Glycine amidinotransferase, mitochondrial

Overview
NameGlycine amidinotransferase, mitochondrial
Smed IDSMED30032169
Length (bp)1380
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Glycine amidinotransferase, mitochondrial (SMED30032169) t-SNE clustered cells

Violin plots show distribution of expression levels for Glycine amidinotransferase, mitochondrial (SMED30032169) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Glycine amidinotransferase, mitochondrial (SMED30032169) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Glycine amidinotransferase, mitochondrial (SMED30032169) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032169

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30032169SMESG000043142.1 SmedASXL_010749SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
epidermal cellSMED30032169SMESG000043142.1 dd_Smed_v4_1943_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30032169SMESG000043142.1 dd_Smed_v6_1943_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
gutSMED30032169SMESG000043142.1 SMED30032169smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30032169SMESG000043142.1 SMED30032169smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
Category 3 cellSMED30032169SMESG000043142.1 dd_Smed_v6_1943_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30032169SMESG000043142.1 dd_Smed_v4_1943_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Human
Match: GATM (glycine amidinotransferase [Source:HGNC Symbol;Acc:HGNC:4175])

HSP 1 Score: 339.347 bits (869), Expect = 1.606e-112
Identity = 182/383 (47.52%), Postives = 239/383 (62.40%), Query Frame = 1
Query:  193 SCHDEKKQT------SPVWAWNEWDPLEEVVVGVPNNATLPFPSQEVAATFGPPRLPFFQKHGGKKFSEVMGQEMWMKIENEIKELVRVLEGEGVKVVQPEAIDYDQKWTTPKFSSTGLYAAMPRDFLLIVGDEIIESPMAWRCRYFEYEAYRPLIRKYFNEGARWTSAPKCTMEDALYDMEFDV----------AQEKPYVYVTTELEPCFDAADFTRIGRDIFGQRSHVTNKKAIQWLRRHLAPSGVRVHDIEFDSLYSMHIDTNFFPVKPGMFLLKDGLNCKTPDLLKKSKWDIVIMPKGPHRDEHYKWMNYHGLPNNMLSIDTERVLVEKTEEYMIKFMQEIGFKPIPVSLKFANNLGGGFHCWTADIRRRGKLESYFE 1293
            SC  + K T       PV ++NEWDPLEEV+VG   NA +P  + EV A       PF+QK GG  F     ++   K   EI+E+  +L+ EGV V +P+ ID+  K+ TP F STGLY+AMPRD L++VG+EIIE+PMAWR R+FEY AYR +I+ YF+ GA+WT+APK TM D LY+ ++ +          AQ K   +VTTE EPCFDAADF R GRDIF QRS VTN   I+W+RRHLAP   RVH I F     MHID  F  + PG+ L      C   DL KK+ W I+  P     D+H  WM+   L  N+L +D +RV+V+  E  + K  +++G   I V+++ AN+LGGGFHCWT D+RRRG L+SY +
Sbjct:   49 SCAADDKATEPLPKDCPVSSYNEWDPLEEVIVGRAENACVPPFTIEVKANTYEKYWPFYQKQGGHYFP----KDHLKKAVAEIEEMCNILKTEGVTVRRPDPIDWSLKYKTPDFESTGLYSAMPRDILIVVGNEIIEAPMAWRSRFFEYRAYRSIIKDYFHRGAKWTTAPKPTMADELYNQDYPIHSVEDRHKLAAQGK---FVTTEFEPCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPD-YRVHIISFKDPNPMHIDATFNIIGPGIVLSNPDRPCHQIDLFKKAGWTIITPPTPIIPDDHPLWMSSKWLSMNVLMLDEKRVMVDANEVPIQKMFEKLGITTIKVNIRNANSLGGGFHCWTCDVRRRGTLQSYLD 423          
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Human
Match: GATM (glycine amidinotransferase [Source:HGNC Symbol;Acc:HGNC:4175])

HSP 1 Score: 288.886 bits (738), Expect = 3.489e-93
Identity = 161/348 (46.26%), Postives = 211/348 (60.63%), Query Frame = 1
Query:  193 SCHDEKKQT------SPVWAWNEWDPLEEVVVGVPNNATLPFPSQEVAATFGPPRLPFFQKHGGKKFSEVMGQEMWMKIENEIKELVRVLEGEGVKVVQPEAIDYDQKWTTPKFSSTGLYAAMPRDFLLIVGDEIIESPMAWRCRYFEYEAYRPLIRKYFNEGARWTSAPKCTMEDALYDMEFDV----------AQEKPYVYVTTELEPCFDAADFTRIGRDIFGQRSHVTNKKAIQWLRRHLAPSGVRVHDIEFDSLYSMHIDTNFFPVKPGMFLLKDGLNCKTPDLLKKSKWDIVIMPKGPHRDEHYKWMNYHGLPNNMLSIDTERVLVEKTEEYMIKFMQEIGF 1188
            SC  + K T       PV ++NEWDPLEEV+VG   NA +P  + EV A       PF+QK GG  F     ++   K   EI+E+  +L+ EGV V +P+ ID+  K+ TP F STGLY+AMPRD L++VG+EIIE+PMAWR R+FEY AYR +I+ YF+ GA+WT+APK TM D LY+ ++ +          AQ K   +VTTE EPCFDAADF R GRDIF QRS VTN   I+W+RRHLAP   RVH I F     MHID  F  + PG+ L      C   DL KK+ W I+  P     D+H  WM+   L  N+L +D +RV+V+  E  + K  +++G 
Sbjct:   49 SCAADDKATEPLPKDCPVSSYNEWDPLEEVIVGRAENACVPPFTIEVKANTYEKYWPFYQKQGGHYFP----KDHLKKAVAEIEEMCNILKTEGVTVRRPDPIDWSLKYKTPDFESTGLYSAMPRDILIVVGNEIIEAPMAWRSRFFEYRAYRSIIKDYFHRGAKWTTAPKPTMADELYNQDYPIHSVEDRHKLAAQGK---FVTTEFEPCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPD-YRVHIISFKDPNPMHIDATFNIIGPGIVLSNPDRPCHQIDLFKKAGWTIITPPTPIIPDDHPLWMSSKWLSMNVLMLDEKRVMVDANEVPIQKMFEKLGM 388          
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Human
Match: GATM (glycine amidinotransferase [Source:HGNC Symbol;Acc:HGNC:4175])

HSP 1 Score: 144.05 bits (362), Expect = 2.041e-40
Identity = 67/129 (51.94%), Postives = 93/129 (72.09%), Query Frame = 1
Query:  343 PFFQKHGGKKFSEVMGQEMWMKIENEIKELVRVLEGEGVKVVQPEAIDYDQKWTTPKFSSTGLYAAMPRDFLLIVGDEIIESPMAWRCRYFEYEAYRPLIRKYFNEGARWTSAPKCTMEDALYDMEFDV 729
            PF+QK GG  F     ++   K   EI+E+  +L+ EGV V +P+ ID+  K+ TP F STGLY+AMPRD L++VG+EIIE+PMAWR R+FEY AYR +I+ YF+ GA+WT+APK TM D LY+ ++ +
Sbjct:   32 PFYQKQGGHYFP----KDHLKKAVAEIEEMCNILKTEGVTVRRPDPIDWSLKYKTPDFESTGLYSAMPRDILIVVGNEIIEAPMAWRSRFFEYRAYRSIIKDYFHRGAKWTTAPKPTMADELYNQDYPI 156          
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Zebrafish
Match: gatm (glycine amidinotransferase (L-arginine:glycine amidinotransferase) [Source:NCBI gene;Acc:266799])

HSP 1 Score: 352.443 bits (903), Expect = 7.032e-118
Identity = 180/379 (47.49%), Postives = 240/379 (63.32%), Query Frame = 1
Query:  184 GHYSCHDEKKQTSPVWAWNEWDPLEEVVVGVPNNATLPFPSQEVAATFGPPRLPFFQKHGGKKFSEVMGQEMWMKIENEIKELVRVLEGEGVKVVQPEAIDYDQKWTTPKFSSTGLYAAMPRDFLLIVGDEIIESPMAWRCRYFEYEAYRPLIRKYFNEGARWTSAPKCTMEDALYDMEFDV----------AQEKPYVYVTTELEPCFDAADFTRIGRDIFGQRSHVTNKKAIQWLRRHLAPSGVRVHDIEFDSLYSMHIDTNFFPVKPGMFLLKDGLNCKTPDLLKKSKWDIVIMPKGPHRDEHYKWMNYHGLPNNMLSIDTERVLVEKTEEYMIKFMQEIGFKPIPVSLKFANNLGGGFHCWTADIRRRGKLESYF 1290
             H    +   +  PV A NEWDPLEEV+VG   NA +P  + EV A       PF+Q++GG+ F     +E   K   EI+E+  +L+ EGV V +PE +D+  ++ TP FSSTG+YAAMPRD L++VG+EIIE+PMAWR R+FEY AYRPLI++YF  GARWT+APK TM D LYD ++ +          AQ K   +VTTE EPCFDAADF R G DIF QRS VTN   I+W+RRHL+P+  ++H I F     MHID  F  + PG+ L      C+  ++ KK+ W +V  P     D H  WM+   L  N+L +D +RV+V+  E  + K  + +G K + VS++ AN+LGGGFHCWT D+RRRG L+SYF
Sbjct:   51 AHEQVPEPAAEECPVCAHNEWDPLEEVIVGRAENACVPPFTVEVKANTYEKYWPFYQQYGGQTFP----KEHVQKAVAEIEEMCNILQHEGVTVRRPEPVDWSLEYRTPDFSSTGMYAAMPRDILMVVGNEIIEAPMAWRARFFEYRAYRPLIKEYFRRGARWTTAPKPTMADQLYDQDYPIRTVEDRHKLAAQGK---FVTTEFEPCFDAADFIRAGTDIFVQRSQVTNYMGIEWMRRHLSPT-YKIHIISFKDPNPMHIDATFNIIGPGLVLSNPDRPCRQIEMFKKAGWTVVTPPTPLIPDNHPLWMSSKWLSMNVLMLDEKRVMVDANESTIQKMFESLGIKTVKVSIRHANSLGGGFHCWTTDVRRRGTLQSYF 421          
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Zebrafish
Match: gatm (glycine amidinotransferase (L-arginine:glycine amidinotransferase) [Source:NCBI gene;Acc:266799])

