Transcription factor RFX4

Overview
NameTranscription factor RFX4
Smed IDSMED30032163
Uniprot Best hitTranscription factor RFX4 OS=Danio rerio OX=7955 GN=rfx4 PE=2 SV=1 (E=1.29974e-45)
Length (bp)1590
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transcription factor RFX4 (SMED30032163) t-SNE clustered cells

Violin plots show distribution of expression levels for Transcription factor RFX4 (SMED30032163) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transcription factor RFX4 (SMED30032163) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transcription factor RFX4 (SMED30032163) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032163

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Category 4 cellSMED30032163SMESG000058756.1 dd_Smed_v4_11406_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30032163SMESG000058756.1 dd_Smed_v4_11406_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30032163SMESG000058756.1 dd_Smed_v4_11406_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30032163SMESG000058756.1 dd_Smed_v4_11406_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transcription factor RFX4 vs. Ensembl Human
Match: RFX4 (regulatory factor X4 [Source:HGNC Symbol;Acc:HGNC:9985])

HSP 1 Score: 173.711 bits (439), Expect = 3.658e-46
Identity = 134/475 (28.21%), Postives = 240/475 (50.53%), Query Frame = 1
Query:  112 ESTKRDSLHRTISWLKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVKKSSVYFNFNNIGDIDPYSQK----TSPSLNVQHPKNRVDSVPKIQFTI-----ETIKNSNNEDQLSQE-IGNFFIMYQTHSQQIIDSIIHGSFDEILKYLLSFWKTCPEHFKHLFEKSLLIDGVITIDLQVYVAVYRFVLHSMDHSLPD---QYLKEFVHFLNNYSIILSNSIPAINKLLREKKIFYALMFKQMCFSWLRGSHLYKIIFPVLSHTDLISEILEEFQGICIENIIDDTVHIVQSSAIPQMPQLIYEHXXXXXXXXXXXXXXXXXXKWV-----KDIFHSSWENMGISFKTC---FLTWTIFFSKFLQEMFLSLSKCFGQVNLVFLWLEH--LFYTESMIQEFEHLIQTLNRIIYSETSLN--YSQCIQLNSTSPHPLPCKT 1461
             ++K  S   T+ WL+ENY   EGV + R  LY +Y  FC  +    ++ A+FGKIIRQQFPQ+TTRRLGTRG SKYHY+G+AVK+SS Y++         YS+K     S +   +  K  V   P+ +          +K+ N    L +E +  F +MY+TH Q+I+D++I  +FDE+  +LL FW+  P H   +   S +++ V   D  +Y A+   ++ ++  +LPD   Q +++F   L+ +  +  + +P   + LR  K   +  F Q+       +HL +    V+   D+  ++LE+++ + + +I   T++ ++ S   +  +LI + ++ F++LLE     +  ++W+     + +   + +  G   K      L W+ F ++ +++M L  +  FG  +L+ L  +   L+  ES+    +     L R +  E S      + I   + +P P P  +
Sbjct:   51 RASKPHSTPATLQWLEENYEIAEGVCIPRSALYMHYLDFCEKNDTQPVNAASFGKIIRQQFPQLTTRRLGTRGQSKYHYYGIAVKESSQYYDVM-------YSKKGAAWVSETGKKEVSKQTVAYSPRSKLGTLLPEFPNVKDLNLPASLPEEKVSTFIMMYRTHCQRILDTVIRANFDEVQSFLLHFWQGMPPHMLPVLGSSTVVNIVGVCDSILYKAISGVLMPTVLQALPDSLTQVIRKFAKQLDEWLKVALHDLP---ENLRNIKFELSRRFSQILRRQTSLNHLCQASRTVIHSADITFQMLEDWRNVDLNSITKQTLYTMEDSRD-EHRKLITQLYQEFDHLLEEQSPIESYIEWLDTMVDRCVVKVAAKRQGSLKKVAQQFLLMWSCFGTRVIRDMTLHSAPSFGSFHLIHLMFDDYVLYLLESL--HCQERANELMRAMKGEGSTAEVREEIILTEAAAPTPSPVPS 512          
BLAST of Transcription factor RFX4 vs. Ensembl Human
Match: RFX4 (regulatory factor X4 [Source:HGNC Symbol;Acc:HGNC:9985])

HSP 1 Score: 173.711 bits (439), Expect = 4.721e-46
Identity = 134/475 (28.21%), Postives = 240/475 (50.53%), Query Frame = 1
Query:  112 ESTKRDSLHRTISWLKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVKKSSVYFNFNNIGDIDPYSQK----TSPSLNVQHPKNRVDSVPKIQFTI-----ETIKNSNNEDQLSQE-IGNFFIMYQTHSQQIIDSIIHGSFDEILKYLLSFWKTCPEHFKHLFEKSLLIDGVITIDLQVYVAVYRFVLHSMDHSLPD---QYLKEFVHFLNNYSIILSNSIPAINKLLREKKIFYALMFKQMCFSWLRGSHLYKIIFPVLSHTDLISEILEEFQGICIENIIDDTVHIVQSSAIPQMPQLIYEHXXXXXXXXXXXXXXXXXXKWV-----KDIFHSSWENMGISFKTC---FLTWTIFFSKFLQEMFLSLSKCFGQVNLVFLWLEH--LFYTESMIQEFEHLIQTLNRIIYSETSLN--YSQCIQLNSTSPHPLPCKT 1461
             ++K  S   T+ WL+ENY   EGV + R  LY +Y  FC  +    ++ A+FGKIIRQQFPQ+TTRRLGTRG SKYHY+G+AVK+SS Y++         YS+K     S +   +  K  V   P+ +          +K+ N    L +E +  F +MY+TH Q+I+D++I  +FDE+  +LL FW+  P H   +   S +++ V   D  +Y A+   ++ ++  +LPD   Q +++F   L+ +  +  + +P   + LR  K   +  F Q+       +HL +    V+   D+  ++LE+++ + + +I   T++ ++ S   +  +LI + ++ F++LLE     +  ++W+     + +   + +  G   K      L W+ F ++ +++M L  +  FG  +L+ L  +   L+  ES+    +     L R +  E S      + I   + +P P P  +
Sbjct:   60 RASKPHSTPATLQWLEENYEIAEGVCIPRSALYMHYLDFCEKNDTQPVNAASFGKIIRQQFPQLTTRRLGTRGQSKYHYYGIAVKESSQYYDVM-------YSKKGAAWVSETGKKEVSKQTVAYSPRSKLGTLLPEFPNVKDLNLPASLPEEKVSTFIMMYRTHCQRILDTVIRANFDEVQSFLLHFWQGMPPHMLPVLGSSTVVNIVGVCDSILYKAISGVLMPTVLQALPDSLTQVIRKFAKQLDEWLKVALHDLP---ENLRNIKFELSRRFSQILRRQTSLNHLCQASRTVIHSADITFQMLEDWRNVDLNSITKQTLYTMEDSRD-EHRKLITQLYQEFDHLLEEQSPIESYIEWLDTMVDRCVVKVAAKRQGSLKKVAQQFLLMWSCFGTRVIRDMTLHSAPSFGSFHLIHLMFDDYVLYLLESL--HCQERANELMRAMKGEGSTAEVREEIILTEAAAPTPSPVPS 521          
BLAST of Transcription factor RFX4 vs. Ensembl Human
Match: RFX4 (regulatory factor X4 [Source:HGNC Symbol;Acc:HGNC:9985])

HSP 1 Score: 153.68 bits (387), Expect = 1.993e-42
Identity = 87/245 (35.51%), Postives = 138/245 (56.33%), Query Frame = 1
Query:  154 LKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVKKSSVYFNFNNIGDIDPYSQK----TSPSLNVQHPKNRVDSVPKIQFTI-----ETIKNSNNEDQLSQE-IGNFFIMYQTHSQQIIDSIIHGSFDEILKYLLSFWKTCPEHFKHLFEKSLLIDGVITIDLQVYVAVYRFVLHSMDHSLPD---QYLKEFVHFLNNYSIILSNSIP 849
            L+ENY   EGV + R  LY +Y  FC  +    ++ A+FGKIIRQQFPQ+TTRRLGTRG SKYHY+G+AVK+SS Y++         YS+K     S +   +  K  V   P+ +          +K+ N    L +E +  F +MY+TH Q+I+D++I  +FDE+  +LL FW+  P H   +   S +++ V   D  +Y A+   ++ ++  +LPD   Q +++F   L+ +  +  + +P
Sbjct:   10 LEENYEIAEGVCIPRSALYMHYLDFCEKNDTQPVNAASFGKIIRQQFPQLTTRRLGTRGQSKYHYYGIAVKESSQYYDVM-------YSKKGAAWVSETGKKEVSKQTVAYSPRSKLGTLLPEFPNVKDLNLPASLPEEKVSTFIMMYRTHCQRILDTVIRANFDEVQSFLLHFWQGMPPHMLPVLGSSTVVNIVGVCDSILYKAISGVLMPTVLQALPDSLTQVIRKFAKQLDEWLKVALHDLP 247          
BLAST of Transcription factor RFX4 vs. Ensembl Human
Match: RFX6 (regulatory factor X6 [Source:HGNC Symbol;Acc:HGNC:21478])

HSP 1 Score: 153.68 bits (387), Expect = 6.329e-39
Identity = 116/427 (27.17%), Postives = 206/427 (48.24%), Query Frame = 1
Query:  121 KRDSLHRTISWLKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVKKSSVYFNFNNIGDIDPYSQKTSPSLNVQHPKNRVDSVPKIQFTIET---IKNSNNEDQL-------SQEIGNFFIMYQTHSQQIIDSIIHGSFDEILKYLLSFWKTCPEHFKHLFEKSLLIDGVITIDLQVYVAVYRFVLHSMDHSLPDQYLKEFVHFLNNYSIILSNSIPAINKLLREKKI-----FYALMFKQMCFSWLRGSHLYKIIFPVLSHTDLISEILEEFQGICIENIIDDTVHIVQSSAIPQMPQLIYEHXXXX-----XXXXXXXXXXXXXXKWV-----KDIFHSSWENMGISFKTC----FLTWTIFFSKFLQEMFLSLSKCFGQVNLVFLWLE 1314
            K+     T+ WL+ENY   EGV L R  LY +Y  FCR         ATFGK IRQ+FP +TTRRLGTRG+SKYHY+G+ +K+SS Y++         YS K     +    KN      K   + +T   +    +   L         ++    +MY+TH Q I+D+ I+G+F+EI  +LL FW+  P+H   L E  ++ID     D  +Y  +   ++ +    +P+  L +  +F  N+   + +S+  + + L +KKI     F + + +Q  F      HL +I  P L    +++ ++ + + + + +I    +  +  S   +   +  EH         ++LL+ + + +  ++W+     + +  +S +N G S K       L W+ F ++ +  + L+ +  FG  +L+ + L+
Sbjct:  117 KKKQTQLTLQWLEENYIVCEGVCLPRCILYAHYLDFCRKEKLEPACAATFGKTIRQKFPLLTTRRLGTRGHSKYHYYGIGIKESSAYYH-------SVYSGKGLTRFSGSKLKNEGGFTRKYSLSSKTGTLLPEFPSAQHLVYQGCISKDKVDTLIMMYKTHCQCILDNAINGNFEEIQHFLLHFWQGMPDHLLPLLENPVIIDIFCVCDSILYKVLTDVLIPATMQEMPESLLADIRNFAKNWEQWVVSSLENLPEALTDKKIPIVRRFVSSLKRQTSF-----LHLAQIARPALFDQHVVNSMVSDIERVDLNSIGSQALLTISGSTDTES-GIYTEHDSITVFQELKDLLKKNATVEAFIEWLDTVVEQRVIKTSKQN-GRSLKKRAQDFLLKWSFFGARVMHNLTLNNASSFGSFHLIRMLLD 529          
BLAST of Transcription factor RFX4 vs. Ensembl Human
Match: RFX4 (regulatory factor X4 [Source:HGNC Symbol;Acc:HGNC:9985])

HSP 1 Score: 130.183 bits (326), Expect = 7.478e-34
Identity = 73/179 (40.78%), Postives = 105/179 (58.66%), Query Frame = 1
Query:  115 STKRDSLHRTISWLKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVKKSSVYFNFNNIGDIDPYSQK----TSPSLNVQHPKNRVDSVPKIQFTI-----ETIKNSNNEDQLSQE-IGNFFIMYQTHSQQIIDSIIHGSFDE 621
            ++K  S   T+ WL+ENY   EGV + R  LY +Y  FC  +    ++ A+FGKIIRQQFPQ+TTRRLGTRG SKYHY+G+AVK+SS Y++         YS+K     S +   +  K  V   P+ +          +K+ N    L +E +  F +MY+TH Q+I+D++I  +FDE
Sbjct:   61 ASKPHSTPATLQWLEENYEIAEGVCIPRSALYMHYLDFCEKNDTQPVNAASFGKIIRQQFPQLTTRRLGTRGQSKYHYYGIAVKESSQYYDVM-------YSKKGAAWVSETGKKEVSKQTVAYSPRSKLGTLLPEFPNVKDLNLPASLPEEKVSTFIMMYRTHCQRILDTVIRANFDE 232          
BLAST of Transcription factor RFX4 vs. Ensembl Celegans
Match: daf-19 (RFX-like transcription factor daf-19 [Source:UniProtKB/Swiss-Prot;Acc:Q09555])

HSP 1 Score: 86.6557 bits (213), Expect = 1.128e-17
Identity = 41/78 (52.56%), Postives = 54/78 (69.23%), Query Frame = 1
Query:  142 TISWLKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVKKSS 375
            T++WL ENY   EG SL R  LY++Y+  C  H    ++ A+FGK+IR  F  + TRRLGTRGNSKYHY+G+ +K SS
Sbjct:  116 TVNWLFENYEIGEG-SLPRCELYDHYKKHCAEHRMDPVNAASFGKLIRSVFHNLKTRRLGTRGNSKYHYYGIRLKDSS 192          
BLAST of Transcription factor RFX4 vs. Ensembl Celegans
Match: daf-19 (RFX-like transcription factor daf-19 [Source:UniProtKB/Swiss-Prot;Acc:Q09555])

HSP 1 Score: 86.6557 bits (213), Expect = 1.138e-17
Identity = 41/78 (52.56%), Postives = 54/78 (69.23%), Query Frame = 1
Query:  142 TISWLKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVKKSS 375
            T++WL ENY   EG SL R  LY++Y+  C  H    ++ A+FGK+IR  F  + TRRLGTRGNSKYHY+G+ +K SS
Sbjct:   93 TVNWLFENYEIGEG-SLPRCELYDHYKKHCAEHRMDPVNAASFGKLIRSVFHNLKTRRLGTRGNSKYHYYGIRLKDSS 169          
BLAST of Transcription factor RFX4 vs. Ensembl Celegans
Match: daf-19 (RFX-like transcription factor daf-19 [Source:UniProtKB/Swiss-Prot;Acc:Q09555])

HSP 1 Score: 86.6557 bits (213), Expect = 1.167e-17
Identity = 41/78 (52.56%), Postives = 54/78 (69.23%), Query Frame = 1
Query:  142 TISWLKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVKKSS 375
            T++WL ENY   EG SL R  LY++Y+  C  H    ++ A+FGK+IR  F  + TRRLGTRGNSKYHY+G+ +K SS
Sbjct:   77 TVNWLFENYEIGEG-SLPRCELYDHYKKHCAEHRMDPVNAASFGKLIRSVFHNLKTRRLGTRGNSKYHYYGIRLKDSS 153          
BLAST of Transcription factor RFX4 vs. Ensembl Celegans
Match: daf-19 (RFX-like transcription factor daf-19 [Source:UniProtKB/Swiss-Prot;Acc:Q09555])

HSP 1 Score: 86.6557 bits (213), Expect = 1.492e-17
Identity = 41/79 (51.90%), Postives = 54/79 (68.35%), Query Frame = 1
Query:  142 TISWLKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVKKSSV 378
            T++WL ENY   EG SL R  LY++Y+  C  H    ++ A+FGK+IR  F  + TRRLGTRGNSKYHY+G+ +K SS 
Sbjct:  235 TVNWLFENYEIGEG-SLPRCELYDHYKKHCAEHRMDPVNAASFGKLIRSVFHNLKTRRLGTRGNSKYHYYGIRLKDSST 312          
BLAST of Transcription factor RFX4 vs. Ensembl Celegans
Match: daf-19 (RFX-like transcription factor daf-19 [Source:UniProtKB/Swiss-Prot;Acc:Q09555])

HSP 1 Score: 86.6557 bits (213), Expect = 1.498e-17
Identity = 41/79 (51.90%), Postives = 54/79 (68.35%), Query Frame = 1
Query:  142 TISWLKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVKKSSV 378
            T++WL ENY   EG SL R  LY++Y+  C  H    ++ A+FGK+IR  F  + TRRLGTRGNSKYHY+G+ +K SS 
Sbjct:  260 TVNWLFENYEIGEG-SLPRCELYDHYKKHCAEHRMDPVNAASFGKLIRSVFHNLKTRRLGTRGNSKYHYYGIRLKDSST 337          
BLAST of Transcription factor RFX4 vs. Ensembl Fly
Match: Rfx (gene:FBgn0020379 transcript:FBtr0337103)

HSP 1 Score: 110.923 bits (276), Expect = 2.999e-25
Identity = 108/468 (23.08%), Postives = 192/468 (41.03%), Query Frame = 1
Query:  142 TISWLKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVKKSSVYFNFNNIGD-------IDPYSQKTS-----PSLNVQHP----------------KNRVDSVPKIQFTIET----------------------IKNSNNEDQLSQEIGNFFIMYQTHSQQIIDSIIHGSFDEILKYLLSFWKT--------CPEHFKHLFEKSLLI--------DGVITIDLQVYVAVYRFVLHSMDHSLPDQYLKEFVHFLNNYSIILSNSIPAINKLLREKKIFYALMFKQMCFSWLRGSHLYKIIFPVLSHTDLISEILEEFQGICIENIIDDTVHIVQSSAIPQMPQLIYEHXXXXXXXXXXXXXXXXXXKWVKDIFHSSWE------NMGISFKTCFLTWTIFFSKFLQEMFLSLSKCFGQVNLV-FLWLEHLFY 1326
            TI WL  NY   +GVSL R TLY +Y   C  H    ++ A+FGK+IR  F  + TRRLGTRGNSKYHY+G+ + K     N   + D         P S  T      P ++V                   +   +   K  F  ET                      + +S N +   +++  F  +Y+ H +  +D++++  F+ +   L  FW+         C E  K+L +  L +          V  +D Q Y      ++  +  S+P+   +   +F  N  I L  S+  + + L + K      F Q    +   +HL +    VL +   IS++L +   +   N+ +    + Q +     P ++     +F+  L+   S ++   W++ +  S+ E          + +   L W+ + S  ++++ L  +  FG  +L+  L+ E++FY
Sbjct:  356 TIKWLSRNYETADGVSLPRSTLYNHYMQHCSEHKLEPVNAASFGKLIRSVFSGLRTRRLGTRGNSKYHYYGIRI-KPGSLLNSQAMDDKQMLAAGYGPSSDGTGGPGSGPMVSVTSSTAGQLTGSNGLGGGHGQRHSNGTKKHTFKPETYEACIQYIGDGTSALPSFPPIELNHSFNSELTLEDVDTFRGLYREHCESFLDAVLNLEFNTVEFLLRDFWRASDNNNLDECEEE-KYLSKTKLYLLCHCAEVQKFVREVDYQFYQNTVDVIIPDVLRSIPNALTQAIRNFAKNLEIWLCESMLGVPEQLAQIKTSAVSAFCQTLRRYTSLNHLAQAARAVLQNGAQISQMLSDLNRVDFHNVQEQAAWVSQCA-----PAVVQRLESDFKAALQQQSSLEQWASWLQLVVESAMEEYNGKPTYARAARQFLLKWSFYSSMIIRDLTLRSASSFGSFHLIRLLFDEYMFY 816          
BLAST of Transcription factor RFX4 vs. Ensembl Fly
Match: Rfx (gene:FBgn0020379 transcript:FBtr0337104)

