Calponin-homology (CH) domain-containing protein

Overview
NameCalponin-homology (CH) domain-containing protein
Smed IDSMED30032160
Length (bp)362
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Calponin-homology (CH) domain-containing protein (SMED30032160) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Calponin-homology (CH) domain-containing protein (SMED30032160) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032160

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 25

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30032160h1SMcG0020690 Contig6890newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032160h1SMcG0020690 Contig6890uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
cephalic gangliaSMED30032160h1SMcG0020690 dd_Smed_v4_5496_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30032160h1SMcG0020690 dd_Smed_v4_5496_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30032160h1SMcG0020690 dd_Smed_v4_5496_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30032160h1SMcG0020690 dd_Smed_v4_1745_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30032160h1SMcG0020690 dd_Smed_v4_1745_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30032160h1SMcG0020690 dd_Smed_v4_1745_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30032160h1SMcG0020690 dd_Smed_v4_1745_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032160h1SMcG0001560 Contig5115newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032160h1SMcG0001560 Contig5115uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032160h1SMcG0020690 Contig45360uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032160h1SMcG0020690 Contig45360newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032160h1SMcG0020690 Contig18952uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032160h1SMcG0020690 Contig18952newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032160h1SMcG0020690 Contig29093newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032160h1SMcG0020690 Contig29093uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032160h1SMcG0020690 Contig5115newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032160h1SMcG0020690 Contig5115uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032160h1SMcG0020690 Contig45260newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032160h1SMcG0020690 Contig45260uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032160h1SMcG0020690 Contig38233uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032160h1SMcG0020690 Contig38233newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynx musculatureSMED30032160h1SMcG0020690 dd_Smed_v6_1745_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
musculature systemSMED30032160h1SMcG0020690 dd_Smed_v6_1745_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Human
Match: FLNC (filamin C [Source:HGNC Symbol;Acc:HGNC:3756])

HSP 1 Score: 74.7146 bits (182), Expect = 2.813e-16
Identity = 49/119 (41.18%), Postives = 63/119 (52.94%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCY--DKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y P  PGEY+V V+C+D DI++SPF+  I PA  D C   K KAFGPG+E     VDK   FT+D R  G       K Y  D  G P+ +K     +GT +  Y P    +H I +
Sbjct:  628 VRYWPTEPGEYAVHVICDDEDIRDSPFIAHILPAPPD-CFPDKVKAFGPGLEPTGCIVDKPAEFTIDARAAG---KGDLKLYAQDADGCPIDIKVIPNGDGTFRCSYVPTKPIKHTIII 742          

HSP 2 Score: 57.7658 bits (138), Expect = 2.872e-10
Identity = 36/117 (30.77%), Postives = 52/117 (44.44%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y P   G Y+V V   D ++  SPF + + PA     D +K +A GPG+ +  +P      FT+D RD G  +  V +  D  G P         +GT    Y P   G + I +
Sbjct: 1503 VHYTPATDGPYTVAVKYADQEVPRSPFKIKVLPAH----DASKVRASGPGLNASGIPASLPVEFTIDARDAGEGLLTV-QILDPEGKPKKANIRDNGDGTYTVSYLPDMSGRYTITI 1614          

HSP 3 Score: 55.4546 bits (132), Expect = 1.940e-9
Identity = 37/117 (31.62%), Postives = 52/117 (44.44%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V YLP  PGEY++ +L  ++ I  SPF   I P      D +K +A GPG+E     V +  TFTVD  + G     +    D  G    +      +GT    Y P   G + I +
Sbjct: 1119 VSYLPTEPGEYTINILFAEAHIPGSPFKATIRPVF----DPSKVRASGPGLERG--KVGEAATFTVDCSEAGEAELTIEILSDA-GVKAEVLIHNNADGTYHITYSPAFPGTYTITI 1228          

HSP 4 Score: 48.1358 bits (113), Expect = 7.009e-7
Identity = 37/119 (31.09%), Postives = 56/119 (47.06%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGP--VVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y+P++ G + V VL    +I+ SPF V +  AL    D  K  A GPG+E      +K T F + T   G   V   +     +R T + +  E + + T +  Y+P  EG H + V
Sbjct:  338 VSYVPKVAGLHKVTVLFAGQNIERSPFEVNVGMAL---GDANKVSARGPGLEPVGNVANKPTYFDIYTAGAGTGDVAVVIVDPQGRRDT-VEVALEDKGDSTFRCTYRPAMEGPHTVHV 452          