HSP 1 Score: 229.95 bits (585), Expect = 3.327e-72
Identity = 122/242 (50.41%), Postives = 155/242 (64.05%), Query Frame = 1
Query:  184 GHYSCHDEKKQTSPVWAWNEWDPLEEVVVGVPNNATLPFPSQEVAATFGPPRLPFFQKHGGKKFSEVMGQEMWMKIENEIKELVRVLEGEGVKVVQPEAIDYDQKWTTPKFSSTGLYAAMPRDFLLIVGDEIIESPMAWRCRYFEYEAYRPLIRKYFNEGARWTSAPKCTMEDALYDMEFDV----------AQEKPYVYVTTELEPCFDAADFTRIGRDIFGQRSHVTNKKAIQWLRRHLA 879
             H    +   +  PV A NEWDPLEEV+VG   NA +P  + EV             K+GG+ F     +E   K   EI+E+  +L+ EGV V +PE +D+  ++ TP FSSTG+YAAMPRD L++VG+EIIE+PMAWR R+FEY AYRPLI++YF  GARWT+APK TM D LYD ++ +          AQ K   +VTTE EPCFDAADF R G DIF QRS VTN   I+W+RRHL+
Sbjct:   51 AHEQVPEPAAEECPVCAHNEWDPLEEVIVGRAENACVPPFTVEV-------------KYGGQTFP----KEHVQKAVAEIEEMCNILQHEGVTVRRPEPVDWSLEYRTPDFSSTGMYAAMPRDILMVVGNEIIEAPMAWRARFFEYRAYRPLIKEYFRRGARWTTAPKPTMADQLYDQDYPIRTVEDRHKLAAQGK---FVTTEFEPCFDAADFIRAGTDIFVQRSQVTNYMGIEWMRRHLS 272          
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Zebrafish
Match: gatm (glycine amidinotransferase (L-arginine:glycine amidinotransferase) [Source:NCBI gene;Acc:266799])

HSP 1 Score: 209.149 bits (531), Expect = 2.691e-64
Identity = 112/227 (49.34%), Postives = 144/227 (63.44%), Query Frame = 1
Query:  184 GHYSCHDEKKQTSPVWAWNEWDPLEEVVVGVPNNATLPFPSQEVAATFGPPRLPFFQKHGGKKFSEVMGQEMWMKIENEIKELVRVLEGEGVKVVQPEAIDYDQKWTTPKFSSTGLYAAMPRDFLLIVGDEIIESPMAWRCRYFEYEAYRPLIRKYFNEGARWTSAPKCTMEDALYDMEFDV----------AQEKPYVYVTTELEPCFDAADFTRIGRDIFGQRSH 834
             H    +   +  PV A NEWDPLEEV+VG   NA +P  + EV            +++GG+ F     +E   K   EI+E+  +L+ EGV V +PE +D+  ++ TP FSSTG+YAAMPRD L++VG+EIIE+PMAWR R+FEY AYRPLI++YF  GARWT+APK TM D LYD ++ +          AQ K   +VTTE EPCFDAADF R G DIF QRS 
Sbjct:   51 AHEQVPEPAAEECPVCAHNEWDPLEEVIVGRAENACVPPFTVEV------------KQYGGQTFP----KEHVQKAVAEIEEMCNILQHEGVTVRRPEPVDWSLEYRTPDFSSTGMYAAMPRDILMVVGNEIIEAPMAWRARFFEYRAYRPLIKEYFRRGARWTTAPKPTMADQLYDQDYPIRTVEDRHKLAAQGK---FVTTEFEPCFDAADFIRAGTDIFVQRSQ 258          
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Xenopus
Match: tmem222 (transmembrane protein 222 [Source:Xenbase;Acc:XB-GENE-943282])

HSP 1 Score: 359.762 bits (922), Expect = 1.047e-120
Identity = 187/370 (50.54%), Postives = 237/370 (64.05%), Query Frame = 1
Query:  202 DEKKQTSPVWAWNEWDPLEEVVVGVPNNATLPFPSQEVAATFGPPRLPFFQKHGGKKFSEVMGQEMWMKIENEIKELVRVLEGEGVKVVQPEAIDYDQKWTTPKFSSTGLYAAMPRDFLLIVGDEIIESPMAWRCRYFEYEAYRPLIRKYFNEGARWTSAPKCTMEDALYDMEFDV--AQEKPYV-----YVTTELEPCFDAADFTRIGRDIFGQRSHVTNKKAIQWLRRHLAPSGVRVHDIEFDSLYSMHIDTNFFPVKPGMFLLKDGLNCKTPDLLKKSKWDIVIMPKGPHRDEHYKWMNYHGLPNNMLSIDTERVLVEKTEEYMIKFMQEIGFKPIPVSLKFANNLGGGFHCWTADIRRRGKLESYF 1290
            D   Q  PV ++NEWDPLEEV+VG P NA +P  S EV A       PF+QKHGG+ F      E   K   EI+E+  VL  EGV V +PE ID+  K+ TP F STG+YAAMPRD LL+VG+EIIE+PMAWR R+FEY AYRPLI+ YF  GA+WT+APK TM D LYD ++ +   +++  +     +VTTE EPCFDAADF R GRDIF QRS VTN   I+W+RRHLAP   +VH I F     MHID  F  + PG+ L      C   +L KK+ W +V  P     D H  WM+   L  N+L +D +RV+V+  E  + K  +++G   I V+++ AN+LGGGFHCWT DIRRRG L+SYF
Sbjct:   45 DTAVQECPVCSYNEWDPLEEVIVGRPENANVPPFSVEVKANTYEKYWPFYQKHGGQSFP----VEHVKKATEEIEEMCNVLRHEGVVVQRPEVIDWSVKYKTPDFESTGMYAAMPRDILLVVGNEIIEAPMAWRARFFEYRAYRPLIKDYFRRGAKWTTAPKPTMADELYDQDYPIRTVEDRHKLAAMGKFVTTEFEPCFDAADFMRAGRDIFAQRSQVTNYLGIEWMRRHLAPD-YKVHIISFKDPNPMHIDATFNIIGPGLVLSNPDRPCHQIELFKKAGWTVVTPPIPLIPDNHPLWMSSKWLSMNVLMLDEKRVMVDANETSIQKMFEKLGISTIKVNIRHANSLGGGFHCWTCDIRRRGTLQSYF 409          
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Xenopus
Match: tmem222 (transmembrane protein 222 [Source:Xenbase;Acc:XB-GENE-943282])

HSP 1 Score: 359.377 bits (921), Expect = 2.027e-120
Identity = 187/370 (50.54%), Postives = 237/370 (64.05%), Query Frame = 1
Query:  202 DEKKQTSPVWAWNEWDPLEEVVVGVPNNATLPFPSQEVAATFGPPRLPFFQKHGGKKFSEVMGQEMWMKIENEIKELVRVLEGEGVKVVQPEAIDYDQKWTTPKFSSTGLYAAMPRDFLLIVGDEIIESPMAWRCRYFEYEAYRPLIRKYFNEGARWTSAPKCTMEDALYDMEFDV--AQEKPYV-----YVTTELEPCFDAADFTRIGRDIFGQRSHVTNKKAIQWLRRHLAPSGVRVHDIEFDSLYSMHIDTNFFPVKPGMFLLKDGLNCKTPDLLKKSKWDIVIMPKGPHRDEHYKWMNYHGLPNNMLSIDTERVLVEKTEEYMIKFMQEIGFKPIPVSLKFANNLGGGFHCWTADIRRRGKLESYF 1290
            D   Q  PV ++NEWDPLEEV+VG P NA +P  S EV A       PF+QKHGG+ F      E   K   EI+E+  VL  EGV V +PE ID+  K+ TP F STG+YAAMPRD LL+VG+EIIE+PMAWR R+FEY AYRPLI+ YF  GA+WT+APK TM D LYD ++ +   +++  +     +VTTE EPCFDAADF R GRDIF QRS VTN   I+W+RRHLAP   +VH I F     MHID  F  + PG+ L      C   +L KK+ W +V  P     D H  WM+   L  N+L +D +RV+V+  E  + K  +++G   I V+++ AN+LGGGFHCWT DIRRRG L+SYF
Sbjct:   57 DTAVQECPVCSYNEWDPLEEVIVGRPENANVPPFSVEVKANTYEKYWPFYQKHGGQSFP----VEHVKKATEEIEEMCNVLRHEGVVVQRPEVIDWSVKYKTPDFESTGMYAAMPRDILLVVGNEIIEAPMAWRARFFEYRAYRPLIKDYFRRGAKWTTAPKPTMADELYDQDYPIRTVEDRHKLAAMGKFVTTEFEPCFDAADFMRAGRDIFAQRSQVTNYLGIEWMRRHLAPD-YKVHIISFKDPNPMHIDATFNIIGPGLVLSNPDRPCHQIELFKKAGWTVVTPPIPLIPDNHPLWMSSKWLSMNVLMLDEKRVMVDANETSIQKMFEKLGISTIKVNIRHANSLGGGFHCWTCDIRRRGTLQSYF 421          
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Mouse
Match: Gatm (glycine amidinotransferase (L-arginine:glycine amidinotransferase) [Source:MGI Symbol;Acc:MGI:1914342])

HSP 1 Score: 347.821 bits (891), Expect = 6.529e-116
Identity = 185/383 (48.30%), Postives = 239/383 (62.40%), Query Frame = 1
Query:  193 SCHDEKKQT------SPVWAWNEWDPLEEVVVGVPNNATLPFPSQEVAATFGPPRLPFFQKHGGKKFSEVMGQEMWMKIENEIKELVRVLEGEGVKVVQPEAIDYDQKWTTPKFSSTGLYAAMPRDFLLIVGDEIIESPMAWRCRYFEYEAYRPLIRKYFNEGARWTSAPKCTMEDALYDMEFDV----------AQEKPYVYVTTELEPCFDAADFTRIGRDIFGQRSHVTNKKAIQWLRRHLAPSGVRVHDIEFDSLYSMHIDTNFFPVKPGMFLLKDGLNCKTPDLLKKSKWDIVIMPKGPHRDEHYKWMNYHGLPNNMLSIDTERVLVEKTEEYMIKFMQEIGFKPIPVSLKFANNLGGGFHCWTADIRRRGKLESYFE 1293
            SC  E K T       PV ++NEWDPLEEV+VG   NA +P  + EV A       PF+QK+GG  F     ++   K   E++E+  +L  EGV V +P+ ID+  K+ TP F STGLY+AMPRD L++VG+EIIE+PMAWR R+FEY AYR +I+ YF+ GA+WT+APK TM D LYD  + +          AQ K   +VTTE EPCFDAADF R GRDIF QRS VTN   I+W+RRHLAP   RVH I F     MHID  F  + PG+ L      C   DL KK+ W IV  P     D+H  WM+   L  N+L +D +RV+V+  E  + K  +++G   I V+++ AN+LGGGFHCWT D+RRRG L+SYF+
Sbjct:   49 SCAAEDKATHPLPKDCPVSSYNEWDPLEEVIVGRAENACVPPFTVEVKANTYEKYWPFYQKNGGLYFP----KDHLKKAVAEVEEMCNILSMEGVTVRRPDPIDWSLKYKTPDFESTGLYSAMPRDILMVVGNEIIEAPMAWRSRFFEYRAYRSIIKDYFHRGAKWTTAPKPTMADELYDQNYPIHSVEDRHKLAAQGK---FVTTEFEPCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPD-YRVHIISFKDPNPMHIDATFNIIGPGLVLSNPDRPCHQIDLFKKAGWTIVTPPTPVIPDDHPLWMSSKWLSMNVLMLDEKRVMVDANEVPIQKMFEKLGISTIKVNIRNANSLGGGFHCWTCDVRRRGTLQSYFD 423          
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Mouse
Match: Gatm (glycine amidinotransferase (L-arginine:glycine amidinotransferase) [Source:MGI Symbol;Acc:MGI:1914342])