HSP 1 Score: 110.538 bits (275), Expect = 3.711e-25
Identity = 108/468 (23.08%), Postives = 192/468 (41.03%), Query Frame = 1
Query:  142 TISWLKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVKKSSVYFNFNNIGD-------IDPYSQKTS-----PSLNVQHP----------------KNRVDSVPKIQFTIET----------------------IKNSNNEDQLSQEIGNFFIMYQTHSQQIIDSIIHGSFDEILKYLLSFWKT--------CPEHFKHLFEKSLLI--------DGVITIDLQVYVAVYRFVLHSMDHSLPDQYLKEFVHFLNNYSIILSNSIPAINKLLREKKIFYALMFKQMCFSWLRGSHLYKIIFPVLSHTDLISEILEEFQGICIENIIDDTVHIVQSSAIPQMPQLIYEHXXXXXXXXXXXXXXXXXXKWVKDIFHSSWE------NMGISFKTCFLTWTIFFSKFLQEMFLSLSKCFGQVNLV-FLWLEHLFY 1326
            TI WL  NY   +GVSL R TLY +Y   C  H    ++ A+FGK+IR  F  + TRRLGTRGNSKYHY+G+ + K     N   + D         P S  T      P ++V                   +   +   K  F  ET                      + +S N +   +++  F  +Y+ H +  +D++++  F+ +   L  FW+         C E  K+L +  L +          V  +D Q Y      ++  +  S+P+   +   +F  N  I L  S+  + + L + K      F Q    +   +HL +    VL +   IS++L +   +   N+ +    + Q +     P ++     +F+  L+   S ++   W++ +  S+ E          + +   L W+ + S  ++++ L  +  FG  +L+  L+ E++FY
Sbjct:  334 TIKWLSRNYETADGVSLPRSTLYNHYMQHCSEHKLEPVNAASFGKLIRSVFSGLRTRRLGTRGNSKYHYYGIRI-KPGSLLNSQAMDDKQMLAAGYGPSSDGTGGPGSGPMVSVTSSTAGQLTGSNGLGGGHGQRHSNGTKKHTFKPETYEACIQYIGDGTSALPSFPPIELNHSFNSELTLEDVDTFRGLYREHCESFLDAVLNLEFNTVEFLLRDFWRASDNNNLDECEEE-KYLSKTKLYLLCHCAEVQKFVREVDYQFYQNTVDVIIPDVLRSIPNALTQAIRNFAKNLEIWLCESMLGVPEQLAQIKTSAVSAFCQTLRRYTSLNHLAQAARAVLQNGAQISQMLSDLNRVDFHNVQEQAAWVSQCA-----PAVVQRLESDFKAALQQQSSLEQWASWLQLVVESAMEEYNGKPTYARAARQFLLKWSFYSSMIIRDLTLRSASSFGSFHLIRLLFDEYMFY 794          
BLAST of Transcription factor RFX4 vs. Ensembl Fly
Match: Rfx (gene:FBgn0020379 transcript:FBtr0337107)

HSP 1 Score: 92.4337 bits (228), Expect = 2.644e-19
Identity = 41/79 (51.90%), Postives = 52/79 (65.82%), Query Frame = 1
Query:  142 TISWLKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVKKSSV 378
            TI WL  NY   +GVSL R TLY +Y   C  H    ++ A+FGK+IR  F  + TRRLGTRGNSKYHY+G+ +K  S+
Sbjct:  371 TIKWLSRNYETADGVSLPRSTLYNHYMQHCSEHKLEPVNAASFGKLIRSVFSGLRTRRLGTRGNSKYHYYGIRIKPGSL 449          

HSP 2 Score: 51.6026 bits (122), Expect = 1.906e-6
Identity = 55/286 (19.23%), Postives = 121/286 (42.31%), Query Frame = 1
Query:  538 QEIGNFFIMYQTHSQQIIDSIIHGSFDEILKYLLSFWKT--------CPEHFKHLFEKSLLI--------DGVITIDLQVYVAVYRFVLHSMDHSLPDQYLKEFVHFLNNYSIILSNSIPAINKLLREKKIFYALMFKQMCFSWLRGSHLYKIIFPVLSHTDLISEILEEFQGICIENIIDDTVHIVQSSAIPQMPQLIYEHXXXXXXXXXXXXXXXXXXKWVKDIFHSSWE------NMGISFKTCFLTWTIFFSKFLQEMFLSLSKCFGQVNLV-FLWLEHLFY 1326
            +++  F  +Y+ H +  +D++++  F+ +   L  FW+         C E  K+L +  L +          V  +D Q Y      ++  +  S+P+   +   +F  N  I L  S+  + + L + K      F Q    +   +HL +    VL +   IS++L +   +   N+ +    + Q +     P ++     +F+  L+   S ++   W++ +  S+ E          + +   L W+ + S  ++++ L  +  FG  +L+  L+ E++FY
Sbjct:  552 EDVDTFRGLYREHCESFLDAVLNLEFNTVEFLLRDFWRASDNNNLDECEEE-KYLSKTKLYLLCHCAEVQKFVREVDYQFYQNTVDVIIPDVLRSIPNALTQAIRNFAKNLEIWLCESMLGVPEQLAQIKTSAVSAFCQTLRRYTSLNHLAQAARAVLQNGAQISQMLSDLNRVDFHNVQEQAAWVSQCA-----PAVVQRLESDFKAALQQQSSLEQWASWLQLVVESAMEEYNGKPTYARAARQFLLKWSFYSSMIIRDLTLRSASSFGSFHLIRLLFDEYMFY 831          
BLAST of Transcription factor RFX4 vs. Ensembl Fly
Match: Rfx (gene:FBgn0020379 transcript:FBtr0337106)

HSP 1 Score: 92.4337 bits (228), Expect = 2.700e-19
Identity = 41/79 (51.90%), Postives = 52/79 (65.82%), Query Frame = 1
Query:  142 TISWLKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVKKSSV 378
            TI WL  NY   +GVSL R TLY +Y   C  H    ++ A+FGK+IR  F  + TRRLGTRGNSKYHY+G+ +K  S+
Sbjct:  363 TIKWLSRNYETADGVSLPRSTLYNHYMQHCSEHKLEPVNAASFGKLIRSVFSGLRTRRLGTRGNSKYHYYGIRIKPGSL 441          

HSP 2 Score: 51.6026 bits (122), Expect = 1.775e-6
Identity = 55/286 (19.23%), Postives = 121/286 (42.31%), Query Frame = 1
Query:  538 QEIGNFFIMYQTHSQQIIDSIIHGSFDEILKYLLSFWKT--------CPEHFKHLFEKSLLI--------DGVITIDLQVYVAVYRFVLHSMDHSLPDQYLKEFVHFLNNYSIILSNSIPAINKLLREKKIFYALMFKQMCFSWLRGSHLYKIIFPVLSHTDLISEILEEFQGICIENIIDDTVHIVQSSAIPQMPQLIYEHXXXXXXXXXXXXXXXXXXKWVKDIFHSSWE------NMGISFKTCFLTWTIFFSKFLQEMFLSLSKCFGQVNLV-FLWLEHLFY 1326
            +++  F  +Y+ H +  +D++++  F+ +   L  FW+         C E  K+L +  L +          V  +D Q Y      ++  +  S+P+   +   +F  N  I L  S+  + + L + K      F Q    +   +HL +    VL +   IS++L +   +   N+ +    + Q +     P ++     +F+  L+   S ++   W++ +  S+ E          + +   L W+ + S  ++++ L  +  FG  +L+  L+ E++FY
Sbjct:  544 EDVDTFRGLYREHCESFLDAVLNLEFNTVEFLLRDFWRASDNNNLDECEEE-KYLSKTKLYLLCHCAEVQKFVREVDYQFYQNTVDVIIPDVLRSIPNALTQAIRNFAKNLEIWLCESMLGVPEQLAQIKTSAVSAFCQTLRRYTSLNHLAQAARAVLQNGAQISQMLSDLNRVDFHNVQEQAAWVSQCA-----PAVVQRLESDFKAALQQQSSLEQWASWLQLVVESAMEEYNGKPTYARAARQFLLKWSFYSSMIIRDLTLRSASSFGSFHLIRLLFDEYMFY 823          
BLAST of Transcription factor RFX4 vs. Ensembl Fly
Match: Rfx (gene:FBgn0020379 transcript:FBtr0337105)

HSP 1 Score: 92.4337 bits (228), Expect = 2.879e-19
Identity = 41/79 (51.90%), Postives = 52/79 (65.82%), Query Frame = 1
Query:  142 TISWLKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVKKSSV 378
            TI WL  NY   +GVSL R TLY +Y   C  H    ++ A+FGK+IR  F  + TRRLGTRGNSKYHY+G+ +K  S+
Sbjct:  393 TIKWLSRNYETADGVSLPRSTLYNHYMQHCSEHKLEPVNAASFGKLIRSVFSGLRTRRLGTRGNSKYHYYGIRIKPGSL 471          

HSP 2 Score: 51.6026 bits (122), Expect = 1.672e-6
Identity = 55/286 (19.23%), Postives = 121/286 (42.31%), Query Frame = 1
Query:  538 QEIGNFFIMYQTHSQQIIDSIIHGSFDEILKYLLSFWKT--------CPEHFKHLFEKSLLI--------DGVITIDLQVYVAVYRFVLHSMDHSLPDQYLKEFVHFLNNYSIILSNSIPAINKLLREKKIFYALMFKQMCFSWLRGSHLYKIIFPVLSHTDLISEILEEFQGICIENIIDDTVHIVQSSAIPQMPQLIYEHXXXXXXXXXXXXXXXXXXKWVKDIFHSSWE------NMGISFKTCFLTWTIFFSKFLQEMFLSLSKCFGQVNLV-FLWLEHLFY 1326
            +++  F  +Y+ H +  +D++++  F+ +   L  FW+         C E  K+L +  L +          V  +D Q Y      ++  +  S+P+   +   +F  N  I L  S+  + + L + K      F Q    +   +HL +    VL +   IS++L +   +   N+ +    + Q +     P ++     +F+  L+   S ++   W++ +  S+ E          + +   L W+ + S  ++++ L  +  FG  +L+  L+ E++FY
Sbjct:  574 EDVDTFRGLYREHCESFLDAVLNLEFNTVEFLLRDFWRASDNNNLDECEEE-KYLSKTKLYLLCHCAEVQKFVREVDYQFYQNTVDVIIPDVLRSIPNALTQAIRNFAKNLEIWLCESMLGVPEQLAQIKTSAVSAFCQTLRRYTSLNHLAQAARAVLQNGAQISQMLSDLNRVDFHNVQEQAAWVSQCA-----PAVVQRLESDFKAALQQQSSLEQWASWLQLVVESAMEEYNGKPTYARAARQFLLKWSFYSSMIIRDLTLRSASSFGSFHLIRLLFDEYMFY 853          
BLAST of Transcription factor RFX4 vs. Ensembl Zebrafish
Match: rfx4 (regulatory factor X, 4 [Source:NCBI gene;Acc:403016])

HSP 1 Score: 174.096 bits (440), Expect = 1.672e-46
Identity = 127/435 (29.20%), Postives = 224/435 (51.49%), Query Frame = 1
Query:  112 ESTKRDSLHRTISWLKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVKKSSVYFNFNNIGDIDPYSQKTSPSLN----VQHPKNRVDSVPKIQFTI-----ETIKNSNNEDQLSQE-IGNFFIMYQTHSQQIIDSIIHGSFDEILKYLLSFWKTCPEHFKHLFEKSLLIDGVITIDLQVYVAVYRFVLHSMDHSLPD---QYLKEFVHFLNNYSIILSNSIPAINKLLREKKIFYALMFKQMCFSWLRGSHLYKIIFPVLSHTDLISEILEEFQGICIENIIDDTVHIVQSSAIPQMPQLIYEHXXXXXXXXXXXXXXXXXXKWVKDIFH-----------SSWENMGISFKTCFLTWTIFFSKFLQEMFLSLSKCFGQVNLVFLWLEH--LFYTESM 1338
             ++K  S   T+ WL+ENY   EGV + R  LY +Y  FC       ++ A+FGKIIRQQFPQ+TTRRLGTRG SKYHY+G+AVK+SS Y++         YS+K +  +N     +  K  V   P+ +          +K+ N    L +E +  F +MY+TH Q+I+D++I  +FDE+  +LL FW+  P H   +   S +++ V   D  +Y A+   ++ ++  +LPD   Q +++F   L+ +  +  + +P   + LR  K   +  F Q+       +HL +    V+   D+  ++LE+++ + + +I   T++ ++ S   Q  +LI + ++ F+ LLE     +  ++W+  +              S + +   F    L W+ F ++ +++M L  +  FG  +L+ L  +   L+  ES+
Sbjct:   51 RASKPHSTPATLQWLEENYEIAEGVCIPRSALYMHYLDFCEKLDSQPVNAASFGKIIRQQFPQLTTRRLGTRGQSKYHYYGIAVKESSQYYDVM-------YSKKGAAWVNETGKKEVTKQTVAYSPRSKLGTLLPDFPNVKDLNLPASLPEEKVSTFIMMYRTHCQRILDTVIRANFDEVQSFLLHFWQGMPPHMLPVLGSSTVVNIVGVCDSILYKAISGVLMPTVLQALPDSLTQVIRKFAKQLDEWLKVALHDLP---ENLRNIKFELSRRFSQILKRQTSLNHLCQASRTVIHSADITFQMLEDWRNVDLNSITKQTLYTMEDSREDQR-RLIIQLYQEFDRLLEDQSPIEAYIEWLDSMVERCVVRVAGKRPGSLKRVAQQF---LLMWSCFGTRVIRDMTLHSAPSFGSFHLIHLMFDDYVLYLLESL 471          
BLAST of Transcription factor RFX4 vs. Ensembl Zebrafish
Match: rfx4 (regulatory factor X, 4 [Source:NCBI gene;Acc:403016])

HSP 1 Score: 174.096 bits (440), Expect = 1.722e-46
Identity = 127/435 (29.20%), Postives = 224/435 (51.49%), Query Frame = 1
Query:  112 ESTKRDSLHRTISWLKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVKKSSVYFNFNNIGDIDPYSQKTSPSLN----VQHPKNRVDSVPKIQFTI-----ETIKNSNNEDQLSQE-IGNFFIMYQTHSQQIIDSIIHGSFDEILKYLLSFWKTCPEHFKHLFEKSLLIDGVITIDLQVYVAVYRFVLHSMDHSLPD---QYLKEFVHFLNNYSIILSNSIPAINKLLREKKIFYALMFKQMCFSWLRGSHLYKIIFPVLSHTDLISEILEEFQGICIENIIDDTVHIVQSSAIPQMPQLIYEHXXXXXXXXXXXXXXXXXXKWVKDIFH-----------SSWENMGISFKTCFLTWTIFFSKFLQEMFLSLSKCFGQVNLVFLWLEH--LFYTESM 1338
             ++K  S   T+ WL+ENY   EGV + R  LY +Y  FC       ++ A+FGKIIRQQFPQ+TTRRLGTRG SKYHY+G+AVK+SS Y++         YS+K +  +N     +  K  V   P+ +          +K+ N    L +E +  F +MY+TH Q+I+D++I  +FDE+  +LL FW+  P H   +   S +++ V   D  +Y A+   ++ ++  +LPD   Q +++F   L+ +  +  + +P   + LR  K   +  F Q+       +HL +    V+   D+  ++LE+++ + + +I   T++ ++ S   Q  +LI + ++ F+ LLE     +  ++W+  +              S + +   F    L W+ F ++ +++M L  +  FG  +L+ L  +   L+  ES+
Sbjct:   51 RASKPHSTPATLQWLEENYEIAEGVCIPRSALYMHYLDFCEKLDSQPVNAASFGKIIRQQFPQLTTRRLGTRGQSKYHYYGIAVKESSQYYDVM-------YSKKGAAWVNETGKKEVTKQTVAYSPRSKLGTLLPDFPNVKDLNLPASLPEEKVSTFIMMYRTHCQRILDTVIRANFDEVQSFLLHFWQGMPPHMLPVLGSSTVVNIVGVCDSILYKAISGVLMPTVLQALPDSLTQVIRKFAKQLDEWLKVALHDLP---ENLRNIKFELSRRFSQILKRQTSLNHLCQASRTVIHSADITFQMLEDWRNVDLNSITKQTLYTMEDSREDQR-RLIIQLYQEFDRLLEDQSPIEAYIEWLDSMVERCVVRVAGKRPGSLKRVAQQF---LLMWSCFGTRVIRDMTLHSAPSFGSFHLIHLMFDDYVLYLLESL 471          
BLAST of Transcription factor RFX4 vs. Ensembl Zebrafish
Match: rfx6 (regulatory factor X, 6 [Source:NCBI gene;Acc:556925])

HSP 1 Score: 153.295 bits (386), Expect = 4.607e-39
Identity = 95/312 (30.45%), Postives = 158/312 (50.64%), Query Frame = 1
Query:  121 KRDSLHRTISWLKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVKKSSVYFNFNNIGDIDPYSQKTSPSLNVQHPKNRVDSVPKIQFTIET---------IKNSNNEDQLSQE-IGNFFIMYQTHSQQIIDSIIHGSFDEILKYLLSFWKTCPEHFKHLFEKSLLIDGVITIDLQVYVAVYRFVLHSMDHSLPDQYLKEFVHFLNNYSIILSNSIPAINKLLREKKIFYALMFKQMCFSWLRGSHLYKIIFPVLSHTDLISEILEEFQGICIENI 1026
            K+     T+ WL++NY   EGV L R  LY +Y  FCR         ATFGK IRQ+FP +TTRRLGTRG+SKYHY+G+ +K+SS Y++         YS K     +    KN      K   + +T          ++   +D +S+E +    +MY+TH Q I+D+ I+ +F+EI  +LL FW+  PEH   L E  +++D     D  +Y  +   ++ +    +P+  L +  +F  ++   + +S+  + ++L EKK+  A  F           HL +I  P L    +++ ++ +   + + +I
Sbjct:   49 KKKQTQLTLQWLEDNYIVCEGVCLPRCILYAHYLDFCRKEKLDPACAATFGKTIRQKFPLLTTRRLGTRGHSKYHYYGIGIKESSAYYH-------SVYSGKGLTRFSGSKLKNEGGFTRKYSLSSKTGTLLPEFPSAQHLVLQDSVSKEKVDTLIMMYKTHCQCILDNAINVNFEEIQNFLLHFWQGMPEHLLPLLENPVIVDIFCVCDSILYKVLTDVLIPATMQDMPESLLADIRNFAKHWEHWMLSSLENLPEILSEKKVPIARRFVSSLKRQTSFLHLAQIARPALFDQIVVTSMVNDIDKVDLNSI 353          
BLAST of Transcription factor RFX4 vs. Ensembl Zebrafish
Match: rfx6 (regulatory factor X, 6 [Source:NCBI gene;Acc:556925])