HSP 5 Score: 47.7506 bits (112), Expect = 8.026e-7
Identity = 36/117 (30.77%), Postives = 50/117 (42.74%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            VEY+P  PG+Y V +      I  SPF VP+     D  D  K K  GPG+ +  +      TFTVD    G   P         G   P++     +GT    Y P ++G + + V
Sbjct: 1407 VEYIPFTPGDYDVNITFGGRPIPGSPFRVPVK----DVVDPGKVKCSGPGLGAG-VRARVPQTFTVDCSQAGR-APLQVAVLGPTGVAEPVEVRDNGDGTHTVHYTPATDGPYTVAV 1517          

HSP 6 Score: 46.595 bits (109), Expect = 2.072e-6
Identity = 27/72 (37.50%), Postives = 39/72 (54.17%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCG 227
            V+Y P   G Y++ VL  + +I  SPF + + P+     D +K KA GPG+    + V K T FTV T+  G
Sbjct:  831 VKYTPPGAGRYTIMVLFANQEIPASPFHIKVDPSH----DASKVKAEGPGLNRTGVEVGKPTHFTVLTKGAG 898          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Human
Match: FLNC (filamin C [Source:HGNC Symbol;Acc:HGNC:3756])

HSP 1 Score: 74.7146 bits (182), Expect = 3.012e-16
Identity = 49/119 (41.18%), Postives = 63/119 (52.94%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCY--DKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y P  PGEY+V V+C+D DI++SPF+  I PA  D C   K KAFGPG+E     VDK   FT+D R  G       K Y  D  G P+ +K     +GT +  Y P    +H I +
Sbjct:  628 VRYWPTEPGEYAVHVICDDEDIRDSPFIAHILPAPPD-CFPDKVKAFGPGLEPTGCIVDKPAEFTIDARAAG---KGDLKLYAQDADGCPIDIKVIPNGDGTFRCSYVPTKPIKHTIII 742          

HSP 2 Score: 57.7658 bits (138), Expect = 3.197e-10
Identity = 36/117 (30.77%), Postives = 52/117 (44.44%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y P   G Y+V V   D ++  SPF + + PA     D +K +A GPG+ +  +P      FT+D RD G  +  V +  D  G P         +GT    Y P   G + I +
Sbjct: 1503 VHYTPATDGPYTVAVKYADQEVPRSPFKIKVLPAH----DASKVRASGPGLNASGIPASLPVEFTIDARDAGEGLLTV-QILDPEGKPKKANIRDNGDGTYTVSYLPDMSGRYTITI 1614          

HSP 3 Score: 55.0694 bits (131), Expect = 2.159e-9
Identity = 37/117 (31.62%), Postives = 52/117 (44.44%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V YLP  PGEY++ +L  ++ I  SPF   I P      D +K +A GPG+E     V +  TFTVD  + G     +    D  G    +      +GT    Y P   G + I +
Sbjct: 1119 VSYLPTEPGEYTINILFAEAHIPGSPFKATIRPVF----DPSKVRASGPGLERG--KVGEAATFTVDCSEAGEAELTIEILSDA-GVKAEVLIHNNADGTYHITYSPAFPGTYTITI 1228          

HSP 4 Score: 47.7506 bits (112), Expect = 8.106e-7
Identity = 37/119 (31.09%), Postives = 56/119 (47.06%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGP--VVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y+P++ G + V VL    +I+ SPF V +  AL    D  K  A GPG+E      +K T F + T   G   V   +     +R T + +  E + + T +  Y+P  EG H + V
Sbjct:  338 VSYVPKVAGLHKVTVLFAGQNIERSPFEVNVGMAL---GDANKVSARGPGLEPVGNVANKPTYFDIYTAGAGTGDVAVVIVDPQGRRDT-VEVALEDKGDSTFRCTYRPAMEGPHTVHV 452          

HSP 5 Score: 47.7506 bits (112), Expect = 8.185e-7
Identity = 36/117 (30.77%), Postives = 50/117 (42.74%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            VEY+P  PG+Y V +      I  SPF VP+     D  D  K K  GPG+ +  +      TFTVD    G   P         G   P++     +GT    Y P ++G + + V
Sbjct: 1407 VEYIPFTPGDYDVNITFGGRPIPGSPFRVPVK----DVVDPGKVKCSGPGLGAG-VRARVPQTFTVDCSQAG-RAPLQVAVLGPTGVAEPVEVRDNGDGTHTVHYTPATDGPYTVAV 1517          