HSP 1 Score: 347.821 bits (891), Expect = 6.529e-116
Identity = 185/383 (48.30%), Postives = 239/383 (62.40%), Query Frame = 1
Query:  193 SCHDEKKQT------SPVWAWNEWDPLEEVVVGVPNNATLPFPSQEVAATFGPPRLPFFQKHGGKKFSEVMGQEMWMKIENEIKELVRVLEGEGVKVVQPEAIDYDQKWTTPKFSSTGLYAAMPRDFLLIVGDEIIESPMAWRCRYFEYEAYRPLIRKYFNEGARWTSAPKCTMEDALYDMEFDV----------AQEKPYVYVTTELEPCFDAADFTRIGRDIFGQRSHVTNKKAIQWLRRHLAPSGVRVHDIEFDSLYSMHIDTNFFPVKPGMFLLKDGLNCKTPDLLKKSKWDIVIMPKGPHRDEHYKWMNYHGLPNNMLSIDTERVLVEKTEEYMIKFMQEIGFKPIPVSLKFANNLGGGFHCWTADIRRRGKLESYFE 1293
            SC  E K T       PV ++NEWDPLEEV+VG   NA +P  + EV A       PF+QK+GG  F     ++   K   E++E+  +L  EGV V +P+ ID+  K+ TP F STGLY+AMPRD L++VG+EIIE+PMAWR R+FEY AYR +I+ YF+ GA+WT+APK TM D LYD  + +          AQ K   +VTTE EPCFDAADF R GRDIF QRS VTN   I+W+RRHLAP   RVH I F     MHID  F  + PG+ L      C   DL KK+ W IV  P     D+H  WM+   L  N+L +D +RV+V+  E  + K  +++G   I V+++ AN+LGGGFHCWT D+RRRG L+SYF+
Sbjct:   49 SCAAEDKATHPLPKDCPVSSYNEWDPLEEVIVGRAENACVPPFTVEVKANTYEKYWPFYQKNGGLYFP----KDHLKKAVAEVEEMCNILSMEGVTVRRPDPIDWSLKYKTPDFESTGLYSAMPRDILMVVGNEIIEAPMAWRSRFFEYRAYRSIIKDYFHRGAKWTTAPKPTMADELYDQNYPIHSVEDRHKLAAQGK---FVTTEFEPCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPD-YRVHIISFKDPNPMHIDATFNIIGPGLVLSNPDRPCHQIDLFKKAGWTIVTPPTPVIPDDHPLWMSSKWLSMNVLMLDEKRVMVDANEVPIQKMFEKLGISTIKVNIRNANSLGGGFHCWTCDVRRRGTLQSYFD 423          
BLAST of Glycine amidinotransferase, mitochondrial vs. UniProt/SwissProt
Match: sp|Q9IAJ6|GATM_XENLA (Glycine amidinotransferase, mitochondrial OS=Xenopus laevis OX=8355 GN=gatm PE=2 SV=2)

HSP 1 Score: 360.147 bits (923), Expect = 6.882e-120
Identity = 186/370 (50.27%), Postives = 239/370 (64.59%), Query Frame = 1
Query:  202 DEKKQTSPVWAWNEWDPLEEVVVGVPNNATLPFPSQEVAATFGPPRLPFFQKHGGKKFSEVMGQEMWMKIENEIKELVRVLEGEGVKVVQPEAIDYDQKWTTPKFSSTGLYAAMPRDFLLIVGDEIIESPMAWRCRYFEYEAYRPLIRKYFNEGARWTSAPKCTMEDALYDMEFDV--AQEKPYV-----YVTTELEPCFDAADFTRIGRDIFGQRSHVTNKKAIQWLRRHLAPSGVRVHDIEFDSLYSMHIDTNFFPVKPGMFLLKDGLNCKTPDLLKKSKWDIVIMPKGPHRDEHYKWMNYHGLPNNMLSIDTERVLVEKTEEYMIKFMQEIGFKPIPVSLKFANNLGGGFHCWTADIRRRGKLESYF 1290
            D   Q  PV ++NEWDPLEEV+VG P NA +P  S EV A       PF+QKHGG+ F      +   K   EI+E+ +VL+ EGV V +PE ID+  K+ TP F STG+YAAMPRD LL+VG+EIIE+PMAWR R+FEY AYRPLI+ YF  GA+WT+APK TM D LYD ++ +   +++  +     +VTTE EPCFDAADF R GRDIF QRS VTN   I+W+RRHLAP   +VH I F     MHID  F  + PG+ L      C   +L KK+ W +V  P     D H  WM+   L  N+L +D +RV+V+  E  + K  +++G   I V+++ AN+LGGGFHCWT DIRRRG L+SYF
Sbjct:   57 DTAAQECPVCSYNEWDPLEEVIVGRPENANVPPFSVEVKANTYEKYWPFYQKHGGQSFP----VDHVKKAIEEIEEMCKVLKHEGVIVQRPEVIDWSVKYKTPDFESTGMYAAMPRDILLVVGNEIIEAPMAWRARFFEYRAYRPLIKDYFRRGAKWTTAPKPTMADELYDQDYPIRTVEDRHKLAAMGKFVTTEFEPCFDAADFMRAGRDIFAQRSQVTNYLGIEWMRRHLAPD-YKVHIISFKDPNPMHIDATFNIIGPGLVLSNPDRPCHQIELFKKAGWTVVTPPTPLIPDNHPLWMSSKWLSMNVLMLDEKRVMVDANETSIHKMFEKLGISTIKVNIRHANSLGGGFHCWTCDIRRRGTLQSYF 421          
BLAST of Glycine amidinotransferase, mitochondrial vs. UniProt/SwissProt
Match: sp|Q6P832|GATM_XENTR (Glycine amidinotransferase, mitochondrial OS=Xenopus tropicalis OX=8364 GN=gatm PE=2 SV=1)

HSP 1 Score: 359.377 bits (921), Expect = 1.074e-119
Identity = 187/370 (50.54%), Postives = 237/370 (64.05%), Query Frame = 1
Query:  202 DEKKQTSPVWAWNEWDPLEEVVVGVPNNATLPFPSQEVAATFGPPRLPFFQKHGGKKFSEVMGQEMWMKIENEIKELVRVLEGEGVKVVQPEAIDYDQKWTTPKFSSTGLYAAMPRDFLLIVGDEIIESPMAWRCRYFEYEAYRPLIRKYFNEGARWTSAPKCTMEDALYDMEFDV--AQEKPYV-----YVTTELEPCFDAADFTRIGRDIFGQRSHVTNKKAIQWLRRHLAPSGVRVHDIEFDSLYSMHIDTNFFPVKPGMFLLKDGLNCKTPDLLKKSKWDIVIMPKGPHRDEHYKWMNYHGLPNNMLSIDTERVLVEKTEEYMIKFMQEIGFKPIPVSLKFANNLGGGFHCWTADIRRRGKLESYF 1290
            D   Q  PV ++NEWDPLEEV+VG P NA +P  S EV A       PF+QKHGG+ F      E   K   EI+E+  VL  EGV V +PE ID+  K+ TP F STG+YAAMPRD LL+VG+EIIE+PMAWR R+FEY AYRPLI+ YF  GA+WT+APK TM D LYD ++ +   +++  +     +VTTE EPCFDAADF R GRDIF QRS VTN   I+W+RRHLAP   +VH I F     MHID  F  + PG+ L      C   +L KK+ W +V  P     D H  WM+   L  N+L +D +RV+V+  E  + K  +++G   I V+++ AN+LGGGFHCWT DIRRRG L+SYF
Sbjct:   57 DTAVQECPVCSYNEWDPLEEVIVGRPENANVPPFSVEVKANTYEKYWPFYQKHGGQSFP----VEHVKKATEEIEEMCNVLRHEGVVVQRPEVIDWSVKYKTPDFESTGMYAAMPRDILLVVGNEIIEAPMAWRARFFEYRAYRPLIKDYFRRGAKWTTAPKPTMADELYDQDYPIRTVEDRHKLAAMGKFVTTEFEPCFDAADFMRAGRDIFAQRSQVTNYLGIEWMRRHLAPD-YKVHIISFKDPNPMHIDATFNIIGPGLVLSNPDRPCHQIELFKKAGWTVVTPPIPLIPDNHPLWMSSKWLSMNVLMLDEKRVMVDANETSIQKMFEKLGISTIKVNIRHANSLGGGFHCWTCDIRRRGTLQSYF 421          
BLAST of Glycine amidinotransferase, mitochondrial vs. UniProt/SwissProt
Match: sp|Q6PH19|GATM_DANRE (Glycine amidinotransferase, mitochondrial OS=Danio rerio OX=7955 GN=gatm PE=2 SV=1)