HSP 1 Score: 152.91 bits (385), Expect = 7.083e-39
Identity = 101/334 (30.24%), Postives = 166/334 (49.70%), Query Frame = 1
Query:   58 YSIPQIGYQI-PKMTDADGESTKRDSLHRTISWLKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVKKSSVYFNFNNIGDIDPYSQKTSPSLNVQHPKNRVDSVPKIQFTIET---------IKNSNNEDQLSQE-IGNFFIMYQTHSQQIIDSIIHGSFDEILKYLLSFWKTCPEHFKHLFEKSLLIDGVITIDLQVYVAVYRFVLHSMDHSLPDQYLKEFVHFLNNYSIILSNSIPAINKLLREKKIFYALMFKQMCFSWLRGSHLYKIIFPVLSHTDLISEILEEFQGICIENI 1026
            YS P    Q  PK + +     K+     T+ WL++NY   EGV L R  LY +Y  FCR         ATFGK IRQ+FP +TTRRLGTRG+SKYHY+G+ +K+SS Y++         YS K     +    KN      K   + +T          ++   +D +S+E +    +MY+TH Q I+D+ I+ +F+EI  +LL FW+  PEH   L E  +++D     D  +Y  +   ++ +    +P+  L +  +F  ++   + +S+  + ++L EKK+  A  F           HL +I  P L    +++ ++ +   + + +I
Sbjct:   86 YSKPFAAKQTQPKKSISQIIKDKKKQTQLTLQWLEDNYIVCEGVCLPRCILYAHYLDFCRKEKLDPACAATFGKTIRQKFPLLTTRRLGTRGHSKYHYYGIGIKESSAYYH-------SVYSGKGLTRFSGSKLKNEGGFTRKYSLSSKTGTLLPEFPSAQHLVLQDSVSKEKVDTLIMMYKTHCQCILDNAINVNFEEIQNFLLHFWQGMPEHLLPLLENPVIVDIFCVCDSILYKVLTDVLIPATMQDMPESLLADIRNFAKHWEHWMLSSLENLPEILSEKKVPIARRFVSSLKRQTSFLHLAQIARPALFDQIVVTSMVNDIDKVDLNSI 412          
BLAST of Transcription factor RFX4 vs. Ensembl Zebrafish
Match: rfx3 (regulatory factor X, 3 (influences HLA class II expression) [Source:NCBI gene;Acc:570989])

HSP 1 Score: 101.293 bits (251), Expect = 4.599e-22
Identity = 89/386 (23.06%), Postives = 160/386 (41.45%), Query Frame = 1
Query:   73 IGYQIPKMTDADGESTKRDSLHRT-ISWLKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVKKSSVYF----------------------------------NFNNIGDIDPYSQKTSPSLNVQHPKNRVDSVPKIQFTIETIKNSNNEDQLSQEIGNFFIMYQTHSQQIIDSIIHGSFDEILKYLLSFWK---TCPEHFKHLFEKSLL--IDGVI-------------------TIDLQVYVAVYRFVLHSMDHSLPDQYLKEFVHFLNNYSIILSNSIPAINKLLREKKIFYALMFKQMCFSWLRGSHLYKIIFPVLSHTDLISEILEEFQGICIENIIDDTVHIVQ 1053
            I   I  +  ++G S++R SL  + + WL +NY   EGVSL R TLY +Y   C+      ++ A+FGK+IR  F  + TRRLGTRGNSKYHY+G+ VK  S                                     NF++ G   P + + +     QH +  +D    +   +E       +    +++     +Y+ H + I+D +++  F+ I     +FW+   +       + E S L  I+G +                   T D  +Y A+   ++  +   +P    +   +F  +    L+N++ +I   +   K+     F Q    +   +HL +    VL +T  I+++L +   +   N+ +    + Q
Sbjct:  165 IEMAIETLQKSEGLSSQRSSLLNSHLQWLLDNYETAEGVSLPRSTLYNHYLRHCQEQKLDPVNAASFGKLIRSIFMGLRTRRLGTRGNSKYHYYGIRVKPDSPLNRLQEDMQYMALRQQPVQQKQRFKPVQKMDGVSGDNFSSAGQHTPNAAEQTFIAQSQHHQQFLDGSRALPEFVELDLGEAVDGVGPEDVKALQTLYREHCEAILDVVVNLQFNLIENLWQTFWRYSASSSVEGVTITENSGLSEIEGRLPRARLILLCRHEAVHKWMNTCDHLMYQALVEILIPDVLRPIPSALTQAIRNFAKSLEGWLTNAMSSIPPRMINTKVSAVSAFAQTLRRYTSLNHLAQAARAVLQNTSQINQMLSDLNRVDFANVQEQASWVCQ 550          
BLAST of Transcription factor RFX4 vs. Ensembl Xenopus
Match: RFX6 (regulatory factor X6 [Source:NCBI gene;Acc:100487566])

HSP 1 Score: 143.665 bits (361), Expect = 1.185e-35
Identity = 117/429 (27.27%), Postives = 205/429 (47.79%), Query Frame = 1
Query:  121 KRDSLHRTISWLKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVKKSSVYFNFNNIGDIDPYSQKTSPSLNVQHPKNRVDSVPKIQFTIET---IKNSNNEDQL-------SQEIGNFFIMYQTHSQQIIDSIIHGSFDEILKYLLSFWKTCPEHFKHLFEKSLLID------------GVITIDLQVYVAVYRFVLHSMDHSLPDQYLKEFVHFLNNYSIILSNSIPAINKLLREKKIFYALMFKQMCFSWLRGSHLYKIIFPVLSHTDLISEILEEFQGICIENIIDDTVHIVQSSAIPQMPQLIYEHXXXXXXXXXXXXXXXXXXKWVKDIFH-----SSWENMGISFKTC----FLTWTIFFSKFLQEMFLSLSKCFGQVNLVFLWLE 1314
            K+     T+ WL+ENY   EGV L R  LY +Y  FCR         ATFGK IRQ+FP +TTRRLGTRG+SKYHY+G+ +K+SS Y++         YS K     +    K+      K   + +T   +    +   L        +++    +MY+TH Q ++D+ I+G+F+EI  +LL FW+  P+H   L E  ++ID              + ID+ +Y+ VY F      H L    L +  +F  ++   + +S+  + + L EKK+  A  F           HL +I  P L   ++++ +  + + + + +I    + +   S       +  E F+  ++LL+ + + +  ++W+ ++       +S +N G S K       L W+ F ++ +  + L+ +  FG  +L+ + L+
Sbjct:  117 KKKQTQLTLQWLEENYIVCEGVCLPRCILYAHYLDFCRKEKLEPACAATFGKTIRQKFPLLTTRRLGTRGHSKYHYYGIGIKESSAYYH-------SVYSGKGLTRFSGSKLKSEGGFTRKYSLSSKTGTLLPEFPSAQHLVLQGCISKEKVDTLIMMYKTHCQCVLDNAINGNFEEIQHFLLHFWQGMPDHLLPLLENPIIIDIFCVCDSILYKVRSLLIDI-MYIIVYLFYFIYKMHFLLVSLLADIRNFAKHWEQWVVSSLENLPESLSEKKLPIARRFVSSLKRQTSFLHLAQIARPALFDQNVVNSMTSDIEKVDLCSIGSQAL-LTSCSGADSDCDVYTELFQELKDLLKKNATVESFIEWLDNVVEQKVIKASKQN-GKSLKKRAQDFLLKWSFFGARVMHNLTLNNASSFGSFHLIRMLLD 535          
BLAST of Transcription factor RFX4 vs. Ensembl Xenopus
Match: sstr2 (somatostatin receptor 2 [Source:Xenbase;Acc:XB-GENE-953419])

HSP 1 Score: 132.494 bits (332), Expect = 2.768e-32
Identity = 106/378 (28.04%), Postives = 194/378 (51.32%), Query Frame = 1
Query:  274 KIIRQQFPQITTRRLGTRGNSKYHYHGLAVKKSSVYFNFNNIGDIDPYSQKTSPSLN----VQHPKNRVDSVPKIQFTI-----ETIKNSNNEDQLSQE-IGNFFIMYQTHSQQIIDSIIHGSFDEILKYLLSFWKTCPEHFKHLFEKSLLIDGVITIDLQVYVAVYRFVLHSMDHSLPD---QYLKEFVHFLNNYSIILSNSIPAINKLLREKKIFYALMFKQMCFSWLRGSHLYKIIFPVLSHTDLISEILEEFQGICIENIIDDTVHIVQSSAIPQMPQLIYEHXXXXXXXXXXXXXXXXXXKWVKDIFHSSWENMGI----SFKTC----FLTWTIFFSKFLQEMFLSLSKCFGQVNLVFLWLEH--LFYTESM 1338
            +IIRQQFPQ+TTRRLGTRG SKYHY+G+AVK+SS Y++         YS+K +  +N     +  K  V   P+ +          +K+ N    L +E I  F +MY+TH Q+I+D++I  +FDE+  +LL FW+  P H   +   S +++ V   D  +Y A+   ++ ++  +LPD   Q +++F   L+ +  +  + +P   + LR  K   +  F Q+       +HL +    V+   D+  ++LE+++ + + +I   +++ ++ S   +  +LI + +  F++LLE     +  + W+  +      N+      S K       L W+ F ++ +++M L  +  FG  +L+ L  +   L+  ES+
Sbjct:   18 QIIRQQFPQLTTRRLGTRGQSKYHYYGIAVKESSQYYDVM-------YSKKGAAWVNETGKKEVTKQTVAYSPRSKLGTLLPEFPNVKDLNLPSSLPEEKISTFIMMYRTHCQRILDTVIRANFDEVQSFLLHFWQGMPPHMLPVLGSSTVVNIVGVCDSILYKAISGVLMPTVLQALPDSLTQVIRKFAKQLDEWLKVALHDLP---ENLRNIKFELSKRFSQILRRQTSLNHLCQASRTVIHSADITFQMLEDWRNVDLNSITKQSLYTIEDSR-EEHRKLIIQLYLEFDHLLEEQSPIESYIDWLDSMVDRCVVNVASKKQGSLKKVAQQFLLIWSCFGTRVIRDMTLHSAPSFGSFHLIHLMFDDYVLYLLESL 384          
BLAST of Transcription factor RFX4 vs. Ensembl Xenopus
Match: sstr2 (somatostatin receptor 2 [Source:Xenbase;Acc:XB-GENE-953419])

HSP 1 Score: 132.494 bits (332), Expect = 3.296e-32
Identity = 106/378 (28.04%), Postives = 194/378 (51.32%), Query Frame = 1
Query:  274 KIIRQQFPQITTRRLGTRGNSKYHYHGLAVKKSSVYFNFNNIGDIDPYSQKTSPSLN----VQHPKNRVDSVPKIQFTI-----ETIKNSNNEDQLSQE-IGNFFIMYQTHSQQIIDSIIHGSFDEILKYLLSFWKTCPEHFKHLFEKSLLIDGVITIDLQVYVAVYRFVLHSMDHSLPD---QYLKEFVHFLNNYSIILSNSIPAINKLLREKKIFYALMFKQMCFSWLRGSHLYKIIFPVLSHTDLISEILEEFQGICIENIIDDTVHIVQSSAIPQMPQLIYEHXXXXXXXXXXXXXXXXXXKWVKDIFHSSWENMGI----SFKTC----FLTWTIFFSKFLQEMFLSLSKCFGQVNLVFLWLEH--LFYTESM 1338
            +IIRQQFPQ+TTRRLGTRG SKYHY+G+AVK+SS Y++         YS+K +  +N     +  K  V   P+ +          +K+ N    L +E I  F +MY+TH Q+I+D++I  +FDE+  +LL FW+  P H   +   S +++ V   D  +Y A+   ++ ++  +LPD   Q +++F   L+ +  +  + +P   + LR  K   +  F Q+       +HL +    V+   D+  ++LE+++ + + +I   +++ ++ S   +  +LI + +  F++LLE     +  + W+  +      N+      S K       L W+ F ++ +++M L  +  FG  +L+ L  +   L+  ES+
Sbjct:   36 QIIRQQFPQLTTRRLGTRGQSKYHYYGIAVKESSQYYDVM-------YSKKGAAWVNETGKKEVTKQTVAYSPRSKLGTLLPEFPNVKDLNLPSSLPEEKISTFIMMYRTHCQRILDTVIRANFDEVQSFLLHFWQGMPPHMLPVLGSSTVVNIVGVCDSILYKAISGVLMPTVLQALPDSLTQVIRKFAKQLDEWLKVALHDLP---ENLRNIKFELSKRFSQILRRQTSLNHLCQASRTVIHSADITFQMLEDWRNVDLNSITKQSLYTIEDSR-EEHRKLIIQLYLEFDHLLEEQSPIESYIDWLDSMVDRCVVNVASKKQGSLKKVAQQFLLIWSCFGTRVIRDMTLHSAPSFGSFHLIHLMFDDYVLYLLESL 402          
BLAST of Transcription factor RFX4 vs. Ensembl Xenopus
Match: rfx3 (regulatory factor X3 [Source:NCBI gene;Acc:779608])

HSP 1 Score: 108.997 bits (271), Expect = 1.674e-24
Identity = 92/381 (24.15%), Postives = 161/381 (42.26%), Query Frame = 1
Query:   73 IGYQIPKMTDADGESTKRDSLHRT-ISWLKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVKKSSVYFNF--------------------------NNIGDIDPYSQKTSPSL------NVQHPKNRVDSVPKIQFTIETIKNSNNEDQLSQEIGNFFIMYQTHSQQIIDSIIHGSFDEILKYLLSFWKTCPE------------HFKHLFEKSLLI---------DGVITIDLQVYVAVYRFVLHSMDHSLPDQYLKEFVHFLNNYSIILSNSIPAINKLLREKKIFYALMFKQMCFSWLRGSHLYKIIFPVLSHTDLISEILEEFQGICIENIIDDTVHIVQ 1053
            I   I  +  +DG S+ R SL  + + WL +NY   EGVSL R TLY +Y   C+ H    ++ A+FGK+IR  F  + TRRLGTRGNSKYHY+G+ VK  S                               + +GD    S ++  S+        QH +  +D+   +    E   +S  +    ++I +   +Y+ H + I+D +++  F  I K   +FW+  P               +    KS LI           +   D  +Y ++   ++  +   +P    +   +F  +    LS+++  I + + + K+     F Q    +   +HL +    VL +T  I+++L +   +   N+ +    + Q
Sbjct:  129 IEMAIETLQKSDGLSSHRSSLLNSHLQWLLDNYETAEGVSLPRSTLYNHYLRHCQEHKLDPVNAASFGKLIRSIFMGLRTRRLGTRGNSKYHYYGIRVKPDSPLNRLQEDMQYMAMRQQPMQQKQRYKPMQKVDGVGDGFAGSGQSGASVEQTVIAQSQHHQQFLDASRALPEFAEVEISSLPDGTTFEDIKSLQSLYREHCEAILDVVVNLQFSLIEKLWQTFWRYSPSSPADGSTITESGEIESRLPKSKLILFCKNESIVKWMCNCDHMMYQSLVEILIPDVLRPIPSALTQAVRNFAKSLEGWLSSAMSNIPQRMIQTKVAAVSAFAQTLRRYTSLNHLAQAARAVLQNTSQINQMLNDLNRVDFANVQEQASWVCQ 509          
BLAST of Transcription factor RFX4 vs. Ensembl Xenopus
Match: rfx3 (regulatory factor X3 [Source:NCBI gene;Acc:779608])

HSP 1 Score: 107.842 bits (268), Expect = 3.145e-24
Identity = 86/353 (24.36%), Postives = 151/353 (42.78%), Query Frame = 1
Query:  142 TISWLKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVKKSSVYFNF--------------------------NNIGDIDPYSQKTSPSL------NVQHPKNRVDSVPKIQFTIETIKNSNNEDQLSQEIGNFFIMYQTHSQQIIDSIIHGSFDEILKYLLSFWKTCPEHFKHLF--------EKSLLI---------DGVITIDLQVYVAVYRFVLHSMDHSLPDQYLKEFVHFLNNYSIILSNSIPAINKLLREKKIFYALMFKQMCFSWLRGSHLYKIIFPVLSHTDLISEILEEFQGICIENIIDDTVHIVQ 1053
            T+ WL +NY   EGVSL R TLY +Y   C+ H    ++ A+FGK+IR  F  + TRRLGTRGNSKYHY+G+ VK  S                               + +GD    S ++  S+        QH +  +D+   +    E   +S  +    ++I +   +Y+ H + I+D +++  F  I K   +FW+  P     +F         KS LI           +   D  +Y ++   ++  +   +P    +   +F  +    LS+++  I + + + K+     F Q    +   +HL +    VL +T  I+++L +   +   N+ +    + Q
Sbjct:  104 TLQWLLDNYETAEGVSLPRSTLYNHYLRHCQEHKLDPVNAASFGKLIRSIFMGLRTRRLGTRGNSKYHYYGIRVKPDSPLNRLQEDMQYMAMRQQPMQQKQRYKPMQKVDGVGDGFAGSGQSGASVEQTVIAQSQHHQQFLDASRALPEFAEVEISSLPDGTTFEDIKSLQSLYREHCEAILDVVVNLQFSLIEKLWQTFWRYSPSSPNSIFTIEIESRLPKSKLILFCKNESIVKWMCNCDHMMYQSLVEILIPDVLRPIPSALTQAVRNFAKSLEGWLSSAMSNIPQRMIQTKVAAVSAFAQTLRRYTSLNHLAQAARAVLQNTSQINQMLNDLNRVDFANVQEQASWVCQ 456          
BLAST of Transcription factor RFX4 vs. Ensembl Mouse
Match: Rfx4 (regulatory factor X, 4 (influences HLA class II expression) [Source:MGI Symbol;Acc:MGI:1918387])