HSP 6 Score: 46.595 bits (109), Expect = 2.196e-6
Identity = 27/72 (37.50%), Postives = 39/72 (54.17%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCG 227
            V+Y P   G Y++ VL  + +I  SPF + + P+     D +K KA GPG+    + V K T FTV T+  G
Sbjct:  831 VKYTPPGAGRYTIMVLFANQEIPASPFHIKVDPSH----DASKVKAEGPGLNRTGVEVGKPTHFTVLTKGAG 898          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Human
Match: FLNB (filamin B [Source:HGNC Symbol;Acc:HGNC:3755])

HSP 1 Score: 69.3218 bits (168), Expect = 2.173e-14
Identity = 42/118 (35.59%), Postives = 63/118 (53.39%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKC-DLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V+Y P+ PGEY+V ++C+D DI++SP+M  I PA      DL   +A+GPG+E     V+    FTVD +D G   P      D  G  + ++ + + +GT    Y P    +H I V
Sbjct:  606 VKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGGYNPDLV--RAYGPGLEKSGCIVNNLAEFTVDPKDAGK-APLKIFAQDGEGQRIDIQMKNRMDGTYACSYTPVKAIKHTIAV 720          

HSP 2 Score: 56.225 bits (134), Expect = 8.923e-10
Identity = 39/117 (33.33%), Postives = 51/117 (43.59%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y P   G Y V V   D +I  SPF V + P      D +K  A GPG+ S  +P      F +D RD G  + AV +  D+ G P         +GT    Y P   G ++I V
Sbjct: 1481 VTYTPSQEGPYMVSVKYADEEIPRSPFKVKVLPTY----DASKVTASGPGLSSYGVPASLPVDFAIDARDAGEGLLAV-QITDQEGKPKRAIVHDNKDGTYAVTYIPDKTGRYMIGV 1592          

HSP 3 Score: 55.4546 bits (132), Expect = 2.074e-9
Identity = 37/118 (31.36%), Postives = 54/118 (45.76%), Query Frame = 3
Query:    9 QVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
              EY+P  PG+Y V +    + I  SPF VP+     D  D +K K  GPG+ S  +      +FTVD+   G + P   +    RG   P+      +GT    Y P  EG +++ V
Sbjct: 1384 SAEYIPFAPGDYDVNITYGGAHIPGSPFRVPVK----DVVDPSKVKIAGPGLGSG-VRARVLQSFTVDSSKAG-LAPLEVRVLGPRGLVEPVNVVDNGDGTHTVTYTPSQEGPYMVSV 1495          

HSP 4 Score: 50.447 bits (119), Expect = 8.991e-8
Identity = 40/119 (33.61%), Postives = 58/119 (48.74%), Query Frame = 3
Query:    9 QVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRG-TPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
             VEYLP++ G + V VL     I  SPF V +  A   + D +K  A GPG+E+     +K T F + T   G V     +  D +G   + L  E + N   + VYKP   G HV+++
Sbjct:  316 SVEYLPKVTGLHKVTVLFAGQHISKSPFEVSVDKA---QGDASKVTAKGPGLEAVGNIANKPTYFDIYTAGAG-VGDIGVEVEDPQGKNTVELLVEDKGNQVYRCVYKPMQPGPHVVKI 430          

HSP 5 Score: 47.7506 bits (112), Expect = 7.714e-7
Identity = 36/119 (30.25%), Postives = 55/119 (46.22%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCY--DKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y+P   G Y++ +      + + P  V + PA+    D ++ K FGPGIE K +  +  T FTVD+R    V     K +  +  G           +GT Q  Y P  +G HV++V
Sbjct: 1192 VTYVPLTAGMYTLTMKYGGELVPHFPARVKVEPAV----DTSRIKVFGPGIEGKDVFREATTDFTVDSRPLTQVGGDHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEV 1306          

HSP 6 Score: 46.9802 bits (110), Expect = 1.825e-6
Identity = 27/72 (37.50%), Postives = 39/72 (54.17%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCG 227
            V+Y+P   G Y+++VL    +I  SPF V + P+     D +K KA GPG+    +   K T FTV T+  G
Sbjct:  809 VKYVPPAAGRYTIKVLFASQEIPASPFRVKVDPS----HDASKVKAEGPGLSKAGVENGKPTHFTVYTKGAG 876          