HSP 1 Score: 352.443 bits (903), Expect = 6.112e-117
Identity = 180/379 (47.49%), Postives = 240/379 (63.32%), Query Frame = 1
Query:  184 GHYSCHDEKKQTSPVWAWNEWDPLEEVVVGVPNNATLPFPSQEVAATFGPPRLPFFQKHGGKKFSEVMGQEMWMKIENEIKELVRVLEGEGVKVVQPEAIDYDQKWTTPKFSSTGLYAAMPRDFLLIVGDEIIESPMAWRCRYFEYEAYRPLIRKYFNEGARWTSAPKCTMEDALYDMEFDV----------AQEKPYVYVTTELEPCFDAADFTRIGRDIFGQRSHVTNKKAIQWLRRHLAPSGVRVHDIEFDSLYSMHIDTNFFPVKPGMFLLKDGLNCKTPDLLKKSKWDIVIMPKGPHRDEHYKWMNYHGLPNNMLSIDTERVLVEKTEEYMIKFMQEIGFKPIPVSLKFANNLGGGFHCWTADIRRRGKLESYF 1290
             H    +   +  PV A NEWDPLEEV+VG   NA +P  + EV A       PF+Q++GG+ F     +E   K   EI+E+  +L+ EGV V +PE +D+  ++ TP FSSTG+YAAMPRD L++VG+EIIE+PMAWR R+FEY AYRPLI++YF  GARWT+APK TM D LYD ++ +          AQ K   +VTTE EPCFDAADF R G DIF QRS VTN   I+W+RRHL+P+  ++H I F     MHID  F  + PG+ L      C+  ++ KK+ W +V  P     D H  WM+   L  N+L +D +RV+V+  E  + K  + +G K + VS++ AN+LGGGFHCWT D+RRRG L+SYF
Sbjct:   51 AHEQVPEPTAEECPVCAHNEWDPLEEVIVGRAENACVPPFTVEVKANTYEKYWPFYQQYGGQTFP----KEHVQKAVAEIEEMCNILQHEGVTVRRPEPVDWSLEYRTPDFSSTGMYAAMPRDILMVVGNEIIEAPMAWRARFFEYRAYRPLIKEYFRRGARWTTAPKPTMADQLYDQDYPIRTVEDRHKLAAQGK---FVTTEFEPCFDAADFIRAGTDIFVQRSQVTNYMGIEWMRRHLSPT-YKIHIISFKDPNPMHIDATFNIIGPGLVLSNPDRPCRQIEMFKKAGWTVVTPPTPLIPDNHPLWMSSKWLSMNVLMLDEKRVMVDANESTIQKMFESLGIKTVKVSIRHANSLGGGFHCWTTDVRRRGTLQSYF 421          
BLAST of Glycine amidinotransferase, mitochondrial vs. UniProt/SwissProt
Match: sp|P50442|GATM_RAT (Glycine amidinotransferase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Gatm PE=1 SV=1)

HSP 1 Score: 348.206 bits (892), Expect = 2.599e-115
Identity = 185/383 (48.30%), Postives = 240/383 (62.66%), Query Frame = 1
Query:  193 SCHDEKKQT------SPVWAWNEWDPLEEVVVGVPNNATLPFPSQEVAATFGPPRLPFFQKHGGKKFSEVMGQEMWMKIENEIKELVRVLEGEGVKVVQPEAIDYDQKWTTPKFSSTGLYAAMPRDFLLIVGDEIIESPMAWRCRYFEYEAYRPLIRKYFNEGARWTSAPKCTMEDALYDMEFDV----------AQEKPYVYVTTELEPCFDAADFTRIGRDIFGQRSHVTNKKAIQWLRRHLAPSGVRVHDIEFDSLYSMHIDTNFFPVKPGMFLLKDGLNCKTPDLLKKSKWDIVIMPKGPHRDEHYKWMNYHGLPNNMLSIDTERVLVEKTEEYMIKFMQEIGFKPIPVSLKFANNLGGGFHCWTADIRRRGKLESYFE 1293
            SC  E K T       PV ++NEWDPLEEV+VG   NA +P  + EV A       PF+QK+GG  F     ++   K   E++E+  +L  EGV V +P+ ID+  K+ TP F STGLY+AMPRD L++VG+EIIE+PMAWR R+FEY AYR +I+ YF+ GA+WT+APK TM D LYD ++ +          AQ K   +VTTE EPCFDAADF R GRDIF QRS VTN   I+W+RRHLAP   RVH I F     MHID  F  + PG+ L      C   DL KK+ W IV  P     D+H  WM+   L  N+L +D +RV+V+  E  + K  +++G   I V+++ AN+LGGGFHCWT D+RRRG L+SYF+
Sbjct:   49 SCAAEDKATHPLPKDCPVSSYNEWDPLEEVIVGRAENACVPPFTVEVKANTYEKYWPFYQKNGGLYFP----KDHLKKAVAEVEEMCNILSMEGVTVKRPDPIDWSLKYKTPDFESTGLYSAMPRDILMVVGNEIIEAPMAWRSRFFEYRAYRSIIKDYFHRGAKWTTAPKPTMADELYDQDYPIHSVEDRHKLAAQGK---FVTTEFEPCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPD-YRVHIISFKDPNPMHIDATFNIIGPGLVLSNPDRPCHQIDLFKKAGWTIVTPPTPVIPDDHPLWMSSKWLSMNVLMLDEKRVMVDANEVPIQKMFEKLGISTIKVNIRNANSLGGGFHCWTCDVRRRGTLQSYFD 423          
BLAST of Glycine amidinotransferase, mitochondrial vs. UniProt/SwissProt
Match: sp|Q9D964|GATM_MOUSE (Glycine amidinotransferase, mitochondrial OS=Mus musculus OX=10090 GN=Gatm PE=1 SV=1)

HSP 1 Score: 347.821 bits (891), Expect = 4.567e-115
Identity = 185/383 (48.30%), Postives = 239/383 (62.40%), Query Frame = 1
Query:  193 SCHDEKKQT------SPVWAWNEWDPLEEVVVGVPNNATLPFPSQEVAATFGPPRLPFFQKHGGKKFSEVMGQEMWMKIENEIKELVRVLEGEGVKVVQPEAIDYDQKWTTPKFSSTGLYAAMPRDFLLIVGDEIIESPMAWRCRYFEYEAYRPLIRKYFNEGARWTSAPKCTMEDALYDMEFDV----------AQEKPYVYVTTELEPCFDAADFTRIGRDIFGQRSHVTNKKAIQWLRRHLAPSGVRVHDIEFDSLYSMHIDTNFFPVKPGMFLLKDGLNCKTPDLLKKSKWDIVIMPKGPHRDEHYKWMNYHGLPNNMLSIDTERVLVEKTEEYMIKFMQEIGFKPIPVSLKFANNLGGGFHCWTADIRRRGKLESYFE 1293
            SC  E K T       PV ++NEWDPLEEV+VG   NA +P  + EV A       PF+QK+GG  F     ++   K   E++E+  +L  EGV V +P+ ID+  K+ TP F STGLY+AMPRD L++VG+EIIE+PMAWR R+FEY AYR +I+ YF+ GA+WT+APK TM D LYD  + +          AQ K   +VTTE EPCFDAADF R GRDIF QRS VTN   I+W+RRHLAP   RVH I F     MHID  F  + PG+ L      C   DL KK+ W IV  P     D+H  WM+   L  N+L +D +RV+V+  E  + K  +++G   I V+++ AN+LGGGFHCWT D+RRRG L+SYF+
Sbjct:   49 SCAAEDKATHPLPKDCPVSSYNEWDPLEEVIVGRAENACVPPFTVEVKANTYEKYWPFYQKNGGLYFP----KDHLKKAVAEVEEMCNILSMEGVTVRRPDPIDWSLKYKTPDFESTGLYSAMPRDILMVVGNEIIEAPMAWRSRFFEYRAYRSIIKDYFHRGAKWTTAPKPTMADELYDQNYPIHSVEDRHKLAAQGK---FVTTEFEPCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPD-YRVHIISFKDPNPMHIDATFNIIGPGLVLSNPDRPCHQIDLFKKAGWTIVTPPTPVIPDDHPLWMSSKWLSMNVLMLDEKRVMVDANEVPIQKMFEKLGISTIKVNIRNANSLGGGFHCWTCDVRRRGTLQSYFD 423          
BLAST of Glycine amidinotransferase, mitochondrial vs. TrEMBL
Match: A0A183T833 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS12631 PE=4 SV=1)

HSP 1 Score: 371.703 bits (953), Expect = 5.464e-122
Identity = 179/365 (49.04%), Postives = 239/365 (65.48%), Query Frame = 1
Query:  223 PVWAWNEWDPLEEVVVGVPNNATLPFPSQEVAATFGPPRLPFFQKHGGKKFSEVMGQEMWMKIENEIKELVRVLEGEGVKVVQPEAIDYDQKWTTPKFSSTGLYAAMPRDFLLIVGDEIIESPMAWRCRYFEYEAYRPLIRKYFNEGARWTSAPKCTMEDALYDMEFDVAQE-------KPYVYVTTELEPCFDAADFTRIGRDIFGQRSHVTNKKAIQWLRRHLAPSGVRVHDIEFDSLYSMHIDTNFFPVKPGMFLLKDGLNCKTPDLLKKSKWDIVIMPKGPHRDEHYKWMNYHGLPNNMLSIDTERVLVEKTEEYMIKFMQEIGFKPIPVSLKFANNLGGGFHCWTADIRRRGKLESYFEW 1296
            PV +WNEWDPLE ++VG P  AT+P    EV A     +  FF+++ GK +++ + ++ W K+E+ IK LV +L+ EG++VV+P  ID+ +++ T  F STG YAAMPRDFLLIVGDEIIE+ M WR R+FEY AYRPLI +Y+ +GA+WT+APK      L D  ++   E         Y YVTTE EPCFDAADF R GRDIF QRS VTN   I WLRRHLAP G+RVH + F     MHID  F  VKPG+ +      C   ++L+ + W +V  P    +D+H  W+    L  N + +D +RVLVEK E  + +  +  G  PIPVS+++AN++GGGFHCWT+DIRRRG  +SYF+W
Sbjct:   45 PVCSWNEWDPLEAIIVGTPEGATVPKLLPEVKACTASQQWKFFEENAGKLWADSIPRKHWQKLEDNIKGLVLILQNEGIEVVRPTPIDFQKEYQTTDFKSTGFYAAMPRDFLLIVGDEIIEATMTWRSRFFEYVAYRPLIIQYWRDGAQWTTAPKPICGSNLIDKTYEAIDEVHRNSLMNSYQYVTTESEPCFDAADFIRAGRDIFAQRSQVTNLAGIDWLRRHLAPKGIRVHQLTFRDARPMHIDATFCLVKPGLAIQNPDRPCDQAEILRAAGWKVVNAPPPLIKDDHPLWLGSKWLSMNTIMLDEKRVLVEKEETTLQELYRANGVTPIPVSMRYANSIGGGFHCWTSDIRRRGGPQSYFDW 409          
BLAST of Glycine amidinotransferase, mitochondrial vs. TrEMBL
Match: A0A0X3NYE3 (Uncharacterized protein (Fragment) OS=Schistocephalus solidus OX=70667 GN=TR115159 PE=4 SV=1)