HSP 1 Score: 173.326 bits (438), Expect = 3.927e-46
Identity = 123/419 (29.36%), Postives = 220/419 (52.51%), Query Frame = 1
Query:  112 ESTKRDSLHRTISWLKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVKKSSVYFNFNNIGDIDPYSQK----TSPSLNVQHPKNRVDSVPKIQFTI-----ETIKNSNNEDQLSQE-IGNFFIMYQTHSQQIIDSIIHGSFDEILKYLLSFWKTCPEHFKHLFEKSLLIDGVITIDLQVYVAVYRFVLHSMDHSLPD---QYLKEFVHFLNNYSIILSNSIPAINKLLREKKIFYALMFKQMCFSWLRGSHLYKIIFPVLSHTDLISEILEEFQGICIENIIDDTVHIVQSSAIPQMPQLIYEHXXXXXXXXXXXXXXXXXXKWV-----KDIFHSSWENMGISFKTC---FLTWTIFFSKFLQEMFLSLSKCFGQVNLVFL 1305
             ++K  S   T+ WL+ENY   EGV + R  LY +Y  FC  +    ++ A+FGKIIRQQFPQ+TTRRLGTRG SKYHY+G+AVK+SS Y++         YS+K     S +   +  K  V   P+ +          +K+ N    L +E +  F +MY+TH Q+I+D++I  +FDE+  +LL FW+  P H   +   S +++ V   D  +Y A+   ++ ++  +LPD   Q +++F   L+ +  +  + +P   + LR  K   +  F Q+       +HL +    V+   D+  ++LE+++ + + +I   T++ ++ S   +  +LI + ++ F++LLE     +  ++W+     + +   + +  G   K      L W+ F ++ +++M L  +  FG  +L+ L
Sbjct:   51 RASKPHSTPATLQWLEENYEIAEGVCIPRSALYMHYLDFCEKNDTQPVNAASFGKIIRQQFPQLTTRRLGTRGQSKYHYYGIAVKESSQYYDVM-------YSKKGAAWVSETGKREVTKQTVAYSPRSKLGTLLPDFPNVKDLNLPASLPEEKVSTFIMMYRTHCQRILDTVIRANFDEVQSFLLHFWQGMPPHMLPVLGSSTVVNIVGVCDSILYKAISGVLMPTVLQALPDSLTQVIRKFAKQLDEWLKVALHDLP---ENLRNIKFELSRRFSQILRRQTSLNHLCQASRTVIHSADITFQMLEDWRNVDLSSITKQTLYTMEDSR-DEHRRLIIQLYQEFDHLLEEQSPIESYIEWLDTMVDRCVVKVAAKRQGSLKKVAQQFLLMWSCFGTRVIRDMTLHSAPSFGSFHLIHL 458          
BLAST of Transcription factor RFX4 vs. Ensembl Mouse
Match: Rfx6 (regulatory factor X, 6 [Source:MGI Symbol;Acc:MGI:2445208])

HSP 1 Score: 150.984 bits (380), Expect = 2.839e-38
Identity = 96/317 (30.28%), Postives = 159/317 (50.16%), Query Frame = 1
Query:  121 KRDSLHRTISWLKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVKKSSVYFNFNNIGDIDPYSQKTSPSLNVQHPKNRVDSVPKIQFTIET---IKNSNNEDQL-------SQEIGNFFIMYQTHSQQIIDSIIHGSFDEILKYLLSFWKTCPEHFKHLFEKSLLIDGVITIDLQVYVAVYRFVLHSMDHSLPDQYLKEFVHFLNNYSIILSNSIPAINKLLREKKI-----FYALMFKQMCFSWLRGSHLYKIIFPVLSHTDLISEILEEFQGICIENI 1026
            K+     T+ WL++NY   EGV L R  LY +Y  FCR         ATFGK IRQ+FP +TTRRLGTRG+SKYHY+G+ +K+SS Y++         YS K     +    KN      K   + +T   +    +   L         ++    +MY+TH Q I+D+ I+G+F+EI  +LL FW+  P+H   L E  ++ID     D  +Y  +   ++ +    +P+  L +  +F  N+   + +S+  + + L +KKI     F + + +Q  F      HL +I  P L    +++ ++ + + + + +I
Sbjct:  116 KKKQTQLTLQWLEDNYIVCEGVCLPRCILYAHYLDFCRKEKLEPACAATFGKTIRQKFPLLTTRRLGTRGHSKYHYYGIGIKESSAYYH-------SVYSGKGLTRFSGSKLKNEGGFTRKYSLSSKTGTLLPEFPSAQHLVYQGCISKDKVDTLIMMYKTHCQCILDNAINGNFEEIQHFLLHFWQGMPDHLLPLLENPVIIDIFCVCDSILYKVLTDVLIPATMQEMPESLLADIRNFAKNWEQWVVSSLENLPEALIDKKIPILRRFVSSLKRQTSF-----LHLAQIARPALFDQHVVNAMVSDIEKVDLNSI 420          
BLAST of Transcription factor RFX4 vs. Ensembl Mouse
Match: Rfx6 (regulatory factor X, 6 [Source:MGI Symbol;Acc:MGI:2445208])

HSP 1 Score: 115.161 bits (287), Expect = 1.907e-26
Identity = 70/195 (35.90%), Postives = 102/195 (52.31%), Query Frame = 1
Query:  121 KRDSLHRTISWLKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVKKSSVYFNFNNIGDIDPYSQKTSPSLNVQHPKNRVDSVPKIQFTIET---IKNSNNEDQL-------SQEIGNFFIMYQTHSQQIIDSIIHGSFDEILKYLL--SFWKTCPEHF 669
            K+     T+ WL++NY   EGV L R  LY +Y  FCR         ATFGK IRQ+FP +TTRRLGTRG+SKYHY+G+ +K+SS Y++         YS K     +    KN      K   + +T   +    +   L         ++    +MY+TH Q I+D+ I+G+F+E+L  +L  +  +  PE F
Sbjct:  116 KKKQTQLTLQWLEDNYIVCEGVCLPRCILYAHYLDFCRKEKLEPACAATFGKTIRQKFPLLTTRRLGTRGHSKYHYYGIGIKESSAYYH-------SVYSGKGLTRFSGSKLKNEGGFTRKYSLSSKTGTLLPEFPSAQHLVYQGCISKDKVDTLIMMYKTHCQCILDNAINGNFEEVLTDVLIPATMQEMPESF 303          
BLAST of Transcription factor RFX4 vs. Ensembl Mouse
Match: Rfx3 (regulatory factor X, 3 (influences HLA class II expression) [Source:MGI Symbol;Acc:MGI:106582])

HSP 1 Score: 109.383 bits (272), Expect = 1.069e-24
Identity = 98/387 (25.32%), Postives = 164/387 (42.38%), Query Frame = 1
Query:   73 IGYQIPKMTDADGESTKRDSLHRT-ISWLKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVKKSSVYFNFNNIGDIDPYSQKTSPSLNVQH--PKNRVDSVP--------KIQFTIE--TIKNSNNEDQLS-----------------------QEIGNFFIMYQTHSQQIIDSIIHGSFDEILKYLLSFWK---TCPEHFKHLFEKSLLID--------GVITI-------------DLQVYVAVYRFVLHSMDHSLPDQYLKEFVHFLNNYSIILSNSIPAINKLLREKKIFYALMFKQMCFSWLRGSHLYKIIFPVLSHTDLISEILEEFQGICIENIIDDTVHIVQ 1053
            I   I  +  +DG ST R SL  + + WL +NY   EGVSL R TLY +Y   C+ H    ++ A+FGK+IR  F  + TRRLGTRGNSKYHY+G+ VK  S         D+   + +  P    Q   P  +VD V         +   ++E   I  S +  Q                         ++I +   +Y+ H + I+D +++  F  I K   +FW+   + P     + E S L +         +IT+             D  +Y A+   ++  +   +P    +   +F  +    LSN++  I + + + K+     F Q    +   +HL +    VL +T  I+++L +   +   N+ +    + Q
Sbjct:  159 IEMAIETLQKSDGLSTHRSSLLNSHLQWLLDNYETAEGVSLPRSTLYNHYLRHCQEHKLDPVNAASFGKLIRSIFMGLRTRRLGTRGNSKYHYYGIRVKPDSPLNRLQE--DMQYMAMRQQPMQQKQRYKPMQKVDGVADGFTGSGQQTGTSVEQTVIAQSQHHQQFLDASRALPEFGEVEISSLPDGTTFEDIKSLQSLYREHCEAILDVVVNLQFSLIEKLWQTFWRYSPSTPADGTTITESSNLSEIESRLPKAKLITLCKHESILKWMCNCDHGMYQALVEILIPDVLRPIPSALTQAIRNFAKSLEGWLSNAMNNIPQRMIQTKVAAVSAFAQTLRRYTSLNHLAQAARAVLQNTSQINQMLSDLNRVDFANVQEQASWVCQ 543          
BLAST of Transcription factor RFX4 vs. Ensembl Mouse
Match: Rfx3 (regulatory factor X, 3 (influences HLA class II expression) [Source:MGI Symbol;Acc:MGI:106582])

HSP 1 Score: 109.383 bits (272), Expect = 1.069e-24
Identity = 98/387 (25.32%), Postives = 164/387 (42.38%), Query Frame = 1
Query:   73 IGYQIPKMTDADGESTKRDSLHRT-ISWLKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVKKSSVYFNFNNIGDIDPYSQKTSPSLNVQH--PKNRVDSVP--------KIQFTIE--TIKNSNNEDQLS-----------------------QEIGNFFIMYQTHSQQIIDSIIHGSFDEILKYLLSFWK---TCPEHFKHLFEKSLLID--------GVITI-------------DLQVYVAVYRFVLHSMDHSLPDQYLKEFVHFLNNYSIILSNSIPAINKLLREKKIFYALMFKQMCFSWLRGSHLYKIIFPVLSHTDLISEILEEFQGICIENIIDDTVHIVQ 1053
            I   I  +  +DG ST R SL  + + WL +NY   EGVSL R TLY +Y   C+ H    ++ A+FGK+IR  F  + TRRLGTRGNSKYHY+G+ VK  S         D+   + +  P    Q   P  +VD V         +   ++E   I  S +  Q                         ++I +   +Y+ H + I+D +++  F  I K   +FW+   + P     + E S L +         +IT+             D  +Y A+   ++  +   +P    +   +F  +    LSN++  I + + + K+     F Q    +   +HL +    VL +T  I+++L +   +   N+ +    + Q
Sbjct:  159 IEMAIETLQKSDGLSTHRSSLLNSHLQWLLDNYETAEGVSLPRSTLYNHYLRHCQEHKLDPVNAASFGKLIRSIFMGLRTRRLGTRGNSKYHYYGIRVKPDSPLNRLQE--DMQYMAMRQQPMQQKQRYKPMQKVDGVADGFTGSGQQTGTSVEQTVIAQSQHHQQFLDASRALPEFGEVEISSLPDGTTFEDIKSLQSLYREHCEAILDVVVNLQFSLIEKLWQTFWRYSPSTPADGTTITESSNLSEIESRLPKAKLITLCKHESILKWMCNCDHGMYQALVEILIPDVLRPIPSALTQAIRNFAKSLEGWLSNAMNNIPQRMIQTKVAAVSAFAQTLRRYTSLNHLAQAARAVLQNTSQINQMLSDLNRVDFANVQEQASWVCQ 543          
BLAST of Transcription factor RFX4 vs. UniProt
Match: sp|A2BGA0|RFX4_DANRE (Transcription factor RFX4 OS=Danio rerio OX=7955 GN=rfx4 PE=2 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 1.300e-45
Identity = 127/435 (29.20%), Postives = 224/435 (51.49%), Query Frame = 1
Query:  112 ESTKRDSLHRTISWLKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVKKSSVYFNFNNIGDIDPYSQKTSPSLN----VQHPKNRVDSVPKIQFTI-----ETIKNSNNEDQLSQE-IGNFFIMYQTHSQQIIDSIIHGSFDEILKYLLSFWKTCPEHFKHLFEKSLLIDGVITIDLQVYVAVYRFVLHSMDHSLPD---QYLKEFVHFLNNYSIILSNSIPAINKLLREKKIFYALMFKQMCFSWLRGSHLYKIIFPVLSHTDLISEILEEFQGICIENIIDDTVHIVQSSAIPQMPQLIYEHXXXXXXXXXXXXXXXXXXKWVKDIFH-----------SSWENMGISFKTCFLTWTIFFSKFLQEMFLSLSKCFGQVNLVFLWLEH--LFYTESM 1338
             ++K  S   T+ WL+ENY   EGV + R  LY +Y  FC       ++ A+FGKIIRQQFPQ+TTRRLGTRG SKYHY+G+AVK+SS Y++         YS+K +  +N     +  K  V   P+ +          +K+ N    L +E +  F +MY+TH Q+I+D++I  +FDE+  +LL FW+  P H   +   S +++ V   D  +Y A+   ++ ++  +LPD   Q +++F   L+ +  +  + +P   + LR  K   +  F Q+       +HL +    V+   D+  ++LE+++ + + +I   T++ ++ S   Q  +LI + ++ F+ LLE     +  ++W+  +              S + +   F    L W+ F ++ +++M L  +  FG  +L+ L  +   L+  ES+
Sbjct:   51 RASKPHSTPATLQWLEENYEIAEGVCIPRSALYMHYLDFCEKLDSQPVNAASFGKIIRQQFPQLTTRRLGTRGQSKYHYYGIAVKESSQYYDVM-------YSKKGAAWVNETGKKEVTKQTVAYSPRSKLGTLLPDFPNVKDLNLPASLPEEKVSTFIMMYRTHCQRILDTVIRANFDEVQSFLLHFWQGMPPHMLPVLGSSTVVNIVGVCDSILYKAISGVLMPTVLQALPDSLTQVIRKFAKQLDEWLKVALHDLP---ENLRNIKFELSRRFSQILKRQTSLNHLCQASRTVIHSADITFQMLEDWRNVDLNSITKQTLYTMEDSREDQR-RLIIQLYQEFDRLLEDQSPIEAYIEWLDSMVERCVVRVAGKRPGSLKRVAQQF---LLMWSCFGTRVIRDMTLHSAPSFGSFHLIHLMFDDYVLYLLESL 471          
BLAST of Transcription factor RFX4 vs. UniProt
Match: sp|Q33E94|RFX4_HUMAN (Transcription factor RFX4 OS=Homo sapiens OX=9606 GN=RFX4 PE=1 SV=2)

HSP 1 Score: 173.711 bits (439), Expect = 1.757e-45
Identity = 134/475 (28.21%), Postives = 240/475 (50.53%), Query Frame = 1
Query:  112 ESTKRDSLHRTISWLKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVKKSSVYFNFNNIGDIDPYSQK----TSPSLNVQHPKNRVDSVPKIQFTI-----ETIKNSNNEDQLSQE-IGNFFIMYQTHSQQIIDSIIHGSFDEILKYLLSFWKTCPEHFKHLFEKSLLIDGVITIDLQVYVAVYRFVLHSMDHSLPD---QYLKEFVHFLNNYSIILSNSIPAINKLLREKKIFYALMFKQMCFSWLRGSHLYKIIFPVLSHTDLISEILEEFQGICIENIIDDTVHIVQSSAIPQMPQLIYEHXXXXXXXXXXXXXXXXXXKWV-----KDIFHSSWENMGISFKTC---FLTWTIFFSKFLQEMFLSLSKCFGQVNLVFLWLEH--LFYTESMIQEFEHLIQTLNRIIYSETSLN--YSQCIQLNSTSPHPLPCKT 1461
             ++K  S   T+ WL+ENY   EGV + R  LY +Y  FC  +    ++ A+FGKIIRQQFPQ+TTRRLGTRG SKYHY+G+AVK+SS Y++         YS+K     S +   +  K  V   P+ +          +K+ N    L +E +  F +MY+TH Q+I+D++I  +FDE+  +LL FW+  P H   +   S +++ V   D  +Y A+   ++ ++  +LPD   Q +++F   L+ +  +  + +P   + LR  K   +  F Q+       +HL +    V+   D+  ++LE+++ + + +I   T++ ++ S   +  +LI + ++ F++LLE     +  ++W+     + +   + +  G   K      L W+ F ++ +++M L  +  FG  +L+ L  +   L+  ES+    +     L R +  E S      + I   + +P P P  +
Sbjct:   51 RASKPHSTPATLQWLEENYEIAEGVCIPRSALYMHYLDFCEKNDTQPVNAASFGKIIRQQFPQLTTRRLGTRGQSKYHYYGIAVKESSQYYDVM-------YSKKGAAWVSETGKKEVSKQTVAYSPRSKLGTLLPEFPNVKDLNLPASLPEEKVSTFIMMYRTHCQRILDTVIRANFDEVQSFLLHFWQGMPPHMLPVLGSSTVVNIVGVCDSILYKAISGVLMPTVLQALPDSLTQVIRKFAKQLDEWLKVALHDLP---ENLRNIKFELSRRFSQILRRQTSLNHLCQASRTVIHSADITFQMLEDWRNVDLNSITKQTLYTMEDSRD-EHRKLITQLYQEFDHLLEEQSPIESYIEWLDTMVDRCVVKVAAKRQGSLKKVAQQFLLMWSCFGTRVIRDMTLHSAPSFGSFHLIHLMFDDYVLYLLESL--HCQERANELMRAMKGEGSTAEVREEIILTEAAAPTPSPVPS 512          
BLAST of Transcription factor RFX4 vs. UniProt
Match: sp|Q7TNK1|RFX4_MOUSE (Transcription factor RFX4 OS=Mus musculus OX=10090 GN=Rfx4 PE=1 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 2.747e-45
Identity = 123/419 (29.36%), Postives = 220/419 (52.51%), Query Frame = 1
Query:  112 ESTKRDSLHRTISWLKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVKKSSVYFNFNNIGDIDPYSQK----TSPSLNVQHPKNRVDSVPKIQFTI-----ETIKNSNNEDQLSQE-IGNFFIMYQTHSQQIIDSIIHGSFDEILKYLLSFWKTCPEHFKHLFEKSLLIDGVITIDLQVYVAVYRFVLHSMDHSLPD---QYLKEFVHFLNNYSIILSNSIPAINKLLREKKIFYALMFKQMCFSWLRGSHLYKIIFPVLSHTDLISEILEEFQGICIENIIDDTVHIVQSSAIPQMPQLIYEHXXXXXXXXXXXXXXXXXXKWV-----KDIFHSSWENMGISFKTC---FLTWTIFFSKFLQEMFLSLSKCFGQVNLVFL 1305
             ++K  S   T+ WL+ENY   EGV + R  LY +Y  FC  +    ++ A+FGKIIRQQFPQ+TTRRLGTRG SKYHY+G+AVK+SS Y++         YS+K     S +   +  K  V   P+ +          +K+ N    L +E +  F +MY+TH Q+I+D++I  +FDE+  +LL FW+  P H   +   S +++ V   D  +Y A+   ++ ++  +LPD   Q +++F   L+ +  +  + +P   + LR  K   +  F Q+       +HL +    V+   D+  ++LE+++ + + +I   T++ ++ S   +  +LI + ++ F++LLE     +  ++W+     + +   + +  G   K      L W+ F ++ +++M L  +  FG  +L+ L
Sbjct:   51 RASKPHSTPATLQWLEENYEIAEGVCIPRSALYMHYLDFCEKNDTQPVNAASFGKIIRQQFPQLTTRRLGTRGQSKYHYYGIAVKESSQYYDVM-------YSKKGAAWVSETGKREVTKQTVAYSPRSKLGTLLPDFPNVKDLNLPASLPEEKVSTFIMMYRTHCQRILDTVIRANFDEVQSFLLHFWQGMPPHMLPVLGSSTVVNIVGVCDSILYKAISGVLMPTVLQALPDSLTQVIRKFAKQLDEWLKVALHDLP---ENLRNIKFELSRRFSQILRRQTSLNHLCQASRTVIHSADITFQMLEDWRNVDLSSITKQTLYTMEDSR-DEHRRLIIQLYQEFDHLLEEQSPIESYIEWLDTMVDRCVVKVAAKRQGSLKKVAQQFLLMWSCFGTRVIRDMTLHSAPSFGSFHLIHL 458          
BLAST of Transcription factor RFX4 vs. UniProt
Match: sp|Q8HWS3|RFX6_HUMAN (DNA-binding protein RFX6 OS=Homo sapiens OX=9606 GN=RFX6 PE=1 SV=2)