HSP 1 Score: 372.089 bits (954), Expect = 8.503e-122
Identity = 179/365 (49.04%), Postives = 239/365 (65.48%), Query Frame = 1
Query:  223 PVWAWNEWDPLEEVVVGVPNNATLPFPSQEVAATFGPPRLPFFQKHGGKKFSEVMGQEMWMKIENEIKELVRVLEGEGVKVVQPEAIDYDQKWTTPKFSSTGLYAAMPRDFLLIVGDEIIESPMAWRCRYFEYEAYRPLIRKYFNEGARWTSAPKCTMEDALYDMEFDVAQE-------KPYVYVTTELEPCFDAADFTRIGRDIFGQRSHVTNKKAIQWLRRHLAPSGVRVHDIEFDSLYSMHIDTNFFPVKPGMFLLKDGLNCKTPDLLKKSKWDIVIMPKGPHRDEHYKWMNYHGLPNNMLSIDTERVLVEKTEEYMIKFMQEIGFKPIPVSLKFANNLGGGFHCWTADIRRRGKLESYFEW 1296
            PV +WNEWDPLE ++VG P  AT+P    EV A     +  FF+++ GK +++ + ++ W K+E+ IK LV +L+ EG++VV+P  ID+ +++ T  F STG YAAMPRDFLLIVGDEIIE+ M WR R+FEY AYRPLI +Y+ +GA+WT+APK      L D  ++   E         Y YVTTE EPCFDAADF R GRDIF QRS VTN   I WLRRHLAP G+RVH + F     MHID  F  VKPG+ +      C   ++L+ + W +V  P    +D+H  W+    L  N + +D +RVLVEK E  + +  +  G  PIPVS+++AN++GGGFHCWT+DIRRRG  +SYF+W
Sbjct:   72 PVCSWNEWDPLEAIIVGTPEGATVPKLLPEVKACTASQQWKFFEENAGKLWADSIPRKHWQKLEDNIKGLVLILQNEGIEVVRPTPIDFQKEYQTTDFKSTGFYAAMPRDFLLIVGDEIIEATMTWRSRFFEYVAYRPLIIQYWRDGAQWTTAPKPICGSNLIDKTYEAIDEVHRNSLMNSYQYVTTESEPCFDAADFIRAGRDIFAQRSQVTNLAGIDWLRRHLAPKGIRVHQLTFRDARPMHIDATFCLVKPGLAIQNPDRPCDQAEILRAAGWKVVNAPPPLIKDDHPLWLGSKWLSMNTIMLDEKRVLVEKEETTLQELYRANGVTPIPVSMRYANSIGGGFHCWTSDIRRRGGPQSYFDW 436          
BLAST of Glycine amidinotransferase, mitochondrial vs. TrEMBL
Match: A0A1S3J2H9 (glycine amidinotransferase, mitochondrial OS=Lingula unguis OX=7574 GN=LOC106169635 PE=4 SV=1)

HSP 1 Score: 364.77 bits (935), Expect = 3.160e-119
Identity = 184/369 (49.86%), Postives = 240/369 (65.04%), Query Frame = 1
Query:  220 SPVWAWNEWDPLEEVVVGVPNNATLPFPSQEVAATFGPPRLPFFQKHGGKKFSEVMGQEMWMKIENEIKELVRVLEGEGVKVVQPEAIDYDQKWTTPKFSSTGLYAAMPRDFLLIVGDEIIESPMAWRCRYFEYEAYRPLIRKYFNEGARWTSAPKCTMEDALYDMEFDVA--QEKPYV-----YVTTELEPCFDAADFTRIGRDIFGQRSHVTNKKAIQWLRRHLAPSGVRVHDIEFDSLYSMHIDTNFFPVKPGMFLLKDGLNCKTPDLLKKSKWDIVIMPKGPHRDEHYKWMNYHGLPNNMLSIDTERVLVEKTEEYMIKFMQEIGFKPIPVSLKFANNLGGGFHCWTADIRRRGKLESYFEWPDE 1305
            SPVW+WNEWDPL+EV+VG    AT+P  + EV A        FF  HGGK F      E   K   EI+E   +L+ EGV V +P+ +D+ Q + TP F S GLY+AMPRD L ++GDEIIE+PMAWR R+FEY AYR LI++YF +GARWT+APK TM DALYD  + ++  +E+  +     +VTTE EPCFDAADF R GRDIF QRS VTN   I+W+RRHLAP G+RVH + F     MHID  F  + PG+ L      C   ++  K+ W +V  P     D+H  WM+   L  N+L +D +RVLVEK E    K  +++G + +PVS++ AN+LGGGFHCWT D+RR G LESYF+ P++
Sbjct:   58 SPVWSWNEWDPLKEVIVGRVEGATIPKFTVEVKANTYEKHWEFFTAHGGKGFP----AEHMQKAAEEIEEFCNILKHEGVHVRRPDHVDFSQIYKTPDFESPGLYSAMPRDILTVIGDEIIEAPMAWRSRFFEYRAYRSLIKEYFRKGARWTTAPKPTMSDALYDQNYPMSCVEERHKLAAQGKFVTTEHEPCFDAADFMRAGRDIFAQRSQVTNYMGIEWMRRHLAPRGIRVHVVSFKDPNPMHIDATFNIIGPGLVLSNPDRPCNQIEMFHKAGWTVVKPPTPLIPDDHPLWMSSKWLSMNVLMLDPKRVLVEKHETTTQKMFEKLGIECVPVSIRHANSLGGGFHCWTCDVRREGILESYFDVPED 422          
BLAST of Glycine amidinotransferase, mitochondrial vs. TrEMBL
Match: H2KUH6 (Glycine amidinotransferase mitochondrial OS=Clonorchis sinensis OX=79923 GN=CLF_109091 PE=4 SV=1)

HSP 1 Score: 361.688 bits (927), Expect = 2.803e-118
Identity = 175/368 (47.55%), Postives = 238/368 (64.67%), Query Frame = 1
Query:  211 KQTSPVWAWNEWDPLEEVVVGVPNNATLPFPSQEVAATFGPPRLPFFQKHGGKKFSEVMGQEMWMKIENEIKELVRVLEGEGVKVVQPEAIDYDQKWTTPKFSSTGLYAAMPRDFLLIVGDEIIESPMAWRCRYFEYEAYRPLIRKYFNEGARWTSAPKCTMEDALYDMEFD------VAQEKPYVYVTTELEPCFDAADFTRIGRDIFGQRSHVTNKKAIQWLRRHLAPSGVRVHDIEFDSLYSMHIDTNFFPVKPGMFLLKDGLNCKTPDLLKKSKWDIVIMPKGPHRDEHYKWMNYHGLPNNMLSIDTERVLVEKTEEYMIKFMQEIGFKPIPVSLKFANNLGGGFHCWTADIRRRGKLESYFEW 1296
              +SPVW+WNEWDPLEE++VG P  A +P P  EV          F++K+ G+ +++ + +E W K+  E++E VRVL+ EGVKV++P  +D+   +    F S G YAAMPRDFLL++G+E+IE+ M WR RYFEY AYRPLI +Y+ +GA+WT APK T  DA+ + E        V+ +    ++TTE EPCFDAADFTR GRDIF QRS VTN   I+W+RRH+ P G+RVH + F     MHID  F   KPG+ +      C   +L+K + WD++  P       H  W+    L  N+L +D ERVLVEK E  + +  + IG  PIPV+L+ AN++GG FHCWT+DI+RRG LESYF+W
Sbjct:   40 NSSSPVWSWNEWDPLEEIIVGTPEGAVVPRPLPEVKMCTPMDTWEFYEKNAGRYWADCIPKEHWEKVVKEVEEYVRVLQMEGVKVLRPSKVDHSSTFKLLGFESQGFYAAMPRDFLLVIGNELIEATMTWRSRYFEYLAYRPLILEYWKQGAKWTVAPKPTDFDAIINKEVTKKLDSGVSDKSNIGFITTESEPCFDAADFTRAGRDIFCQRSQVTNLAGIEWVRRHVEPLGIRVHQLTFTDPRPMHIDATFVFAKPGIAIQNPDRPCDQTELIKAAGWDVIDAPTPNVPKSHPYWLGSPWLSMNVLMLDPERVLVEKGETAIHEMYRRIGITPIPVALRHANSIGGSFHCWTSDIKRRGNLESYFDW 407          
BLAST of Glycine amidinotransferase, mitochondrial vs. TrEMBL
Match: A0A1L8GSU2 (Uncharacterized protein OS=Xenopus laevis OX=8355 GN=gatm PE=4 SV=1)

HSP 1 Score: 360.918 bits (925), Expect = 8.471e-118
Identity = 186/370 (50.27%), Postives = 238/370 (64.32%), Query Frame = 1
Query:  202 DEKKQTSPVWAWNEWDPLEEVVVGVPNNATLPFPSQEVAATFGPPRLPFFQKHGGKKFSEVMGQEMWMKIENEIKELVRVLEGEGVKVVQPEAIDYDQKWTTPKFSSTGLYAAMPRDFLLIVGDEIIESPMAWRCRYFEYEAYRPLIRKYFNEGARWTSAPKCTMEDALYDMEFDV--AQEKPYV-----YVTTELEPCFDAADFTRIGRDIFGQRSHVTNKKAIQWLRRHLAPSGVRVHDIEFDSLYSMHIDTNFFPVKPGMFLLKDGLNCKTPDLLKKSKWDIVIMPKGPHRDEHYKWMNYHGLPNNMLSIDTERVLVEKTEEYMIKFMQEIGFKPIPVSLKFANNLGGGFHCWTADIRRRGKLESYF 1290
            D   Q SPV ++NEWDPLEEV+VG P NA +P  S EV A       PF+QKHGG+ F      +   K   EI+E+  VL  EGV V +PE ID+  K+ TP F STG+YAAMPRD LL+VG+EIIE+PMAWR R+FEY AYRPLI+ YF  GA+WT+APK TM D LYD ++ +   +++  +     +VTTE EPCFDAADF R GRDIF QRS VTN   I+W+RRHLAP   +VH I F     MHID  F  + PG+ L      C   +L KK+ W +V  P     D H  WM+   L  N+L +D +RV+V+  E  + K  +++G   + V+++ AN+LGGGFHCWT DIRRRG L+SYF
Sbjct:   57 DPAAQESPVCSYNEWDPLEEVIVGRPENANVPEFSVEVKANTYEKYWPFYQKHGGQSFP----VDHVKKATEEIEEMCNVLRHEGVIVQRPEVIDWSVKYKTPDFESTGMYAAMPRDILLVVGNEIIEAPMAWRARFFEYRAYRPLIKDYFRRGAKWTTAPKPTMADELYDQDYPIRTVEDRHKLAAMGKFVTTEFEPCFDAADFMRAGRDIFAQRSQVTNYLGIEWMRRHLAPD-YKVHIISFKDPNPMHIDATFNIIGPGLVLSNPDRPCHQIELFKKAGWTVVTPPTPLIPDNHPLWMSSKWLSMNVLMLDEKRVMVDANETSIQKMFEKLGISTVKVNIRHANSLGGGFHCWTCDIRRRGTLQSYF 421          
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Cavefish
Match: gatm (glycine amidinotransferase [Source:NCBI gene;Acc:103044592])