HSP 1 Score: 153.68 bits (387), Expect = 3.039e-38
Identity = 116/427 (27.17%), Postives = 206/427 (48.24%), Query Frame = 1
Query:  121 KRDSLHRTISWLKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVKKSSVYFNFNNIGDIDPYSQKTSPSLNVQHPKNRVDSVPKIQFTIET---IKNSNNEDQL-------SQEIGNFFIMYQTHSQQIIDSIIHGSFDEILKYLLSFWKTCPEHFKHLFEKSLLIDGVITIDLQVYVAVYRFVLHSMDHSLPDQYLKEFVHFLNNYSIILSNSIPAINKLLREKKI-----FYALMFKQMCFSWLRGSHLYKIIFPVLSHTDLISEILEEFQGICIENIIDDTVHIVQSSAIPQMPQLIYEHXXXX-----XXXXXXXXXXXXXXKWV-----KDIFHSSWENMGISFKTC----FLTWTIFFSKFLQEMFLSLSKCFGQVNLVFLWLE 1314
            K+     T+ WL+ENY   EGV L R  LY +Y  FCR         ATFGK IRQ+FP +TTRRLGTRG+SKYHY+G+ +K+SS Y++         YS K     +    KN      K   + +T   +    +   L         ++    +MY+TH Q I+D+ I+G+F+EI  +LL FW+  P+H   L E  ++ID     D  +Y  +   ++ +    +P+  L +  +F  N+   + +S+  + + L +KKI     F + + +Q  F      HL +I  P L    +++ ++ + + + + +I    +  +  S   +   +  EH         ++LL+ + + +  ++W+     + +  +S +N G S K       L W+ F ++ +  + L+ +  FG  +L+ + L+
Sbjct:  117 KKKQTQLTLQWLEENYIVCEGVCLPRCILYAHYLDFCRKEKLEPACAATFGKTIRQKFPLLTTRRLGTRGHSKYHYYGIGIKESSAYYH-------SVYSGKGLTRFSGSKLKNEGGFTRKYSLSSKTGTLLPEFPSAQHLVYQGCISKDKVDTLIMMYKTHCQCILDNAINGNFEEIQHFLLHFWQGMPDHLLPLLENPVIIDIFCVCDSILYKVLTDVLIPATMQEMPESLLADIRNFAKNWEQWVVSSLENLPEALTDKKIPIVRRFVSSLKRQTSF-----LHLAQIARPALFDQHVVNSMVSDIERVDLNSIGSQALLTISGSTDTES-GIYTEHDSITVFQELKDLLKKNATVEAFIEWLDTVVEQRVIKTSKQN-GRSLKKRAQDFLLKWSFFGARVMHNLTLNNASSFGSFHLIRMLLD 529          
BLAST of Transcription factor RFX4 vs. UniProt
Match: sp|Q5RJA1|RFX6_DANRE (DNA-binding protein RFX6 OS=Danio rerio OX=7955 GN=rfx6 PE=2 SV=2)

HSP 1 Score: 153.295 bits (386), Expect = 3.477e-38
Identity = 95/312 (30.45%), Postives = 158/312 (50.64%), Query Frame = 1
Query:  121 KRDSLHRTISWLKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVKKSSVYFNFNNIGDIDPYSQKTSPSLNVQHPKNRVDSVPKIQFTIET---------IKNSNNEDQLSQE-IGNFFIMYQTHSQQIIDSIIHGSFDEILKYLLSFWKTCPEHFKHLFEKSLLIDGVITIDLQVYVAVYRFVLHSMDHSLPDQYLKEFVHFLNNYSIILSNSIPAINKLLREKKIFYALMFKQMCFSWLRGSHLYKIIFPVLSHTDLISEILEEFQGICIENI 1026
            K+     T+ WL++NY   EGV L R  LY +Y  FCR         ATFGK IRQ+FP +TTRRLGTRG+SKYHY+G+ +K+SS Y++         YS K     +    KN      K   + +T          ++   +D +S+E +    +MY+TH Q I+D+ I+ +F+EI  +LL FW+  PEH   L E  +++D     D  +Y  +   ++ +    +P+  L +  +F  ++   + +S+  + ++L EKK+  A  F           HL +I  P L    +++ ++ +   + + +I
Sbjct:   49 KKKQTQLTLQWLEDNYIVCEGVCLPRCILYAHYLDFCRKEKLDPACAATFGKTIRQKFPLLTTRRLGTRGHSKYHYYGIGIKESSAYYH-------SVYSGKGLTRFSGSKLKNEGGFTRKYSLSSKTGTLLPEFPSAQHLVLQDSVSKEKVDTLIMMYKTHCQCILDNAINVNFEEIQNFLLHFWQGMPEHLLPLLENPVIVDIFCVCDSILYKVLTDVLIPATMQDMPESLLADIRNFAKHWEHWMLSSLENLPEILSEKKVPIARRFVSSLKRQTSFLHLAQIARPALFDQIVVTSMVNDIDKVDLNSI 353          
BLAST of Transcription factor RFX4 vs. TrEMBL
Match: gnl|BL_ORD_ID|23857828 (tr|V4B1B6|V4B1B6_LOTGI RFX-type winged-helix domain-containing protein (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_113173 PE=4 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 2.761e-47
Identity = 122/436 (27.98%), Postives = 223/436 (51.15%), Query Frame = 1
Query:  112 ESTKRDSLHRTISWLKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVKKSSVYFNF----NNIGDIDPYSQKTSPSLNVQHPKNRVDSVPKIQFTIETIKNSNNEDQLSQEIGNFFIMYQTHSQQIIDSIIHGSFDEILKYLLSFWKTCPEHFKHLFEKSLLIDGVITIDLQVYVAVYRFVLHSMDHSLPD---QYLKEFVHFLNNYSIILSNSIPAINKLLREKKIFYALMFKQMCFSWLRGSHLYKIIFPVLSHTDLISEILEEFQGICIENIIDDTV----------HIVQSSAIPQMPQLIYEHXXXXXXXXXXXXXXXXXXKWV-----KDIFHSSWENMGISFKTC---FLTWTIFFSKFLQEMFLSLSKCFGQVNLVFLWLEH--LFYTESM 1338
              +K  S   T+ WL+ENY   EGV + R TLY +Y  FC  +  + I+ A+FGKIIRQQFPQITTRRLGTRG SKYHY+G+ V+++S Y++       I       ++ S  +    P++++ ++     ++  IK   N ++  +++  F +MY+TH Q+I+D++I  +FDE+  +L+ FW+  P H   + + S ++  V   D  +Y AV   ++ ++  +LP+   Q ++ F   L+ + ++  N++P     LR  K   A  F Q+       +HL +    V+  +D+ S++L+++  I + +II  T+          H++  +   +  +L+ E             + +  ++W+     K +   S +  G   K      L W+ F ++ +++M L  +  FG  +L+ L  +   L+  ES+
Sbjct:    1 RGSKPHSTPLTLKWLEENYEIAEGVCIPRSTLYLHYLDFCERNDSNPINAASFGKIIRQQFPQITTRRLGTRGQSKYHYYGIGVRETSSYYDIMYSSKGIQSAGDGKKECSKQVIAYSPRSKLGTLLPDFPSVREIKIPANIEE--EKVSTFLVMYRTHCQRILDTVIRANFDEVQNFLMHFWQGMPSHIVPILDSSTIVMLVGVCDSILYKAVSSVLMPTVLQALPESLTQVIRRFAKQLDEWLMLALNNLP---DTLRRVKFDLARRFSQVLRRQTSLNHLCQAARTVIHSSDITSQMLDDWLNIDLNSIIKQTLYTMDQYTDKDHMIIVNLCSEFEKLLEEQ-----------SAIECYIEWLDNMVDKCVVQPSSKKPGTLRKIARQFLLMWSCFGTRVIRDMTLHSAPSFGSFHLLHLMFDDYVLYLVESL 420          
BLAST of Transcription factor RFX4 vs. TrEMBL
Match: gnl|BL_ORD_ID|23900200 (tr|K1QV89|K1QV89_CRAGI Transcription factor RFX4 OS=Crassostrea gigas OX=29159 GN=CGI_10018775 PE=4 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 8.529e-47
Identity = 127/430 (29.53%), Postives = 219/430 (50.93%), Query Frame = 1
Query:  118 TKRDSLHRTISWLKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVKKSSVYFNFNNIGDIDPYSQKTSPSLN-----------VQHPKNRVDSVPKIQFTIETIKNSNNEDQLSQEIGNFFIMYQTHSQQIIDSIIHGSFDEILKYLLSFWKTCPEHFKHLFEKSLLIDGVITIDLQVYVAVYRFVLHSMDHSLPD---QYLKEFVHFLNNYSIILSNSIPAINKLLREKKIFYALMFKQMCFSWLRGSHLYKIIFPVLSHTDLISEILEEFQGICIENIIDDTVHIVQ---SSAIPQMPQLIYEHXXXXXXXXXXXXXXXXXXKWVKDIFHSSWENMGISFKTC----FLTWTIFFSKFLQEMFLSLSKCFGQVNLVFLWLEH--LFYTESM 1338
            +K  S   T+ WL+ENY   E V + R TLY +Y  +C ++    ++ A+FGKIIRQQFPQITTRRLGTRG SKYHY+G+ V+++S YF          YS K +PS N              P++++ ++      I+ IK    +D    ++  F +MY+TH Q+I+D++I  +FDE+  +LL FW+  PEH   + +    +  V   D  +Y A+   ++ S+  +LPD   Q +K F   L+ +  +  +S+P+    +RE K   A  F Q+    +  +HL +    V+ + D+ +++LE++  + +  II  T++ ++      +  +  L  E  +  ++   L    + L + V        +N   S +       L W+ F ++ +++M L  S  FG  +L+ L  +   LF  E++
Sbjct:   67 SKSHSTPSTLKWLEENYEIAEAVCIPRSTLYCHYLDYCETNDTQPVNAASFGKIIRQQFPQITTRRLGTRGQSKYHYYGIGVRETSKYFE-------TVYSAKGTPSSNEGKKETVKQIVAYSPRSKLGTLLPDFPDIKDIKLP--DDVPEDKVLTFMMMYRTHCQRILDTVIRANFDEVQSFLLHFWQGMPEHMMAILDSQTTVLLVGVCDTMLYKAIANVLMPSVLQALPDSLIQVIKNFSQQLDEWLKVALDSLPSG---IREVKFDLARRFSQILRRQISLNHLCQAARSVVHNPDISAQMLEDWISVDLSGIIKQTMYTMERYREKVMETIVNLCNEFEQLLDDQAPLQSYTEWLDRMVDRCVVQFAKNRPGSLRRTARQFLLMWSCFCTRIIRDMTLHSSPSFGSFHLLHLMFDDYVLFLVENL 484          
BLAST of Transcription factor RFX4 vs. TrEMBL
Match: gnl|BL_ORD_ID|174952978 (tr|A0A5A9NZQ5|A0A5A9NZQ5_9TELE Transcription factor RFX4 OS=Triplophysa tibetana OX=1572043 GN=E1301_Tti008869 PE=4 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 1.138e-46
Identity = 136/486 (27.98%), Postives = 242/486 (49.79%), Query Frame = 1
Query:  112 ESTKRDSLHRTISWLKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVKKSSVYFNFNNIGDIDPYSQKTSPSLN----VQHPKNRVDSVPKIQFTI-----ETIKNSNNEDQLSQE-IGNFFIMYQTHSQQIIDSIIHGSFDEILKYLLSFWKTCPEHFKHLFEKSLLIDGVITIDLQVYVAVYRFVLHSMDHSLPD---QYLKEFVHFLNNYSIILSNSIPAINKLLREKKIFYALMFKQMCFSWLRGSHLYKIIFPVLSHTDLISEILEEFQGICIENIIDDTVHIVQSSAIPQMPQLIYEHXXXXXXXXXXXXXXXXXXKWVKDIFHSSWENMGISFKTC--------FLTWTIFFSKFLQEMFLSLSKCFGQVNLVFLWLEH--LFYTESMIQEFEHLIQTLNRIIYS----ETSLNYSQCIQLNSTSPHPL---PCKTEIELHN 1479
             ++K  S   T+ WL+ENY   EGV + R  LY +Y  FC  H    ++ A+FGKIIRQQFPQ+TTRRLGTRG SKYHY+G+AVK+SS Y++         YS+K +  +N     +  K  V   P+ +          +K+ N    L +E +  F +MY+TH Q+I+D++I  +FDE+  +LL FW+  P H   +   S++++ V   D  +Y A+   ++ ++  +LPD   Q +++F   L+ +  +  + +P   + LR  K   +  F Q+       +HL +    V+   D+  ++LE+++ + + +I   T++ ++ S   Q   LI + ++ F+ LLE     +  ++W+  +       +      C         L W+ F ++ +++M L  +  FG  +L+ L  +   L+  ES+     H  +  N ++ S        +  + + L  ++P P    PC     +H+
Sbjct:   51 RASKPHSTPATLQWLEENYEIAEGVCIPRSALYMHYLDFCEKHDSQPVNAASFGKIIRQQFPQLTTRRLGTRGQSKYHYYGIAVKESSQYYDVM-------YSKKGAAWVNETGKKEVTKQTVAYSPRSKLGTLLPEFPNVKDLNLPASLPEEKVATFIMMYRTHCQRILDTVIRANFDEVQSFLLHFWQGMPPHMLPVLGSSIVVNIVGVCDSILYKAISGVLMPTVLQALPDSLTQVIRKFAKQLDEWLKVALHDLP---ENLRNIKFELSRRFSQILKRQTSLNHLCQASRTVIHSADITFQMLEDWRNVDLNSITKQTLYTMEDSREDQR-GLIVQLYQEFDRLLEDQSPIEAYIEWLDSMVERCVVRVAGKRPGCLKRLAQQFLLMWSCFGTRVIRDMTLHSAPSFGSFHLIHLMFDDYVLYLLESL-----HCQERANELMRSMKGEGAPADTGEELMLMGSTPTPTSPEPCSPAKSIHS 520          
BLAST of Transcription factor RFX4 vs. TrEMBL
Match: gnl|BL_ORD_ID|172140854 (tr|W5LLN7|W5LLN7_ASTMX Regulatory factor X, 4 OS=Astyanax mexicanus OX=7994 PE=4 SV=2)

HSP 1 Score: 184.111 bits (466), Expect = 1.231e-46
Identity = 137/483 (28.36%), Postives = 245/483 (50.72%), Query Frame = 1
Query:  112 ESTKRDSLHRTISWLKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVKKSSVYFNFNNIGDIDPYSQKTSPSLN----VQHPKNRVDSVPKIQFTI-----ETIKNSNNEDQLSQE-IGNFFIMYQTHSQQIIDSIIHGSFDEILKYLLSFWKTCPEHFKHLFEKSLLIDGVITIDLQVYVAVYRFVLHSMDHSLPD---QYLKEFVHFLNNYSIILSNSIPAINKLLREKKIFYALMFKQMCFSWLRGSHLYKIIFPVLSHTDLISEILEEFQGICIENIIDDTVHIVQSSAIPQMPQLIYEHXXXXXXXXXXXXXXXXXXKWVKDIFHSSWENMGISFKTC--------FLTWTIFFSKFLQEMFLSLSKCFGQVNLVFLWLEH--LFYTESMIQEFEHLIQTLNRIIYSETSL-NYSQCIQLNSTSP---HPLPCKTEIELHN 1479
            +++KR S   T+ WL+ENY   EGV + R  LY +Y  FC  H    ++ A+FGKIIRQQFPQ+TTRRLGTRG SKYHY+G+AVK+SS Y++         YS+K +  +N     +  K  V   P+ +          +K+ N    L +E +  F +MY+TH Q+I+D++I  +FDE+  +LL FW+  P H   +   S +++ V   D  +Y A+   ++ ++  +LPD   Q +++F   L+ +  +  + +P   + LR  K   +  F Q+       +HL +    V+   D+  ++LE+++ + + +I   T++ ++ S   Q  +LI + ++ F+ LLE     +  ++W+  +       +      C         L W+ F ++ +++M L  +  FG  +L+ L  +   L+  ES+    +     L R +  E ++ +  + + L  T+P    P+P      +H+
Sbjct:   51 QASKRHSTPATLEWLEENYEITEGVCIPRSALYMHYLDFCEKHDSQPVNAASFGKIIRQQFPQLTTRRLGTRGQSKYHYYGIAVKESSQYYDVM-------YSKKGAAWVNETGKKEVTKQTVAYSPRSKLGTLLPEFPNVKDLNLPAALPEEKVSTFIMMYRTHCQRILDTVIRANFDEVQSFLLHFWQGMPPHMLPVLSSSTVVNIVGVCDSILYKAISGVLMPTVLQALPDSLTQVIRKFAKQLDEWLKMALHDLP---ENLRNIKFELSRRFSQILKRQTSLNHLCQASRTVIHSADITFQMLEDWRNVDLNSITKQTLYTMEDSQEDQR-RLIIQLYQEFDRLLEDQSPIEAYIEWLDSMVDRCVVRVAGKRPGCLKKVAQQFLLMWSCFGTRVIRDMTLHSAPSFGSFHLIHLMFDDYVLYLLESL--HCQERANELMRAMKGEGTVGDTDENMMLTETTPTSLSPVPYSPAKSVHS 520          
BLAST of Transcription factor RFX4 vs. TrEMBL
Match: gnl|BL_ORD_ID|174538452 (tr|A0A2D0QQJ6|A0A2D0QQJ6_ICTPU transcription factor RFX4 isoform X2 OS=Ictalurus punctatus OX=7998 GN=rfx4 PE=4 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 2.036e-46
Identity = 134/443 (30.25%), Postives = 229/443 (51.69%), Query Frame = 1
Query:   97 TDADGE------STKRDSLHRTISWLKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVKKSSVYFNFNNIGDIDPYSQKTSPSLN----VQHPKNRVDSVPKIQFTI-----ETIKNSNNEDQLS-QEIGNFFIMYQTHSQQIIDSIIHGSFDEILKYLLSFWKTCPEHFKHLFEKSLLIDGVITIDLQVYVAVYRFVLHSMDHSLPD---QYLKEFVHFLNNYSIILSNSIPAINKLLREKKIFYALMFKQMCFSWLRGSHLYKIIFPVLSHTDLISEILEEFQGICIENIIDDTVHIVQSSAIPQMPQLIYEHXXXXXXXXXXXXXXXXXXKWVKD-----IFHSSWENMGISFKTC---FLTWTIFFSKFLQEMFLSLSKCFGQVNLVFLWLEH--LFYTESM 1338
            TD D E      ++KR S   T+ WL+ENY   EGV + R  LY +Y  FC  H    ++ A+FGKIIRQQFPQ+TTRRLGTRG SKYHY+GLAVK+SS Y++         YS+K    +N     +  K  V   P+ +          +K+ N    L  Q++  F +MY+TH Q+I+D++I  +FDE+  +LL FW+  P H   +   S +++ V   D  +Y A+   ++ ++  +LPD   Q +++F   L+ +  +  + +P   + LR  K   +  F Q+       +HL +    V+   D+  ++LE+++ + + +I   T++ ++ S   Q  +LI + ++ F+ LLE     +  ++W+       +   + +  G   K      L W+ F ++ +++M L  +  FG  +L+ L  +   L+  ES+
Sbjct:   41 TDTDNEEKENNRASKRHSTPATLQWLEENYEIAEGVCVPRSALYMHYLDFCEKHGTQPVNAASFGKIIRQQFPQLTTRRLGTRGQSKYHYYGLAVKESSQYYDVM-------YSKKGGAWVNETGKKEVTKQTVAYSPRSKLGTLLPEFPNVKDLNLPAILPEQKVSTFIMMYRTHCQRILDTVIRANFDEVQSFLLHFWQGMPPHMLPVLGSSTVVNIVGVCDSILYKAISGVLMPTVLQALPDSLTQVIRKFAKQLDEWLRVALHDLP---ENLRNIKFELSRRFSQILKRQTSLNHLCQASRTVIHSADITFQMLEDWRNVDLNSITKQTLYTMEDSREDQR-RLIIQLYQEFDRLLEDQSPIEAYIEWLDSMVDRCVVRVAGKRPGSLKKVAQQFLLMWSCFGTRVIRDMTLHSAPSFGSFHLIHLMFDDYVLYLLESL 472          
BLAST of Transcription factor RFX4 vs. Ensembl Cavefish
Match: rfx4 (regulatory factor X, 4 [Source:NCBI gene;Acc:403016])