HSP 1 Score: 351.673 bits (901), Expect = 9.837e-118
Identity = 183/372 (49.19%), Postives = 240/372 (64.52%), Query Frame = 1
Query:  205 EKKQTSPVWAWNEWDPLEEVVVGVPNNATLPFPSQEVAATFGPPRLPFFQKHGGKKFSEVMGQEMWMKIENEIKELVRVLEGEGVKVVQPEAIDYDQKWTTPKFSSTGLYAAMPRDFLLIVGDEIIESPMAWRCRYFEYEAYRPLIRKYFNEGARWTSAPKCTMEDALYDMEFDV----------AQEKPYVYVTTELEPCFDAADFTRIGRDIFGQRSHVTNKKAIQWLRRHLAPSGVRVHDIEFDSLYSMHIDTNFFPVKPGMFLLKDGLNCKTPDLLKKSKWDIVIMPKGPHRDEHYKWMNYHGLPNNMLSIDTERVLVEKTEEYMIKFMQEIGFKPIPVSLKFANNLGGGFHCWTADIRRRGKLESYF 1290
            E+ +  PV A+NEWDPLEEV+VG   NA +P  + EV A       PF+QK+GG+ F E    E   K   EI+E+  +L  EGV V +PE ID+  ++ TP F+STG+YAAMPRD L++VG+EIIE+PMAWR R+FEY AYRPLI++YF  GA+WT+APK TM D LYD E+ +          A+ K   +VTTE EPCFDAADF R G D+F QRS VTN   I+W+RRHLAP   +VH I F     MHID  F  + PG+ L      C+  ++ KK+ W +V  P     D+H  WM+   L  N+L +D +RV+V+  E  + K  + +G K I VS++ AN+LGGGFHCWT D+RRRG L+SYF
Sbjct:   51 EEVEECPVCAYNEWDPLEEVIVGRAENARVPPFTVEVKANTYEKYWPFYQKYGGQTFPE----EHLKKAIAEIEEMCNILRHEGVTVQRPEPIDWSVEYKTPDFTSTGMYAAMPRDILMVVGNEIIEAPMAWRARFFEYRAYRPLIKEYFRRGAKWTTAPKPTMADELYDQEYPIRTVEDRHKLAAEGK---FVTTEHEPCFDAADFIRAGTDLFVQRSQVTNFLGIEWMRRHLAPH-YKVHIISFKDPNPMHIDATFNIIGPGLVLSNPDRPCRQIEMFKKAGWTVVKPPTPLIPDDHPLWMSSKWLSMNVLMLDEKRVMVDANESTIQKMFENLGIKTIKVSIRHANSLGGGFHCWTTDVRRRGTLQSYF 414          
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Nematostella
Match: EDO35968 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK04])

HSP 1 Score: 352.058 bits (902), Expect = 4.840e-118
Identity = 182/376 (48.40%), Postives = 232/376 (61.70%), Query Frame = 1
Query:  184 GHYSCHDEKKQTSPVWAWNEWDPLEEVVVGVPNNATLPFPSQEVAATFGPPRLPFFQKHGGKKFSEVMGQEMWMKIENEIKELVRVLEGEGVKVVQPEAIDYDQKWTTPKFSSTGLYAAMPRDFLLIVGDEIIESPMAWRCRYFEYEAYRPLIRKYFNEGARWTSAPKCTMEDALYDMEFDVAQ-------EKPYVYVTTELEPCFDAADFTRIGRDIFGQRSHVTNKKAIQWLRRHLAPSGVRVHDIEFDSLYSMHIDTNFFPVKPGMFLLKDGLNCKTPDLLKKSKWDIVIMPKGPHRDEHYKWMNYHGLPNNMLSIDTERVLVEKTEEYMIKFMQEIGFKPIPVSLKFANNLGGGFHCWTADIRRRGKLESYF 1290
            GH +    +    PV + NEWD LEEV+VG    AT+P  + EV A        FF+ +GG+ F      E   K   EI+E   +L  EGV V +PE ID+ +   TP F S+GLY+AMPRD LL+VGDEIIESPMAWR R+FEY AYRPLI++YF  GARWT+APK  M D LYD+++ +              +VTTE EPCFDAADF R GRDIF QRS VTN   I+W++RHL  +  R+H + FD    MHID  F  + PG+ L      C   D+ KK+ W +V  P+    D H  WM+   L  N+L +D  RV+ +K E   IK  +++G  PIPVS++FAN+LGGGFHCWT D+RRRGKLESY 
Sbjct:   58 GHSATPRTEIADCPVGSHNEWDLLEEVIVGNVEGATVPKFTPEVKANTSHKNWKFFELYGGRPFP----AEHLKKAATEIEEFCNILHHEGVTVRRPEPIDFSEVCKTPDFESSGLYSAMPRDILLVVGDEIIESPMAWRSRFFEYRAYRPLIKEYFRRGARWTTAPKPQMSDELYDLDYPIRSVEDRHKLSSEGKFVTTEFEPCFDAADFMRAGRDIFVQRSQVTNYMGIEWMKRHLG-NQYRIHTLSFDDPNPMHIDATFNIIGPGLVLSNPDRPCHQIDMFKKAGWTVVQPPEPLIPDSHPLWMSSKWLSMNVLMLDPTRVVCDKNETTTIKMFEKLGITPIPVSIRFANSLGGGFHCWTCDVRRRGKLESYL 428          
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Medaka
Match: gatm (glycine amidinotransferase [Source:NCBI gene;Acc:101156236])

HSP 1 Score: 353.984 bits (907), Expect = 1.856e-118
Identity = 182/369 (49.32%), Postives = 239/369 (64.77%), Query Frame = 1
Query:  214 QTSPVWAWNEWDPLEEVVVGVPNNATLPFPSQEVAATFGPPRLPFFQKHGGKKFSEVMGQEMWMKIENEIKELVRVLEGEGVKVVQPEAIDYDQKWTTPKFSSTGLYAAMPRDFLLIVGDEIIESPMAWRCRYFEYEAYRPLIRKYFNEGARWTSAPKCTMEDALYDMEFDV----------AQEKPYVYVTTELEPCFDAADFTRIGRDIFGQRSHVTNKKAIQWLRRHLAPSGVRVHDIEFDSLYSMHIDTNFFPVKPGMFLLKDGLNCKTPDLLKKSKWDIVIMPKGPHRDEHYKWMNYHGLPNNMLSIDTERVLVEKTEEYMIKFMQEIGFKPIPVSLKFANNLGGGFHCWTADIRRRGKLESYF 1290
            Q  PV ++NEWDPLEEV+VG   NA +P  + EV A       PF+QKHGG+ F      +   K   EI+E+  +L  EGV V +PE ID+  ++ TP FSSTG+YAAMPRD L++VG+EIIE+PMAWR R+FEY AYRPLI++YF +GA+WT+APK TM D LYD ++ +          AQ K   +VTTE EPCFDAADF R GRD+F QRS VTN   I+W+RRHLAP   +VH I F     MHID  F  + PG+ L      C+  D+ KK+ W +V  P     D+H  WM+   L  N+L +D +RV+V+  E  + K  + +G + I V+++ AN+LGGGFHCWT D+RRRG L+SYF
Sbjct:   62 QECPVCSYNEWDPLEEVIVGRAENAHVPPFTVEVKANTYEKYWPFYQKHGGQSFP----ADHLKKAVAEIEEMCNILRHEGVVVRRPEPIDWSLEYKTPDFSSTGMYAAMPRDILIVVGNEIIEAPMAWRARFFEYRAYRPLIKEYFRKGAKWTTAPKPTMADELYDQDYPIRTVEDRHKLAAQGK---FVTTEHEPCFDAADFIRAGRDLFVQRSQVTNYMGIEWMRRHLAPD-YKVHIISFKDPNPMHIDATFNIIGPGLVLSNPDRPCRQVDMFKKAGWTVVKPPTPLIPDDHPLWMSSKWLSMNVLMLDEKRVMVDANESTIQKMFESLGIQTIKVNIRHANSLGGGFHCWTTDVRRRGTLQSYF 422          
BLAST of Glycine amidinotransferase, mitochondrial vs. Planmine SMEST
Match: SMESG000043142.1 (SMESG000043142.1)