HSP 1 Score: 184.111 bits (466), Expect = 4.661e-50
Identity = 137/483 (28.36%), Postives = 245/483 (50.72%), Query Frame = 1
Query:  112 ESTKRDSLHRTISWLKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVKKSSVYFNFNNIGDIDPYSQKTSPSLN----VQHPKNRVDSVPKIQFTI-----ETIKNSNNEDQLSQE-IGNFFIMYQTHSQQIIDSIIHGSFDEILKYLLSFWKTCPEHFKHLFEKSLLIDGVITIDLQVYVAVYRFVLHSMDHSLPD---QYLKEFVHFLNNYSIILSNSIPAINKLLREKKIFYALMFKQMCFSWLRGSHLYKIIFPVLSHTDLISEILEEFQGICIENIIDDTVHIVQSSAIPQMPQLIYEHXXXXXXXXXXXXXXXXXXKWVKDIFHSSWENMGISFKTC--------FLTWTIFFSKFLQEMFLSLSKCFGQVNLVFLWLEH--LFYTESMIQEFEHLIQTLNRIIYSETSL-NYSQCIQLNSTSP---HPLPCKTEIELHN 1479
            +++KR S   T+ WL+ENY   EGV + R  LY +Y  FC  H    ++ A+FGKIIRQQFPQ+TTRRLGTRG SKYHY+G+AVK+SS Y++         YS+K +  +N     +  K  V   P+ +          +K+ N    L +E +  F +MY+TH Q+I+D++I  +FDE+  +LL FW+  P H   +   S +++ V   D  +Y A+   ++ ++  +LPD   Q +++F   L+ +  +  + +P   + LR  K   +  F Q+       +HL +    V+   D+  ++LE+++ + + +I   T++ ++ S   Q  +LI + ++ F+ LLE     +  ++W+  +       +      C         L W+ F ++ +++M L  +  FG  +L+ L  +   L+  ES+    +     L R +  E ++ +  + + L  T+P    P+P      +H+
Sbjct:   51 QASKRHSTPATLEWLEENYEITEGVCIPRSALYMHYLDFCEKHDSQPVNAASFGKIIRQQFPQLTTRRLGTRGQSKYHYYGIAVKESSQYYDVM-------YSKKGAAWVNETGKKEVTKQTVAYSPRSKLGTLLPEFPNVKDLNLPAALPEEKVSTFIMMYRTHCQRILDTVIRANFDEVQSFLLHFWQGMPPHMLPVLSSSTVVNIVGVCDSILYKAISGVLMPTVLQALPDSLTQVIRKFAKQLDEWLKMALHDLP---ENLRNIKFELSRRFSQILKRQTSLNHLCQASRTVIHSADITFQMLEDWRNVDLNSITKQTLYTMEDSQEDQR-RLIIQLYQEFDRLLEDQSPIEAYIEWLDSMVDRCVVRVAGKRPGCLKKVAQQFLLMWSCFGTRVIRDMTLHSAPSFGSFHLIHLMFDDYVLYLLESL--HCQERANELMRAMKGEGTVGDTDENMMLTETTPTSLSPVPYSPAKSVHS 520          
BLAST of Transcription factor RFX4 vs. Ensembl Cavefish
Match: rfx6 (regulatory factor X, 6 [Source:NCBI gene;Acc:556925])

HSP 1 Score: 108.997 bits (271), Expect = 1.192e-24
Identity = 84/315 (26.67%), Postives = 139/315 (44.13%), Query Frame = 1
Query:  121 KRDSLHRTISWLKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVK------------KSSVYFNFNNIGDIDPYSQKTSPSLNVQHPKNRVDSVPKIQFTIETIKNSNNEDQLSQE-IGNFFIMYQTHSQQIIDSIIHGSFDEILKYLLSFWKTCPEHFKHLFEKSLLIDGVITIDLQVYVAVYRFVLHSMDHSLPDQYLKEFVHFLNNYSIILSNSIPAINKLLREKKIFYALMFKQMCFSWLRGSHLYKIIFPVLSHTDLISEILEEFQGICIENI 1026
            K+     T+ WL+ENY   EGV L R  LY +Y  FCR         ATFGK IRQ+FP +TTRRLGTRG+SKYHY+G+ +K            K    F+ + + +   +++K S S         +   P  Q  +        +D +S+E +    +MY+TH Q I+D+ I  +F+E+                       L D +I   +Q                +P+  L +  +F  ++   + +S+  +  +L EKK+  A  F           HL +I  P L   ++++ ++ +   + + +I
Sbjct:   45 KKKQTQLTLLWLEENYIVCEGVCLPRCILYAHYLDFCRKEKLDPACAATFGKTIRQKFPLLTTRRLGTRGHSKYHYYGIGIKESSSYYHSVYSGKGLTRFSGSKLKNEGGFTRKYSLSSKT---GTLLPEFPSAQHLVL-------DDSVSKEKVDTLIMMYKTHCQCILDNAISVNFEEV-----------------------LTDVLIPATMQ---------------DMPESLLADIRNFAKHWEHWMVSSLENLPDVLSEKKLPIARRFVSSLKRQTSFLHLAQIARPALFDQNVVTSMVNDIDKVDLNSI 311          
BLAST of Transcription factor RFX4 vs. Ensembl Cavefish
Match: rfx3 (regulatory factor X3 [Source:NCBI gene;Acc:103029090])

HSP 1 Score: 103.219 bits (256), Expect = 8.520e-23
Identity = 92/386 (23.83%), Postives = 161/386 (41.71%), Query Frame = 1
Query:   85 IPKMTDADGESTKRDSLHRT-ISWLKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVKKSSVYFNFNN---------------------------IGDIDPYSQKTSPS-------LNVQHPKNRVDSVPKI-QFTIETIKNSNNEDQLSQEIGNFFIMYQTHSQQIIDSIIHGSFDEILKYLLSFWKTCPEHFKHLFEKSLLI--DGVITI-------------------------DLQVYVAVYRFVLHSMDHSLPDQYLKEFVHFLNNYSIILSNSIPAINKLLREKKIFYALMFKQMCFSWLRGSHLYKIIFPVLSHTDLISEILEEFQGICIENIIDDTVHIVQ 1053
            I  +   +G S++R +L  + + WL +NY   +GVSL R TLY +Y   C+      ++ A+FGK+IR  F  + TRRLGTRGNSKYHY+G+ VK  S                                   GD  P S + +P+          QH +  +D+   + +F    +     ED   ++I     +Y+ H + I+D +++  F  I K   +FW+  P    +  E + +I   GV  I                         D  +Y A+   ++  +   +P    +   +F  +    L+N++ AI + + + K+     F Q    +   +HL +    VL +T  I+++L +   +   N+ +    + Q
Sbjct:  161 IETLQKTEGLSSQRSALLNSHLQWLLDNYETADGVSLPRSTLYSHYLRHCQEQKLDPVNAASFGKLIRSIFMGLRTRRLGTRGNSKYHYYGIRVKPDSPLNRLQEDMQYMALRQQPVQQKQRYKPVQKMDGFSGDNYPSSGQHTPNAAEQTVIAQSQHHQQFLDASRALPEFVELDLGEHGVEDVSMEDIKALQTLYREHCEAILDVVVNLQFSLIEKLWQTFWRYSP---SNTIEGATIIQNSGVSEIEGRLPRARLLLLCRSEAVLKWMSACDHLMYQALVEILIPDVLRPIPSALTQAIRNFAKSLEGWLTNAMSAIPQKMIQTKVSTVSAFAQTLRRYTSLNHLAQAARAVLQNTSQINQMLSDLNRVDFVNVQEQASWVCQ 543          
BLAST of Transcription factor RFX4 vs. Ensembl Cavefish
Match: rfx3 (regulatory factor X3 [Source:NCBI gene;Acc:103029090])

HSP 1 Score: 101.679 bits (252), Expect = 2.898e-22
Identity = 88/366 (24.04%), Postives = 151/366 (41.26%), Query Frame = 1
Query:  142 TISWLKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVKKSSVYFNFNN---------------------------IGDIDPYSQKTSPS-------LNVQHPKNRVDSVPKI-QFTIETIKNSNNEDQLSQEIGNFFIMYQTHSQQIIDSIIHGSFDEILKYLLSFWKTCPEHFKHLFEKSLLI--DGVITI-------------------------DLQVYVAVYRFVLHSMDHSLPDQYLKEFVHFLNNYSIILSNSIPAINKLLREKKIFYALMFKQMCFSWLRGSHLYKIIFPVLSHTDLISEILEEFQGICIENIIDDTVHIVQ 1053
            T+ WL +NY   +GVSL R TLY +Y   C+      ++ A+FGK+IR  F  + TRRLGTRGNSKYHY+G+ VK  S                                   GD  P S + +P+          QH +  +D+   + +F    +     ED   ++I     +Y+ H + I+D +++  F  I K   +FW+  P    +  E + +I   GV  I                         D  +Y A+   ++  +   +P    +   +F  +    L+N++ AI + + + K+     F Q    +   +HL +    VL +T  I+++L +   +   N+ +    + Q
Sbjct:  156 TLQWLLDNYETADGVSLPRSTLYSHYLRHCQEQKLDPVNAASFGKLIRSIFMGLRTRRLGTRGNSKYHYYGIRVKPDSPLNRLQEDMQYMALRQQPVQQKQRYKPVQKMDGFSGDNYPSSGQHTPNAAEQTVIAQSQHHQQFLDASRALPEFVELDLGEHGVEDVSMEDIKALQTLYREHCEAILDVVVNLQFSLIEKLWQTFWRYSP---SNTIEGATIIQNSGVSEIEGRLPRARLLLLCRSEAVLKWMSACDHLMYQALVEILIPDVLRPIPSALTQAIRNFAKSLEGWLTNAMSAIPQKMIQTKVSTVSAFAQTLRRYTSLNHLAQAARAVLQNTSQINQMLSDLNRVDFVNVQEQASWVCQ 518          
BLAST of Transcription factor RFX4 vs. Ensembl Cavefish
Match: rfx1b (regulatory factor X, 1b (influences HLA class II expression) [Source:ZFIN;Acc:ZDB-GENE-041008-101])

HSP 1 Score: 87.0409 bits (214), Expect = 1.381e-17
Identity = 42/78 (53.85%), Postives = 53/78 (67.95%), Query Frame = 1
Query:  142 TISWLKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVKKSS 375
            T+ WL +NY   EGVSL R TLY +Y   C+      ++ A+FGK+IR  F  + TRRLGTRGNSKYHY+GL +K SS
Sbjct:  294 TVQWLCDNYETAEGVSLPRCTLYCHYLLHCQEAKLDPVNAASFGKLIRSVFLGLRTRRLGTRGNSKYHYYGLRIKSSS 371          
BLAST of Transcription factor RFX4 vs. Ensembl Sea Lamprey
Match: rfx2 (regulatory factor X, 2 (influences HLA class II expression) [Source:NCBI gene;Acc:503590])

HSP 1 Score: 90.8929 bits (224), Expect = 1.304e-19
Identity = 79/338 (23.37%), Postives = 139/338 (41.12%), Query Frame = 1
Query:  133 LHRTISWLKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVKKSSVYFNFNNIGDIDPYSQ-KTSPSLNVQH--PKNRVDSVPKIQ-----------FTIETIKNSNNEDQLS---------------------QEIGNFFIMYQTHSQQIIDSIIHGSFDEILKYLLSFWKTCP----------EHFKHLFEKSLLIDGVITI-------------DLQVYVAVYRFVLHSMDHSLPDQYLKEFVHFLNNYSIILSNSIPAINKLLREKKIFYALMFKQMCFSWLRGSHLYKIIFPVLSHT 972
            L+  + WL +NY   EGVSL R TLY +Y   C+      ++ A+FGK+IR  F  + TRRLGTRGNSKYHY+G+ +K SS     N + D   ++  +  P +  Q   P  + D V + Q              +T ++    D                        + +     +Y+ H + I+D +++  F  I     +FW+  P          +H ++ +EK L    + T+             D  +Y A+   ++  +   +P    +   +F  +    L+ ++  + + +   K+     F Q    +   +HL +    VL +T
Sbjct:  182 LNHHVQWLIDNYETAEGVSLPRCTLYNHYLRHCQEQKLDPVNAASFGKLIRSVFLGLRTRRLGTRGNSKYHYYGIRIKASS---PLNRMQDDHQHAALRQQPLIQKQRFKPTAKADGVGEAQGVGPHGSAEQALVAQTQQHQQFLDASRALPAFAEVEWGDITFPPGVSIEHVRTLQTLYREHCEAILDIVVNLQFGLIETIWQTFWRYSPPDDDDTSMDVQHRENGYEKRLPKGALATLCRWEPVMKWMRSCDYLLYQALVEVLIPDVLRPIPSALTQAIRNFAKSLEGWLATALSGLPQEVIHAKVAAVSAFAQTLRRYTSLNHLAQAARAVLQNT 516          
BLAST of Transcription factor RFX4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005569.1 (pep scaffold:Pmarinus_7.0:GL484170:9855:13247:-1 gene:ENSPMAG00000005066.1 transcript:ENSPMAT00000005569.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.077 bits (144), Expect = 7.474e-11
Identity = 30/86 (34.88%), Postives = 49/86 (56.98%), Query Frame = 1
Query:  115 STKRDSLHRTISWLKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYH--YHGLAVK 366
            +  R    +  SW++++       SL ++ +Y+ Y+ +C +  +  +S A FGK+++  FP +  RRLGTRGNSKY   Y GL  K
Sbjct:    7 TANRTDQMQAFSWIRQHLEEHNDTSLPKQEVYDEYKGYCENLGHRFLSAADFGKLMKNVFPNMKARRLGTRGNSKYPCCYSGLRKK 92          
BLAST of Transcription factor RFX4 vs. Ensembl Yeast
Match: RFX1 (Major transcriptional repressor of DNA-damage-regulated genes; recruits repressors Tup1p and Cyc8p to their promoters; involved in DNA damage and replication checkpoint pathway; similar to a family of mammalian DNA binding RFX1-4 proteins [Source:SGD;Acc:S000004166])

HSP 1 Score: 67.0106 bits (162), Expect = 3.368e-12
Identity = 35/85 (41.18%), Postives = 46/85 (54.12%), Query Frame = 1
Query:  151 WLKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAV---KKSSVYFNFNN 396
            WL +N        + R  ++  Y S C  +    +S A+ GK+IR  FP +TTRRLG RG SKYHY GL +   +  SV  N NN
Sbjct:  288 WLMKNCKSQHDSYVPRGKIFAQYASSCSQNNLKPLSQASLGKLIRTVFPDLTTRRLGMRGQSKYHYCGLKLTVNESGSVSLNNNN 372          
BLAST of Transcription factor RFX4 vs. Ensembl Nematostella
Match: EDO39490 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9V5])

HSP 1 Score: 160.999 bits (406), Expect = 1.960e-44
Identity = 118/405 (29.14%), Postives = 195/405 (48.15%), Query Frame = 1
Query:  154 LKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVKKSSVYFNFNNIGDIDPYSQKTSPSLNVQHPKNRVDSVPKIQFTIETIKNSN------NEDQLS-------QEIGNFFIMYQTHSQQIIDSIIHGSFDEILKYLLSFWKTCPEHFKHLFEKSLLIDGVITIDLQVYVAVYRFVLHSMDHSLPDQYLKEFVHFLNNYSIILSNSIPAINKLLREKKIFYALMFKQMCFSWLRGSHLYKIIFPVLSHTDLISEILEEFQGICIENIIDDTVHIVQSSAIPQMPQLIYEHXXXXXXXXXXXXXXXXXXKWV-----KDIFHSSWENMGISF---KTCFLT-WTIFFSKFLQEMFLSLSKCFGQVNLVF 1302
            + ENY   EG+ L R  +Y +Y  FC+ +  +    ATFGKIIRQ+FP++TTRRLGTRG SKYHY+G+ V +SS YF+         YS++     +   PKN  +   K +F++   K         N  +L        Q++  F +MY+TH Q+I+D++I  +FD +  ++  FW+  P H K + + S+L+D +   D  +Y  +   ++ S    LPD   +E   F  N    L+ S+  +   +   K+  A  F       +   HL +    VL   D +S ++++ + I  + I+     I  +    + P+ I  + + FENLL      +   +W+     + I     EN G  F      FL  W++F +K L+++ L  +  FG+    F
Sbjct:    1 MGENYELKEGMCLPRCVMYTHYLDFCKKNKLNPAGPATFGKIIRQKFPKLTTRRLGTRGQSKYHYYGIQVSESSPYFHSG-------YSKQGLTRFSTMKPKNEGEIATKSKFSLGGSKTRTLLPEFPNAQKLDLPKGVSLQKVETFIMMYRTHCQRILDTVISANFDGVQSFVCHFWQGMPIHMKSVLQCSVLVDVIAICDSILYKVLIDVLIPSSIQDLPDSLREEIREFAVNLLEWLNESLTDVPSTVHAAKVKVARTFGNALTRQVSFVHLAQTARSVLLSYDSVSRMMDDLRKIDWKGIMSQITFITGNM---EFPEKIKTYIQEFENLLTKQAPLEAYTEWLDSTVDRCILKPCKEN-GAKFDEKSAKFLGLWSLFTTKLLEDLTLRSAPSFGKEARTF 394          
BLAST of Transcription factor RFX4 vs. Ensembl Nematostella
Match: EDO35375 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLM7])

HSP 1 Score: 152.525 bits (384), Expect = 3.880e-41
Identity = 111/404 (27.48%), Postives = 192/404 (47.52%), Query Frame = 1
Query:  154 LKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVKKSSVYFNF--------NNIGDIDPYSQKTSPSLNVQHPKNRVDSVPKIQFTIETIKNSNNEDQLSQE-IGNFFIMYQTHSQQIIDSIIHGSFDEILKYLLSFWKTCPEHFKHLFEKSLLIDGVITIDLQVYVAVYRFVLHSMDHSLPDQYLKEFVHFLNNYSIILSNSIPAINKLLREKKIFYALMFKQMCFSWLRGSHLYKIIFPVLSHTDLISEILEEFQGICIENIIDDTVHIVQSSAIPQMPQLIYEHXXXXXXXXXXXXXXXXXXKWVKDIFH----SSWENMGISFKTC----FLTWTIFFSKFLQEMFLSLSKCFGQVNLVFLWLE 1314
            L ENY   +GVSL R  LY +Y  FC  +  S ++ A+FGKIIR  FP + TRRLGTRG SKYHY+G+ +K +S Y +         ++   +   +Q +S SL V      + S P       ++ + N   ++S++ +  F IMY+ H Q+I+D+I+  +F E+  +L+ FW+  P H   +   S ++D +   D  +Y A+   ++      LP    +   HF       L  S+  +   L+++K+  A  F          +HL +    VL   + ++++L++++ I  E I    +    S  + +    I E    F  LL+   + D+  +W   +         E  G S++ C     L W+ F  + ++E+ L  +  FG  +L+ + LE
Sbjct:    1 LNENYEVADGVSLPRSALYSHYLDFCEKNSLSPVNAASFGKIIRHTFPNLKTRRLGTRGQSKYHYYGITIKTTSPYHDTVCNAARQSSSGHSVTKSAQGSSSSLIVAPGGTLLPSFP-------SVNHLNLPAEVSRDKVKTFLIMYRAHCQRILDTILRANFGEVQNFLVHFWQGMPSHMLEVLGCSDVVDLIGVCDGILYKAISGVLIPGTLQPLPASLTQAIRHFAKQLGRWLEESLAHLPAPLQQRKLSVAKSFAHSLRRQTSLTHLAQAARTVLHSAEPVTQMLQDWKQIDFEGIARQAMWTF-SQNVEKDYAKIKEIHTEFTQLLDQQATIDQYAEWASSLVDRCVTKRVEKEGSSYQKCAQDFLLKWSFFSIRIVRELTLHSAHSFGSFHLLHMLLE 396          
BLAST of Transcription factor RFX4 vs. Ensembl Nematostella
Match: EDO47852 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL05])

HSP 1 Score: 149.058 bits (375), Expect = 7.192e-40
Identity = 113/405 (27.90%), Postives = 190/405 (46.91%), Query Frame = 1
Query:  154 LKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVKKSSVYFNFNNIGDIDPYSQKTSPSLNVQHPKNRVDSVPKIQFTIETIKNSNNED-----------QLSQE-IGNFFIMYQTHSQQIIDSIIHGSFDEILKYLLSFWKTCPEHFKHLFEKSLLIDGVITIDLQVYVAVYRFVLHSMDHSLPDQYLKEFVHFLNNYSIILSNSIPAINKLLREKKIFYALMFKQMCFSWLRGSHLYKIIFPVLSHTDLISEILEEFQGICIENIIDDTVHIVQSSAIPQMPQLIYEHXXXXXXXXXXXXXXXXXXKWV--------KDIFHSSWENMGISFKTC----FLTWTIFFSKFLQEMFLSLSKCFGQVNL 1296
            + ENY   EGV L R  LY +Y  FCR H       ATFGK IRQ+FPQ+TTRRLGTRG+SKYHY+G+ +K+SS Y++         YS K     +    KN  +   + ++++ +   +   D            +SQE +  F IMY+TH Q I+D+ I+ +FDEI  +LL FW+  P+H   L +  ++ D V   D  +Y  +   +L S    +P+  L +   F  +  + ++++   + + ++  K+     F Q         HL +   PVL+  +L+ +++ +   +   +    T++    +   +      EH    E   EL  +   +  +V        + +  S  E+ G+ FK       L W+   ++ +  + L+ S CFG   L
Sbjct:    1 MDENYVMCEGVCLPRCILYAHYLDFCRRHKIEAACAATFGKTIRQKFPQLTTRRLGTRGHSKYHYYGIGIKESSAYYH-------SVYSGKGLTRFSGSKAKNEGNFAAR-KYSLSSKTGTLLPDFPNPQLLELPQGISQEKVETFVIMYKTHCQCILDTAINANFDEIKNFLLHFWQGLPDHLLPLMDTEVVSDVVCVCDSILYKVLMDVLLPSSMQDVPEGLLADIRSFARHLEVWVASATEELPEYVKLAKLQIVRRFAQSIRRQTSFLHLAQTARPVLNSAELLEQMICDLDKVDNSSAGSQTLYDKTENETDEGLDRECEHVVFMEEFRELLANQSCVESYVEWLDKTVEQKVIQSCVES-GLEFKNRAQEFLLRWSFLGARLMHSLTLNASSCFGMSAL 396          
BLAST of Transcription factor RFX4 vs. Ensembl Nematostella
Match: EDO43982 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RX75])

HSP 1 Score: 121.709 bits (304), Expect = 1.053e-29
Identity = 109/468 (23.29%), Postives = 198/468 (42.31%), Query Frame = 1
Query:  145 ISWLKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVKKSSVYFNFNNIGDIDPYSQKTSPSLNVQ-HPKNRVDSVPKIQ-FTIETIKNSNN----------------------------------EDQLSQEIGNFFIMYQTHSQQIIDSIIHGSFDEILKYLLSFWK-------------TCPEHFKHLF-----EKSL-------------LIDGVITIDLQVYVAVYRFVLHSMDHSLPDQYLKEFVHFLNNYSIILSNSIPAINKLLREKKIFYALMFKQMCFSWLRGSHLYKIIFPVLSHTDLISEILEEFQGICIENIIDDTVHIVQSSAIPQMPQLIYEHXXXXXXXXXXXXXXXXXXKWVKDIF------HSSWENMGISFKTCFLTWTIFFSKFLQEMFLSLSKCFGQVNLV-FLWLEHLFY 1326
            + WL ENY   EGVSL R TLY +Y + C++H    ++ A+FGK+IR  F  + TRRLGTRGNSKYHY+G+ +K SS     N + D    + + SPS   +  P +RVD V  +  +  +   N ++                                  E  L +++  F  MY+ H +  +D +++  F  +     SFW+             T     K L      EK L             ++  V + D  +Y  +   ++  +   +P    +   +F       L+ S+ ++ K + + K+     F Q    +   +HL +    VL +T  I+++L +   +   N+ +    + Q         ++Y   ++F+  L+   S ++   W++ +       H   EN   + +   L W+ + S  ++++ L  +  FG  +L+  L+ E++FY
Sbjct:    1 MQWLLENYETAEGVSLPRSTLYNHYLTHCQTHKLDPVNAASFGKLIRSVFLGLRTRRLGTRGNSKYHYYGIRIKPSS---PLNALTDDAQVALRQSPSTQKRLKPASRVDGVEGVDGYPSQGGTNVDSAQQSQHQQHQQYLGDITQGLPDFEDLDPKGTPLPEGVLEEDLDTFQDMYREHCEAFLDVVVNLQFALVESLWQSFWRHPSTTDVKREEPSTPTSGIKELGDDEDNEKRLPKVKLAILCEYEPVVAYVKSCDHLLYQTLVEVLIPDVLRPIPSSLTQAIRNFAKGLEGWLAGSLSSVPKKMADVKVSSCCAFAQTLRRYTSLNHLAQAARAVLQNTSQITQMLNDLNRVDFANVQEQAAWVCQCDD-----HMVYRFEQDFKLTLQQQNSLEQWATWLEGVVDQFLKPHEGSENYPKAARQFLLKWSFYSSMIIRDLTLRSAASFGSFHLIRLLYDEYMFY 460          
BLAST of Transcription factor RFX4 vs. Ensembl Nematostella
Match: EDO41435 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S491])

HSP 1 Score: 64.3142 bits (155), Expect = 7.893e-12
Identity = 35/90 (38.89%), Postives = 52/90 (57.78%), Query Frame = 1
Query:  115 STKRDSLHRTISWLKENYCFVEGV----SLSRKTLYENYQSFCRSHVYSQ-ISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVKK 369
            ST R    +   W++   C +E      +L +  +Y+ Y+++C S   S+ +S   FGKII+  FP++  RRLGTRGNSKY Y G+  KK
Sbjct:   39 STTRAEQTQAFHWIR---CHLEECDNSSTLPKHEVYDEYKAYCESMSASRTLSAPDFGKIIKCVFPRVKARRLGTRGNSKYCYSGIQRKK 125          
BLAST of Transcription factor RFX4 vs. Ensembl Medaka
Match: rfx4 (regulatory factor X4 [Source:NCBI gene;Acc:101165053])

HSP 1 Score: 171.785 bits (434), Expect = 8.689e-46
Identity = 120/421 (28.50%), Postives = 216/421 (51.31%), Query Frame = 1
Query:  106 DGESTKRDSLHRTISWLKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVKKSSVYFNFNNIGDIDPYSQKTSPSLN----VQHPKNRVDSVPKIQFTI-----ETIKNSNNEDQLSQE-IGNFFIMYQTHSQQIIDSIIHGSFDEILKYLLSFWKTCPEHFKHLFEKSLLIDGVITIDLQVYVAVYRFVLHSMDHSLPD---QYLKEFVHFLNNYSIILSNSIPAINKLLREKKIFYALMFKQMCFSWLRGSHLYKIIFPVLSHTDLISEILEEFQGICIENIIDDTVHIVQSSAIPQMPQLIYEHXXXXXXXXXXXXXXXXXXKWVKDIFHSSWENMGISFKTC--------FLTWTIFFSKFLQEMFLSLSKCFGQVNLVFL 1305
            +  ++K  S   T+ WL+ENY   EGV + R  LY +Y  F   H    ++ A+FGKIIRQQFP +TTRRLGTRG SKYHY+G+AVK+SS Y++         YS+K +  +N     +  K  V   P+ +          +K+ N    L +E +  F +MY+TH Q+I+D++I  +FDE+  +LL FW+  P H   +     +++ V   D  +Y A+   ++ ++  +LPD   Q +++F   L+ +  I  + +P   + LR  K   +  F Q+       +HL +    V++  D+  ++LE+++ + + +I   T++ ++ S   +  ++I + ++ F+ LLE     +  ++W+  +       +      C         L W+ F ++ +++M L  +  FG  +L+ L
Sbjct:   49 NNRASKPHSTPATLEWLEENYEIAEGVCIPRSALYMHYLDFSEKHDTQPVNAASFGKIIRQQFPALTTRRLGTRGQSKYHYYGIAVKESSPYYDVM-------YSKKGAAWVNETGKKEVTKQTVAYSPRSKLGTLLPEFPNVKDLNLPASLPEERVSTFIMMYRTHCQRILDTVIRANFDEVQSFLLHFWQGMPPHMLPVLGSPTVVNIVGVCDSILYKAISGVLMPTVLQALPDSLTQVIRKFAKQLDEWLKIALHDLP---ENLRNIKFELSRRFSQILKRQTSLNHLCQASRTVINSADITFQMLEDWRNVDLNSITKQTLYTMEDSQ-EEHRRIIIQLYQEFDRLLEEQSPIEAYIEWLDSMVDRCVVKVAGKRPGCLKKVAQQFLLMWSCFGTRVIRDMTLHSAPSFGSFHLIHL 458          
BLAST of Transcription factor RFX4 vs. Ensembl Medaka
Match: rfx3 (regulatory factor X3 [Source:NCBI gene;Acc:101163751])

HSP 1 Score: 115.931 bits (289), Expect = 6.186e-27
Identity = 97/387 (25.06%), Postives = 168/387 (43.41%), Query Frame = 1
Query:   73 IGYQIPKMTDADGESTKRDSLHRT-ISWLKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVKK----------------------------------SSVYFNFNNIGDIDPYSQKTSPSLNVQHPKNRVDSVPKIQFTIE-TIKNSNNEDQLSQEIGNFFIMYQTHSQQIIDSIIHGSFDEILKYLLSFWKTCP----------------EHFKHLFEKSLLI----DGVI----TIDLQVYVAVYRFVLHSMDHSLPDQYLKEFVHFLNNYSIILSNSIPAINKLLREKKIFYALMFKQMCFSWLRGSHLYKIIFPVLSHTDLISEILEEFQGICIENIIDDTVHIVQ 1053
            I   I  +  ++G S++R SL  + + WL +NY   EGVSL R TLY +Y   C+      ++ A+FGK+IR  F  + TRRLGTRGNSKYHY+G+ VK                                   SS   N++  G   P + + +     QH +  +D+   +   +E  +  SN E+  S+++     +Y+ H + I+D +++  F  I K   +FW+  P                E    L    LL+    + V+    T D  +Y A+   ++  +   +P    +   +F  +    L+N++ AI + + + KI     F Q    +   +HL +    VL +T  I+++L +   +   N+ +    + Q
Sbjct:  150 IEMAIETLQKSEGLSSQRSSLLNSHLQWLLDNYETAEGVSLPRSTLYNHYLRHCQEQKLDPVNAASFGKLIRSIFMGLRTRRLGTRGNSKYHYYGIRVKPDSPLNRLQEDMQYMALKQQPVQQKQRFKPVQKFDSSSGENYSGGGQHHPGAAEQTVIAQSQHHQQFIDASRALPDFVELDLGQSNTENISSEDVKALQSLYREHCEAILDVVVNLQFSLIEKLWETFWRYSPPETVEGATVTENSSISEIEARLPRARLLVLCRNEAVLKWMSTCDHLMYQALVEILIPDVLRPIPSALTQAIRNFAKSLEGWLNNAMNAIPQRMIQTKIAAVSAFAQTLRRYTSLNHLAQAARAVLQNTSQINQMLSDLNRVDFANVQEQASWVCQ 536          
BLAST of Transcription factor RFX4 vs. Ensembl Medaka
Match: rfx3 (regulatory factor X3 [Source:NCBI gene;Acc:101163751])

HSP 1 Score: 112.849 bits (281), Expect = 6.479e-26
Identity = 91/363 (25.07%), Postives = 156/363 (42.98%), Query Frame = 1
Query:  142 TISWLKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVKK----------------------------------SSVYFNFNNIGDIDPYSQKTSPSLNVQHPKNRVDSVPKIQFTIE-TIKNSNNEDQLSQEIGNFFIMYQTHSQQIIDSIIHGSFDEILKYLLSFWKTCP----------------EHFKHLFEKSLLI----DGVI----TIDLQVYVAVYRFVLHSMDHSLPDQYLKEFVHFLNNYSIILSNSIPAINKLLREKKIFYALMFKQMCFSWLRGSHLYKIIFPVLSHTDLISEILEEFQGICIENIIDDTVHIVQ 1053
            T+ WL +NY   EGVSL R TLY +Y   C+      ++ A+FGK+IR  F  + TRRLGTRGNSKYHY+G+ VK                                   SS   N++  G   P + + +     QH +  +D+   +   +E  +  SN E+  S+++     +Y+ H + I+D +++  F  I K   +FW+  P                E    L    LL+    + V+    T D  +Y A+   ++  +   +P    +   +F  +    L+N++ AI + + + KI     F Q    +   +HL +    VL +T  I+++L +   +   N+ +    + Q
Sbjct:  149 TLQWLLDNYETAEGVSLPRSTLYNHYLRHCQEQKLDPVNAASFGKLIRSIFMGLRTRRLGTRGNSKYHYYGIRVKPDSPLNRLQEDMQYMALKQQPVQQKQRFKPVQKFDSSSGENYSGGGQHHPGAAEQTVIAQSQHHQQFIDASRALPDFVELDLGQSNTENISSEDVKALQSLYREHCEAILDVVVNLQFSLIEKLWETFWRYSPPETVEGATVTENSSISEIEARLPRARLLVLCRNEAVLKWMSTCDHLMYQALVEILIPDVLRPIPSALTQAIRNFAKSLEGWLNNAMNAIPQRMIQTKIAAVSAFAQTLRRYTSLNHLAQAARAVLQNTSQINQMLSDLNRVDFANVQEQASWVCQ 511          
BLAST of Transcription factor RFX4 vs. Ensembl Medaka
Match: rfx6 (regulatory factor X6 [Source:NCBI gene;Acc:101170242])

HSP 1 Score: 110.923 bits (276), Expect = 3.336e-25
Identity = 84/307 (27.36%), Postives = 136/307 (44.30%), Query Frame = 1
Query:  121 KRDSLHRTISWLKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVKKSSVYFNFNNIGDIDPYSQKTSPSLNVQHPKNRVDSVPKIQFTIETIKNSNN---EDQLSQEIGNFFIMYQTHSQQIIDSIIHG--SFDEILKYLLSFWKT---------CPE------------HFKHLFEKSLLIDGVITIDLQVYVAVYRFVLHSMDHSLPDQYLKEFVHFLNNYSIILSNSIPAINKLLREKKIFYALMFKQMCFSWLRGSHLYKIIFPVL 963
            K+  +  T+ WL+ENY   EGV L R  LY +Y  FCR         ATFGK IRQ+FP +TTRRLGTRG+SKYHY+G+ +K+SS Y++         YS K                    +F+   +KN      +  LS + G     +  ++Q +   ++HG  S +++ + L +F  T         CP             H   L +  ++++     D  +Y  +   ++ +    +P+  L +   F  ++   L++S+  + + L  KK+  A  F           HL +I  P L
Sbjct:   34 KKKQMQLTLQWLEENYMVCEGVCLPRCILYAHYLDFCRKERLEPACAATFGKTIRQKFPLLTTRRLGTRGHSKYHYYGIGIKESSAYYHAV-------YSGKG-----------------LTRFSGSKLKNEGGFTRKYSLSSKTGTLLPDF-PNAQHL---VLHGNISREKVGRRLAAFSTTFCCSLKRPVCPSGGHSMEVHGMPNHLLPLLQTPVIVNVFCVCDSILYKVLTDVLIPATMQEMPESLLADIRSFAKHWEHWLASSLENLPECLAAKKLPIARCFVSSLKRQTSFLHLAQIARPAL 312          
BLAST of Transcription factor RFX4 vs. Ensembl Medaka
Match: rfx1a (MHC class II regulatory factor RFX1 [Source:NCBI gene;Acc:101166798])