HSP 1 Score: 809.29 bits (2089), Expect = 0.000e+0
Identity = 408/409 (99.76%), Postives = 409/409 (100.00%), Query Frame = 1
Query:  100 MLSVLRQXXXXXXXXXXXXXXXXXXXYFGHYSCHDEKKQTSPVWAWNEWDPLEEVVVGVPNNATLPFPSQEVAATFGPPRLPFFQKHGGKKFSEVMGQEMWMKIENEIKELVRVLEGEGVKVVQPEAIDYDQKWTTPKFSSTGLYAAMPRDFLLIVGDEIIESPMAWRCRYFEYEAYRPLIRKYFNEGARWTSAPKCTMEDALYDMEFDVAQEKPYVYVTTELEPCFDAADFTRIGRDIFGQRSHVTNKKAIQWLRRHLAPSGVRVHDIEFDSLYSMHIDTNFFPVKPGMFLLKDGLNCKTPDLLKKSKWDIVIMPKGPHRDEHYKWMNYHGLPNNMLSIDTERVLVEKTEEYMIKFMQEIGFKPIPVSLKFANNLGGGFHCWTADIRRRGKLESYFEWPDEILERLTP 1326
            MLSVLRQISHSKSAISSKISVIHISKYFGHYSCHDEKKQTSPVWAWNEWDPLEEVVVGVPNNATLPFPSQEVAATFGPPRLPFFQKHGGKKFSEVMGQEMWMKIENEIKELVRVLEGEGVKVVQPEAIDYDQKWTTPKFSSTGLYAAMPRDFLLIVGDEIIESPMAWRCRYFEYEAYRPLIRKYFNEGARWTSAPKCTMEDALYDMEFDVAQEKPYVYVTTELEPCFDAADFTRIGRDIFGQRSHVTNKKAIQWLRRHLAPSGVRVHDIEFDSLYSMHIDTNFFPVKPGMFLLKDGLNCKTPDLLKKSKWDIVIMPKGPHRDEHYKWMNYHGLPNNMLSIDTERVLVEKTEEYMIKFMQEIGFKPIPVSLKFANNLGGGFHCWTADIRR+GKLESYFEWPDEILERLTP
Sbjct:    1 MLSVLRQISHSKSAISSKISVIHISKYFGHYSCHDEKKQTSPVWAWNEWDPLEEVVVGVPNNATLPFPSQEVAATFGPPRLPFFQKHGGKKFSEVMGQEMWMKIENEIKELVRVLEGEGVKVVQPEAIDYDQKWTTPKFSSTGLYAAMPRDFLLIVGDEIIESPMAWRCRYFEYEAYRPLIRKYFNEGARWTSAPKCTMEDALYDMEFDVAQEKPYVYVTTELEPCFDAADFTRIGRDIFGQRSHVTNKKAIQWLRRHLAPSGVRVHDIEFDSLYSMHIDTNFFPVKPGMFLLKDGLNCKTPDLLKKSKWDIVIMPKGPHRDEHYKWMNYHGLPNNMLSIDTERVLVEKTEEYMIKFMQEIGFKPIPVSLKFANNLGGGFHCWTADIRRQGKLESYFEWPDEILERLTP 409          
BLAST of Glycine amidinotransferase, mitochondrial vs. Planmine SMEST
Match: SMESG000068402.1 (SMESG000068402.1)

HSP 1 Score: 372.474 bits (955), Expect = 5.974e-126
Identity = 181/373 (48.53%), Postives = 243/373 (65.15%), Query Frame = 1
Query:  205 EKKQTSPVWAWNEWDPLEEVVVGVPNNATLPFPSQEVAATFGPPRLPFFQKHGGKKFSEVMGQEMWMKIENEIKELVRVLEGEGVKVVQPEAIDYDQKWTTPKFSSTGLYAAMPRDFLLIVGDEIIESPMAWRCRYFEYEAYRPLIRKYFNEGARWTSAPKCTMEDALYDMEFDVAQEKPYVYVTTELEPCFDAADFTRIGRDIFGQRSHVTNKKAIQWLRRHLAPSGVRVHDIEFDSLYSMHIDTNFFPVKPGMFLLKDGLNCKTPDLLKKSKWDIVIMPKGPHRDEHYKWMNYHGLPNNMLSIDTERVLVEKTEEYMIKFMQEIGFKPIPVSLKFANNLGGGFHCWTADIRRRGKLESYFEWPDEILERLT 1323
            E+K+ SPVW+WNEWD LEE VVG+P+NA +P  + EV A   P    F   +GGK +S+++    W +++NEI+E  +VLEGEGVKVV+PEA D+ + +T   F S G+YAAMPRD +L+VGDE+IES M W+ RYFE+ +YR L++ Y+++GA+WT APK  M D L + ++D         +TTE E CFDAADF R G+DIFGQRS VTN  AI W+RRHLAP G+RVH++ F   + MH+D    PVKPG+FL          D      W+ V +P  P   E   +M+ + L  N L +D  RV +EK E    K  + IG K IPVS+K   ++GGGFHCWT+DI+RRG LE+YF W    L++ T
Sbjct:   45 ERKKKSPVWSWNEWDHLEECVVGIPDNAVVPTMTPEVKACMSPDLWDFLDANGGKYWSDILPDGHWKQLQNEIEEFAKVLEGEGVKVVRPEAQDFGKIFTGLGFCSHGIYAAMPRDLVLVVGDELIESTMTWKSRYFEFVSYRKLLKGYYDKGAKWTVAPKPLMLDELLEKDYDFYGTNKLKRITTEKEICFDAADFFRCGQDIFGQRSQVTNSAAINWMRRHLAPQGIRVHELNFYDAFCMHVDATLVPVKPGVFLKNPKYPLVEMDNFTNCGWEFVDVPT-PLLSEERLYMSSNYLAMNTLMMDPGRVFIEKEETGTQKLFESIGVKSIPVSMKHCFSIGGGFHCWTSDIKRRGTLENYFNWSKPFLDKYT 416          
BLAST of Glycine amidinotransferase, mitochondrial vs. Planmine SMEST
Match: SMESG000051953.1 (SMESG000051953.1)

HSP 1 Score: 371.703 bits (953), Expect = 1.319e-125
Identity = 184/375 (49.07%), Postives = 248/375 (66.13%), Query Frame = 1
Query:  211 KQTSPVWAWNEWDPLEEVVVGVPNNATLPFPSQEVAATFGPPRLP--FFQKHGGKKFSEVMGQEMWMKIENEIKELVRVLEGEGVKVVQPEAIDYDQKWTTPKFSSTGLYAAMPRDFLLIVGDEIIESPMAWRCRYFEYEAYRPLIRKYFNEGARWTSAPKCTMEDALYDMEFDVAQEK--PYVYVTTELEPCFDAADFTRIGRDIFGQRSHVTNKKAIQWLRRHLAPSGVRVHDIEFDSLYSMHIDTNFFPVKPGMFLLKDGLNCKTPDLLKKSKWDIVIMPKGPHRDEHYKWMNYHGLPNNMLSIDTERVLVEKTEEYMIKFMQEIGFKPIPVSLKFANNLGGGFHCWTADIRRRGKLESYFEWPDEILERLT 1323
            K+ SPVW+WNEWDPLEEV+VGVP++  +P+P  E AA FG  RL   F +K+GGK +S++M +E+W  +  E KE   +L+GEGV VV P  +D  +++ TP F S GL  A PRD +L+VGDEI+E+ M WR R++EY  YRPL+  Y+  GA + SAPK    +  +  +FD++  K     YVTTE EP FDAADF R GRDIF Q+SHVTN   I+W+RRHLA  G+R+H + F+  Y+MHID  FF VKPG  +    +     D LKK+ W IV  PK   R + Y+ M+Y  L  N+L +D +RVLVEK E  M K  + IG +PI V       +GGG HCWT+D+RR+G LE+YF+WP E+LE+++
Sbjct:   41 KRNSPVWSWNEWDPLEEVIVGVPDHGVVPYPYPETAACFGE-RLTENFMKKYGGKYWSDIMPKEVWNNVLKEHKEFCNILKGEGVTVVHPTPMDMKKEYETPYFKSVGLDVAFPRDIILVVGDEIMETTMTWRSRFWEYLCYRPLMLDYWKRGANFQSAPKPVCSEESFKKDFDISGNKFDELGYVTTEFEPMFDAADFMRAGRDIFVQQSHVTNATGIEWMRRHLAEKGIRLHLLNFNDPYAMHIDATFFTVKPGYLIENPEVINPYADYLKKAGWKIVKGPKPADRSDMYEGMSYKWLSMNVLVLDQKRVLVEKREVGMHKMFESIGMQPIKVDFGHCFAVGGGLHCWTSDVRRKGTLENYFDWPQEVLEKVS 414          
BLAST of Glycine amidinotransferase, mitochondrial vs. Planmine SMEST
Match: SMESG000051964.1 (SMESG000051964.1)

HSP 1 Score: 338.576 bits (867), Expect = 9.167e-113
Identity = 165/375 (44.00%), Postives = 234/375 (62.40%), Query Frame = 1
Query:  211 KQTSPVWAWNEWDPLEEVVVGVPNNATLPFPSQEVAATFGPPRLPFFQKHGGKKFSEVMGQEMWMKIENEIKELVRVLEGEGVKVVQPEAIDYDQKWTTPKFSSTGLYAAMPRDFLLIVGDEIIESPMAWRCRYFEYEAYRPLIRKYFNEGARWTSAPKCTMEDALYDMEFDVAQEKPYVY-----VTTELEPCFDAADFTRIGRDIFGQRSHVTNKKAIQWLRRHLAPSGVRVHDIEFDSLYSMHIDTNFFPVKPGMFLLKDGLNCKTPDLLKKSKWDIVIMPKGPHRDEHYKWMNYHGLPNNMLSIDTERVLVEKTEEYMIKFMQEIGFKPIPVSLKFANNLGGGFHCWTADIRRRGKLESYFEWPDEILERL 1320
            K+ SPVWAWNEWDPLEE+V+G+P+ A  P    E  A     +  F  KH GK + +V+  E +  + +E K  +++L+GEGVKVV PE ID+ +   TP F++ G+  AMPRDFLLIVG+E+IES M WR RYFE+  Y+ LI+ Y++ GA+WT+APK   ++ L+   +   ++    +     + TE EP FDAADF R GRDIF   S V+N   I+W+RRHLAP G+RVH + F     MHIDT  F  +PG+ +      C    +LKK+ WD+V+ P          +++   L  N++ +D +RVLVEK E  + K  ++ G  P+ V  K   ++GGG HCWT+D+RRRG L++YF+WP EILE+ 
Sbjct:   33 KKHSPVWAWNEWDPLEEIVLGLPDMACCPEILPEAKACISENKFDFLLKHKGKYWKDVIEPEHYKLMLDEHKNFIKILQGEGVKVVHPEPIDFAKTLCTPNFTAHGVDCAMPRDFLLIVGNEMIESTMTWRSRYFEFMCYKKLIKDYWSRGAKWTAAPKPMCKETLFKENYRADEDSTAFFDEKTSILTEEEPVFDAADFIRCGRDIFAHVSQVSNNAGIEWVRRHLAPKGIRVHSMNFVDPKPMHIDTTLFTPRPGLAITCPERPCLQIGMLKKAGWDVVVAPYPDIAKNFPYYISSQWLSLNVVMLDEKRVLVEKDEIGIQKLFEKCGITPVKVPFKHCFSIGGGIHCWTSDVRRRGDLQNYFDWPQEILEKF 407          
BLAST of Glycine amidinotransferase, mitochondrial vs. Planmine SMEST
Match: SMESG000051929.1 (SMESG000051929.1)

HSP 1 Score: 303.138 bits (775), Expect = 2.917e-99
Identity = 147/364 (40.38%), Postives = 213/364 (58.52%), Query Frame = 1
Query:  226 VWAWNEWDPLEEVVVGVPNNATLPFPSQEVAATFGPPRLPFFQKHGGKKFSEVMGQEMWMKIENEIKELVRVLEGEGVKVVQPEAIDYDQKWTTPKFSSTGLYAAMPRDFLLIVGDEIIESPMAWRCRYFEYEAYRPLIRKYFNEGARWTSAPKCTMEDALYDMEFDVAQEKPYV-YVTTELEPCFDAADFTRIGRDIFGQRSHVTNKKAIQWLRRHLAPSGVRVHDIEFDSLYSMHIDTNFFPVKPGMFLLKDGLNCKTPDLLKKSKWDIVIMPKGPHRDEHYKWMNYHGLPNNMLSIDTERVLVEKTEEYMIKFMQEIGFKPIPVSLKFANNLGGGFHCWTADIRRRGKLESYFEWPDEILE 1314
            V  WNEWDPLEE+VVG+P+NA +P  + E          PFF+++ GK +S+V+GQ  W  +  E K     L+ EGVKVV PE  +++ K+      +TG+Y AMPRD LL +G+EIIE+PM WR RYFE  +YR LI  Y+  GA W +APK T     Y+  F+ + +   + +VT+E EP FDAADF R G DIF QRS VTN   IQW+R H+    +RV  + FD    MHID  F P+KPG+ L      C        + W ++      + + H  +++   +  N+L ++  +V+V+  +  M    + +  + IPV  +  N++GGGFHCW+ DIRR+G L+SYF W   +++
Sbjct:   22 VQVWNEWDPLEEIVVGIPDNAVIPPITIETKPCIHNSMWPFFKENSGKYWSDVLGQRFWSALLKEHKSFSDALKNEGVKVVNPETQNFENKYKIRDHETTGMYCAMPRDILLPIGNEIIEAPMTWRSRYFEINSYRKLIIDYWKRGASWVAAPKPT-----YNNLFEESNKSDLISFVTSEAEPTFDAADFVRAGTDIFAQRSQVTNNLGIQWVRNHVKSKNIRVWTLSFDDPRPMHIDATFMPLKPGIILSNPDRKCHQIQNFLDAGWKVIYGIPRTNNNGHPYYLSSPWITMNVLMVNENKVIVDADDLEMQNLFRTLNIEVIPVKFRHCNSIGGGFHCWSVDIRRKGDLQSYFNWKSSVID 380          
The following BLAST results are available for this feature:
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
GATM1.606e-11247.52glycine amidinotransferase [Source:HGNC Symbol;Acc... [more]
GATM3.489e-9346.26glycine amidinotransferase [Source:HGNC Symbol;Acc... [more]
GATM2.041e-4051.94glycine amidinotransferase [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
gatm7.032e-11847.49glycine amidinotransferase (L-arginine:glycine ami... [more]
gatm3.327e-7250.41glycine amidinotransferase (L-arginine:glycine ami... [more]
gatm2.691e-6449.34glycine amidinotransferase (L-arginine:glycine ami... [more]
back to top
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tmem2221.047e-12050.54transmembrane protein 222 [Source:Xenbase;Acc:XB-G... [more]
tmem2222.027e-12050.54transmembrane protein 222 [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Gatm6.529e-11648.30glycine amidinotransferase (L-arginine:glycine ami... [more]
Gatm6.529e-11648.30glycine amidinotransferase (L-arginine:glycine ami... [more]
back to top
BLAST of Glycine amidinotransferase, mitochondrial vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9IAJ6|GATM_XENLA6.882e-12050.27Glycine amidinotransferase, mitochondrial OS=Xenop... [more]
sp|Q6P832|GATM_XENTR1.074e-11950.54Glycine amidinotransferase, mitochondrial OS=Xenop... [more]
sp|Q6PH19|GATM_DANRE6.112e-11747.49Glycine amidinotransferase, mitochondrial OS=Danio... [more]
sp|P50442|GATM_RAT2.599e-11548.30Glycine amidinotransferase, mitochondrial OS=Rattu... [more]
sp|Q9D964|GATM_MOUSE4.567e-11548.30Glycine amidinotransferase, mitochondrial OS=Mus m... [more]
back to top
BLAST of Glycine amidinotransferase, mitochondrial vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183T8335.464e-12249.04Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A0X3NYE38.503e-12249.04Uncharacterized protein (Fragment) OS=Schistocepha... [more]
A0A1S3J2H93.160e-11949.86glycine amidinotransferase, mitochondrial OS=Lingu... [more]
H2KUH62.803e-11847.55Glycine amidinotransferase mitochondrial OS=Clonor... [more]
A0A1L8GSU28.471e-11850.27Uncharacterized protein OS=Xenopus laevis OX=8355 ... [more]
back to top
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gatm9.837e-11849.19glycine amidinotransferase [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO359684.840e-11848.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gatm1.856e-11849.32glycine amidinotransferase [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Glycine amidinotransferase, mitochondrial vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000043142.10.000e+099.76SMESG000043142.1[more]
SMESG000068402.15.974e-12648.53SMESG000068402.1[more]
SMESG000051953.11.319e-12549.07SMESG000051953.1[more]
SMESG000051964.19.167e-11344.00SMESG000051964.1[more]
SMESG000051929.12.917e-9940.38SMESG000051929.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032169 ID=SMED30032169|Name=Glycine amidinotransferase, mitochondrial|organism=Schmidtea mediterranea sexual|type=transcript|length=1380bp
CGTGTTTCTGCCAGAATCCAAGTTTGGTAGGGTGGGTGGAGTAGGCTTTT
ATATCATATCTAAATCTGAAAATGAATTTTTATCATCATATTTTCTCAAA
TGTTGTCTGTATTACGACAAATTAGCCATTCAAAATCTGCCATTTCTTCG
AAAATATCGGTAATTCACATTTCAAAGTACTTCGGTCATTATTCATGCCA
CGATGAAAAGAAACAGACTTCTCCAGTTTGGGCTTGGAATGAATGGGATC
CACTTGAAGAAGTTGTGGTCGGTGTTCCTAATAATGCAACTTTGCCCTTT
CCATCACAGGAAGTAGCAGCCACTTTTGGACCCCCTAGACTTCCATTTTT
TCAAAAACATGGTGGCAAAAAATTCTCAGAGGTTATGGGTCAAGAAATGT
GGATGAAAATTGAAAATGAAATAAAAGAATTAGTAAGAGTATTAGAGGGA
GAAGGTGTAAAAGTTGTGCAACCAGAGGCTATAGATTACGATCAAAAGTG
GACTACGCCAAAGTTTTCTTCAACAGGTTTGTATGCCGCTATGCCAAGAG
ATTTTTTACTTATCGTTGGTGATGAAATCATTGAATCCCCTATGGCTTGG
AGGTGTAGATACTTTGAATACGAAGCATACAGACCACTTATTCGAAAATA
TTTTAATGAAGGAGCCAGATGGACATCGGCTCCTAAATGCACTATGGAAG
ACGCTCTCTATGATATGGAATTCGATGTTGCTCAAGAGAAACCATATGTG
TATGTAACAACTGAATTAGAACCATGTTTTGATGCGGCTGACTTTACAAG
AATTGGCAGGGATATTTTTGGTCAAAGAAGTCATGTAACCAACAAAAAGG
CAATACAGTGGCTCCGGCGTCATTTAGCTCCTAGTGGAGTCAGGGTCCAT
GACATTGAATTTGACTCTCTCTATTCAATGCATATTGATACCAATTTTTT
CCCCGTGAAACCTGGTATGTTTTTACTTAAAGATGGACTCAATTGTAAAA
CCCCGGATCTATTAAAAAAATCTAAATGGGACATAGTCATTATGCCAAAA
GGACCTCATCGAGACGAGCATTACAAATGGATGAATTATCACGGATTACC
GAACAATATGCTCAGTATAGACACAGAGAGGGTCCTAGTTGAGAAAACCG
AAGAATACATGATAAAATTCATGCAAGAAATTGGATTCAAACCGATTCCA
GTTTCGCTTAAATTCGCAAATAATCTAGGAGGGGGCTTCCACTGCTGGAC
AGCGGACATCAGACGGCGAGGAAAACTAGAAAGCTATTTTGAGTGGCCAG
ATGAGATTTTGGAGCGATTGACTCCATAAATCGGAAATATTAAATTAAAA
AATATTTTTTGTTTTAATTTTCTATACAAT
back to top

protein sequence of SMED30032169-orf-1

>SMED30032169-orf-1 ID=SMED30032169-orf-1|Name=SMED30032169-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=410bp
MLSVLRQISHSKSAISSKISVIHISKYFGHYSCHDEKKQTSPVWAWNEWD
PLEEVVVGVPNNATLPFPSQEVAATFGPPRLPFFQKHGGKKFSEVMGQEM
WMKIENEIKELVRVLEGEGVKVVQPEAIDYDQKWTTPKFSSTGLYAAMPR
DFLLIVGDEIIESPMAWRCRYFEYEAYRPLIRKYFNEGARWTSAPKCTME
DALYDMEFDVAQEKPYVYVTTELEPCFDAADFTRIGRDIFGQRSHVTNKK
AIQWLRRHLAPSGVRVHDIEFDSLYSMHIDTNFFPVKPGMFLLKDGLNCK
TPDLLKKSKWDIVIMPKGPHRDEHYKWMNYHGLPNNMLSIDTERVLVEKT
EEYMIKFMQEIGFKPIPVSLKFANNLGGGFHCWTADIRRRGKLESYFEWP
DEILERLTP*
back to top
Aliases
The feature 'Glycine amidinotransferase, mitochondrial' has the following synonyms
Synonym
gatm
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000035Category 3 cell
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0002111X2 cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR033195AmidinoTrfase
Vocabulary: molecular function
TermDefinition
GO:0016740transferase activity
GO:0015067amidinotransferase activity
GO:0015068glycine amidinotransferase activity
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
GO:0005743mitochondrial inner membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0006601creatine biosynthetic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.75.10.10coord: 1..251
e-value: 6.1E-76
score: 257.8
NoneNo IPR availableSUPERFAMILYSSF55909Penteincoord: 1..250
IPR033195Glycine/inosamine-phosphate amidinotransferasePANTHERPTHR10488GLYCINE AMIDINOTRANSFERASE, MITOCHONDRIALcoord: 1..251