HSP 1 Score: 92.4337 bits (228), Expect = 2.683e-19
Identity = 44/90 (48.89%), Postives = 57/90 (63.33%), Query Frame = 1
Query:  106 DGESTKRDSLHRTISWLKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVKKSS 375
            +GE T   S  + + WL +NY   EGVSL R TLY +Y   C+      ++ A+FGK+IR  F  + TRRLGTRGNSKYHY+GL +K  S
Sbjct:  329 EGEETSVPSADKKVQWLLDNYETAEGVSLPRSTLYCHYLLHCQEQKLEPVNAASFGKLIRSVFMGLRTRRLGTRGNSKYHYYGLRIKAGS 418          
BLAST of Transcription factor RFX4 vs. Planmine SMEST
Match: SMESG000058756.1 (SMESG000058756.1)

HSP 1 Score: 971.074 bits (2509), Expect = 0.000e+0
Identity = 490/495 (98.99%), Postives = 494/495 (99.80%), Query Frame = 1
Query:   94 MTDADGESTKRDSLHRTISWLKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVKKSSVYFNFNNIGDIDPYSQKTSPSLNVQHPKNRVDSVPKIQFTIETIKNSNNEDQLSQEIGNFFIMYQTHSQQIIDSIIHGSFDEILKYLLSFWKTCPEHFKHLFEKSLLIDGVITIDLQVYVAVYRFVLHSMDHSLPDQYLKEFVHFLNNYSIILSNSIPAINKLLREKKIFYALMFKQMCFSWLRGSHLYKIIFPVLSHTDLISEILEEFQGICIENIIDDTVHIVQSSAIPQMPQLIYEHXXXXXXXXXXXXXXXXXXKWVKDIFHSSWENMGISFKTCFLTWTIFFSKFLQEMFLSLSKCFGQVNLVFLWLEHLFYTESMIQEFEHLIQTLNRIIYSETSLNYSQCIQLNSTSPHPLPCKTEIELHNNNGQSNESMFEPMEYDESRYNREIVSDCDILFM 1578
            MTDADGESTKRDSLHRTISWLKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVKKSSVYFNFNNIGDIDPYSQKTSPSLNVQHPKNRVDSVPKIQFTIETIKNSNNEDQLSQEIGNFFIMYQTHSQQIIDSIIHGSFDEILKYLLSFWKTCPEHFKHLFE+SLLIDGVITIDLQVY+AVYRFVLHSMDHSLPDQYLKEFVHFLNNYSIILSNSIPAINKLLREKKIFYALMFKQMCFSWLRGSHLYKIIFPVLSHTDLISEILEEFQGICIENIIDDTVHIVQSSAIPQMPQLIYEHFENFENLLELDFSFDELLKWVKDIFHSSWENMGISFKTCFLTWTIFFSKFLQEMFLSLSKCFGQVNLVFLWLEHLFYTESMIQEFEH+IQTLNRIIYSETSLNYSQCIQLNSTS HPLPCKTEIELHNNNGQSNESMFEPMEYDESRYNRE+VSDCDILFM
Sbjct:    1 MTDADGESTKRDSLHRTISWLKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVKKSSVYFNFNNIGDIDPYSQKTSPSLNVQHPKNRVDSVPKIQFTIETIKNSNNEDQLSQEIGNFFIMYQTHSQQIIDSIIHGSFDEILKYLLSFWKTCPEHFKHLFEESLLIDGVITIDLQVYIAVYRFVLHSMDHSLPDQYLKEFVHFLNNYSIILSNSIPAINKLLREKKIFYALMFKQMCFSWLRGSHLYKIIFPVLSHTDLISEILEEFQGICIENIIDDTVHIVQSSAIPQMPQLIYEHFENFENLLELDFSFDELLKWVKDIFHSSWENMGISFKTCFLTWTIFFSKFLQEMFLSLSKCFGQVNLVFLWLEHLFYTESMIQEFEHIIQTLNRIIYSETSLNYSQCIQLNSTSLHPLPCKTEIELHNNNGQSNESMFEPMEYDESRYNREVVSDCDILFM 495          
BLAST of Transcription factor RFX4 vs. Planmine SMEST
Match: SMESG000017202.1 (SMESG000017202.1)

HSP 1 Score: 88.1965 bits (217), Expect = 5.299e-18
Identity = 44/103 (42.72%), Postives = 64/103 (62.14%), Query Frame = 1
Query:  142 TISWLKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVKKSSVYFNFNNIGDIDPYSQKTSPSLNVQ 450
            T+ WL +NY   +GVSL R TLY +Y   C+      ++ A+FGK+IR  F  + TRRLGTRGNSKYHY+G+ +K +SV    N+  +   ++ +  PS + Q
Sbjct:  193 TMQWLYDNYETADGVSLPRSTLYNHYLQHCQQEKLEPMNQASFGKLIRSVFFGLRTRRLGTRGNSKYHYYGIRIKPNSV---LNHYVEDQTFAMRQYPSFHRQ 292          
BLAST of Transcription factor RFX4 vs. Planmine SMEST
Match: SMESG000021065.1 (SMESG000021065.1)

HSP 1 Score: 67.781 bits (164), Expect = 1.152e-11
Identity = 32/86 (37.21%), Postives = 53/86 (61.63%), Query Frame = 1
Query:  145 ISWLKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVKKSSVYFNFNNIG 402
            +S L+EN    +   L ++ +YE+Y+S+C ++    +STA FGK++++ FP I  RRLG RG S+Y Y GL  ++ +      +IG
Sbjct:  157 LSHLEEN----KTTCLQKQEVYEDYKSYCMTYNIKCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGLRNRQETQSPALKDIG 238          
The following BLAST results are available for this feature:
BLAST of Transcription factor RFX4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RFX43.658e-4628.21regulatory factor X4 [Source:HGNC Symbol;Acc:HGNC:... [more]
RFX44.721e-4628.21regulatory factor X4 [Source:HGNC Symbol;Acc:HGNC:... [more]
RFX41.993e-4235.51regulatory factor X4 [Source:HGNC Symbol;Acc:HGNC:... [more]
RFX66.329e-3927.17regulatory factor X6 [Source:HGNC Symbol;Acc:HGNC:... [more]
RFX47.478e-3440.78regulatory factor X4 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Transcription factor RFX4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
daf-191.128e-1752.56RFX-like transcription factor daf-19 [Source:UniP... [more]
daf-191.138e-1752.56RFX-like transcription factor daf-19 [Source:UniP... [more]
daf-191.167e-1752.56RFX-like transcription factor daf-19 [Source:UniP... [more]
daf-191.492e-1751.90RFX-like transcription factor daf-19 [Source:UniP... [more]
daf-191.498e-1751.90RFX-like transcription factor daf-19 [Source:UniP... [more]
back to top
BLAST of Transcription factor RFX4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rfx2.999e-2523.08gene:FBgn0020379 transcript:FBtr0337103[more]
Rfx3.711e-2523.08gene:FBgn0020379 transcript:FBtr0337104[more]
Rfx2.644e-1951.90gene:FBgn0020379 transcript:FBtr0337107[more]
Rfx2.700e-1951.90gene:FBgn0020379 transcript:FBtr0337106[more]
Rfx2.879e-1951.90gene:FBgn0020379 transcript:FBtr0337105[more]
back to top
BLAST of Transcription factor RFX4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rfx41.672e-4629.20regulatory factor X, 4 [Source:NCBI gene;Acc:40301... [more]
rfx41.722e-4629.20regulatory factor X, 4 [Source:NCBI gene;Acc:40301... [more]
rfx64.607e-3930.45regulatory factor X, 6 [Source:NCBI gene;Acc:55692... [more]
rfx67.083e-3930.24regulatory factor X, 6 [Source:NCBI gene;Acc:55692... [more]
rfx34.599e-2223.06regulatory factor X, 3 (influences HLA class II ex... [more]
back to top
BLAST of Transcription factor RFX4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RFX61.185e-3527.27regulatory factor X6 [Source:NCBI gene;Acc:1004875... [more]
sstr22.768e-3228.04somatostatin receptor 2 [Source:Xenbase;Acc:XB-GEN... [more]
sstr23.296e-3228.04somatostatin receptor 2 [Source:Xenbase;Acc:XB-GEN... [more]
rfx31.674e-2424.15regulatory factor X3 [Source:NCBI gene;Acc:779608][more]
rfx33.145e-2424.36regulatory factor X3 [Source:NCBI gene;Acc:779608][more]
back to top
BLAST of Transcription factor RFX4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rfx43.927e-4629.36regulatory factor X, 4 (influences HLA class II ex... [more]
Rfx62.839e-3830.28regulatory factor X, 6 [Source:MGI Symbol;Acc:MGI:... [more]
Rfx61.907e-2635.90regulatory factor X, 6 [Source:MGI Symbol;Acc:MGI:... [more]
Rfx31.069e-2425.32regulatory factor X, 3 (influences HLA class II ex... [more]
Rfx31.069e-2425.32regulatory factor X, 3 (influences HLA class II ex... [more]
back to top
BLAST of Transcription factor RFX4 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A2BGA0|RFX4_DANRE1.300e-4529.20Transcription factor RFX4 OS=Danio rerio OX=7955 G... [more]
sp|Q33E94|RFX4_HUMAN1.757e-4528.21Transcription factor RFX4 OS=Homo sapiens OX=9606 ... [more]
sp|Q7TNK1|RFX4_MOUSE2.747e-4529.36Transcription factor RFX4 OS=Mus musculus OX=10090... [more]
sp|Q8HWS3|RFX6_HUMAN3.039e-3827.17DNA-binding protein RFX6 OS=Homo sapiens OX=9606 G... [more]
sp|Q5RJA1|RFX6_DANRE3.477e-3830.45DNA-binding protein RFX6 OS=Danio rerio OX=7955 GN... [more]
back to top
BLAST of Transcription factor RFX4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|238578282.761e-4727.98tr|V4B1B6|V4B1B6_LOTGI RFX-type winged-helix domai... [more]
gnl|BL_ORD_ID|239002008.529e-4729.53tr|K1QV89|K1QV89_CRAGI Transcription factor RFX4 O... [more]
gnl|BL_ORD_ID|1749529781.138e-4627.98tr|A0A5A9NZQ5|A0A5A9NZQ5_9TELE Transcription facto... [more]
gnl|BL_ORD_ID|1721408541.231e-4628.36tr|W5LLN7|W5LLN7_ASTMX Regulatory factor X, 4 OS=A... [more]
gnl|BL_ORD_ID|1745384522.036e-4630.25tr|A0A2D0QQJ6|A0A2D0QQJ6_ICTPU transcription facto... [more]
back to top
BLAST of Transcription factor RFX4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rfx44.661e-5028.36regulatory factor X, 4 [Source:NCBI gene;Acc:40301... [more]
rfx61.192e-2426.67regulatory factor X, 6 [Source:NCBI gene;Acc:55692... [more]
rfx38.520e-2323.83regulatory factor X3 [Source:NCBI gene;Acc:1030290... [more]
rfx32.898e-2224.04regulatory factor X3 [Source:NCBI gene;Acc:1030290... [more]
rfx1b1.381e-1753.85regulatory factor X, 1b (influences HLA class II e... [more]
back to top
BLAST of Transcription factor RFX4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rfx21.304e-1923.37regulatory factor X, 2 (influences HLA class II ex... [more]
ENSPMAT00000005569.17.474e-1134.88pep scaffold:Pmarinus_7.0:GL484170:9855:13247:-1 g... [more]
back to top
BLAST of Transcription factor RFX4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
RFX13.368e-1241.18Major transcriptional repressor of DNA-damage-regu... [more]
back to top
BLAST of Transcription factor RFX4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO394901.960e-4429.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO353753.880e-4127.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478527.192e-4027.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO439821.053e-2923.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO414357.893e-1238.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transcription factor RFX4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rfx48.689e-4628.50regulatory factor X4 [Source:NCBI gene;Acc:1011650... [more]
rfx36.186e-2725.06regulatory factor X3 [Source:NCBI gene;Acc:1011637... [more]
rfx36.479e-2625.07regulatory factor X3 [Source:NCBI gene;Acc:1011637... [more]
rfx63.336e-2527.36regulatory factor X6 [Source:NCBI gene;Acc:1011702... [more]
rfx1a2.683e-1948.89MHC class II regulatory factor RFX1 [Source:NCBI g... [more]
back to top
BLAST of Transcription factor RFX4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000058756.10.000e+098.99SMESG000058756.1[more]
SMESG000017202.15.299e-1842.72SMESG000017202.1[more]
SMESG000021065.11.152e-1137.21SMESG000021065.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032163 ID=SMED30032163|Name=Transcription factor RFX4|organism=Schmidtea mediterranea sexual|type=transcript|length=1590bp
TAGACATTTATAAGTAATAAAGATTACAACTAAATTACAAGTGAACGCGC
TCAGTTATACAGCATTCCGCAAATTGGATACCAAATCCCGAAAATGACAG
ATGCTGATGGGGAGTCAACGAAAAGGGATTCATTGCACCGAACGATTTCG
TGGTTGAAAGAAAATTACTGCTTCGTAGAGGGAGTTTCGTTGTCTAGAAA
AACTCTTTATGAGAATTATCAATCGTTTTGCCGATCTCATGTTTATTCTC
AAATTAGTACTGCGACTTTCGGAAAGATCATCCGTCAACAATTTCCACAA
ATTACTACTCGGCGACTGGGAACAAGAGGCAATTCGAAATACCATTATCA
TGGGTTGGCTGTAAAAAAGAGTTCAGTTTATTTCAATTTCAACAACATTG
GAGATATTGACCCCTATTCGCAAAAGACTTCGCCTTCTCTAAACGTTCAA
CATCCAAAAAACCGAGTGGATTCTGTTCCAAAGATTCAGTTTACTATTGA
GACAATAAAAAATTCAAATAACGAAGACCAATTGAGTCAAGAAATTGGAA
ACTTTTTCATCATGTATCAGACTCATTCTCAACAAATAATAGATTCAATT
ATTCATGGATCCTTCGATGAAATTTTAAAATATCTTCTTTCATTTTGGAA
AACTTGCCCGGAACATTTCAAACATTTATTTGAGAAATCTCTGTTAATTG
ATGGGGTTATAACCATTGACTTACAAGTCTACGTAGCCGTTTATAGGTTT
GTGCTCCATTCAATGGATCACTCTCTGCCAGATCAATATTTAAAAGAATT
CGTCCATTTCCTAAATAATTATTCAATAATTCTGTCAAATTCAATTCCTG
CAATAAACAAATTGCTTAGAGAAAAGAAGATATTTTATGCTCTGATGTTC
AAGCAAATGTGTTTTAGTTGGCTCCGTGGATCTCATTTATACAAAATCAT
TTTCCCTGTTCTCAGTCATACTGATCTGATTTCGGAAATTCTTGAAGAGT
TTCAAGGGATTTGTATAGAAAATATCATAGACGACACAGTACACATCGTA
CAAAGTTCTGCAATACCTCAAATGCCGCAGCTCATCTATGAACATTTTGA
GAACTTTGAAAATTTGTTGGAATTGGATTTTTCATTTGATGAACTTTTAA
AATGGGTTAAAGACATTTTTCATTCCAGTTGGGAAAATATGGGAATCAGC
TTCAAAACTTGTTTCTTAACTTGGACAATTTTCTTTTCAAAGTTTTTACA
AGAAATGTTTCTAAGTCTATCTAAATGTTTTGGTCAGGTGAATTTAGTTT
TCCTATGGTTGGAACACTTATTTTACACTGAATCAATGATACAGGAATTT
GAGCATTTAATCCAAACACTTAATCGCATTATTTATTCTGAAACATCATT
AAATTATTCCCAATGTATCCAACTAAATTCGACGTCCCCTCATCCACTCC
CATGTAAAACCGAAATCGAATTACATAATAATAATGGCCAATCAAATGAA
AGTATGTTTGAACCAATGGAATATGACGAATCGAGATATAACAGAGAAAT
TGTCAGTGATTGTGATATTTTGTTCATGTGAAAATACAAT
back to top

protein sequence of SMED30032163-orf-1

>SMED30032163-orf-1 ID=SMED30032163-orf-1|Name=SMED30032163-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=496bp
MTDADGESTKRDSLHRTISWLKENYCFVEGVSLSRKTLYENYQSFCRSHV
YSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVKKSSVYFNFN
NIGDIDPYSQKTSPSLNVQHPKNRVDSVPKIQFTIETIKNSNNEDQLSQE
IGNFFIMYQTHSQQIIDSIIHGSFDEILKYLLSFWKTCPEHFKHLFEKSL
LIDGVITIDLQVYVAVYRFVLHSMDHSLPDQYLKEFVHFLNNYSIILSNS
IPAINKLLREKKIFYALMFKQMCFSWLRGSHLYKIIFPVLSHTDLISEIL
EEFQGICIENIIDDTVHIVQSSAIPQMPQLIYEHFENFENLLELDFSFDE
LLKWVKDIFHSSWENMGISFKTCFLTWTIFFSKFLQEMFLSLSKCFGQVN
LVFLWLEHLFYTESMIQEFEHLIQTLNRIIYSETSLNYSQCIQLNSTSPH
PLPCKTEIELHNNNGQSNESMFEPMEYDESRYNREIVSDCDILFM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
Vocabulary: INTERPRO
TermDefinition
IPR036388WH-like_DNA-bd_sf
IPR039779RFX-like
IPR036390WH_DNA-bd_sf
IPR011991WHTH_DNA-bd_dom
IPR003150DNA-bd_RFX
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0000978RNA polymerase II core promoter proximal region sequence-specific DNA binding
GO:0001077transcriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding
GO:0003682chromatin binding
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0006351transcription, DNA-templated
GO:0006357regulation of transcription from RNA polymerase II promoter
GO:0006366transcription from RNA polymerase II promoter
GO:0021516dorsal spinal cord development
GO:0021537telencephalon development
GO:0021696cerebellar cortex morphogenesis
GO:0021914negative regulation of smoothened signaling pathway involved in ventral spinal cord patterning
GO:0030900forebrain development
GO:0030901midbrain development
GO:0045944positive regulation of transcription from RNA polymerase II promoter
GO:0060271cilium morphogenesis
GO:0070613regulation of protein processing
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR036388Winged helix-like DNA-binding domain superfamilyGENE3DG3DSA:1.10.10.10coord: 17..92
e-value: 2.2E-30
score: 107.0
IPR003150DNA-binding RFX-type winged-helix domainPFAMPF02257RFX_DNA_bindingcoord: 17..91
e-value: 2.2E-28
score: 98.7
IPR003150DNA-binding RFX-type winged-helix domainPROSITEPS51526RFX_DBDcoord: 17..92
score: 16.629
IPR039779RFX-like DNA-binding proteinPANTHERPTHR12619RFX TRANSCRIPTION FACTOR FAMILYcoord: 15..413
IPR036390Winged helix DNA-binding domain superfamilySUPERFAMILYSSF46785"Winged helix" DNA-binding domaincoord: 18..91