HSP 7 Score: 45.4394 bits (106), Expect = 5.445e-6
Identity = 35/118 (29.66%), Postives = 50/118 (42.37%), Query Frame = 3
Query:    9 QVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
             V YLP  PGEY V +L  +  I  SPF   I        D +K  A GPG+E     V +    +VD  + GP    +    D  GT   +  +   +GT    Y P + G + + +
Sbjct: 1096 SVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPF----DPSKVVASGPGLEHG--KVGEAGLLSVDCSEAGPGALGLEAVSDS-GTKAEVSIQNNKDGTYAVTYVPLTAGMYTLTM 1206          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Human
Match: FLNB (filamin B [Source:HGNC Symbol;Acc:HGNC:3755])

HSP 1 Score: 69.3218 bits (168), Expect = 2.281e-14
Identity = 42/118 (35.59%), Postives = 63/118 (53.39%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKC-DLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V+Y P+ PGEY+V ++C+D DI++SP+M  I PA      DL   +A+GPG+E     V+    FTVD +D G   P      D  G  + ++ + + +GT    Y P    +H I V
Sbjct:  606 VKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGGYNPDLV--RAYGPGLEKSGCIVNNLAEFTVDPKDAGK-APLKIFAQDGEGQRIDIQMKNRMDGTYACSYTPVKAIKHTIAV 720          

HSP 2 Score: 56.225 bits (134), Expect = 9.549e-10
Identity = 39/117 (33.33%), Postives = 51/117 (43.59%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y P   G Y V V   D +I  SPF V + P      D +K  A GPG+ S  +P      F +D RD G  + AV +  D+ G P         +GT    Y P   G ++I V
Sbjct: 1481 VTYTPSQEGPYMVSVKYADEEIPRSPFKVKVLPTY----DASKVTASGPGLSSYGVPASLPVDFAIDARDAGEGLLAV-QITDQEGKPKRAIVHDNKDGTYAVTYIPDKTGRYMIGV 1592          

HSP 3 Score: 55.0694 bits (131), Expect = 2.241e-9
Identity = 37/118 (31.36%), Postives = 54/118 (45.76%), Query Frame = 3
Query:    9 QVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
              EY+P  PG+Y V +    + I  SPF VP+     D  D +K K  GPG+ S  +      +FTVD+   G + P   +    RG   P+      +GT    Y P  EG +++ V
Sbjct: 1384 SAEYIPFAPGDYDVNITYGGAHIPGSPFRVPVK----DVVDPSKVKIAGPGLGSG-VRARVLQSFTVDSSKAG-LAPLEVRVLGPRGLVEPVNVVDNGDGTHTVTYTPSQEGPYMVSV 1495          

HSP 4 Score: 50.447 bits (119), Expect = 9.904e-8
Identity = 40/119 (33.61%), Postives = 58/119 (48.74%), Query Frame = 3
Query:    9 QVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRG-TPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
             VEYLP++ G + V VL     I  SPF V +  A   + D +K  A GPG+E+     +K T F + T   G V     +  D +G   + L  E + N   + VYKP   G HV+++
Sbjct:  316 SVEYLPKVTGLHKVTVLFAGQHISKSPFEVSVDKA---QGDASKVTAKGPGLEAVGNIANKPTYFDIYTAGAG-VGDIGVEVEDPQGKNTVELLVEDKGNQVYRCVYKPMQPGPHVVKI 430          

HSP 5 Score: 47.7506 bits (112), Expect = 8.334e-7
Identity = 36/119 (30.25%), Postives = 55/119 (46.22%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCY--DKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y+P   G Y++ +      + + P  V + PA+    D ++ K FGPGIE K +  +  T FTVD+R    V     K +  +  G           +GT Q  Y P  +G HV++V
Sbjct: 1192 VTYVPLTAGMYTLTMKYGGELVPHFPARVKVEPAV----DTSRIKVFGPGIEGKDVFREATTDFTVDSRPLTQVGGDHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEV 1306          

HSP 6 Score: 46.595 bits (109), Expect = 1.953e-6
Identity = 27/72 (37.50%), Postives = 39/72 (54.17%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCG 227
            V+Y+P   G Y+++VL    +I  SPF V + P+     D +K KA GPG+    +   K T FTV T+  G
Sbjct:  809 VKYVPPAAGRYTIKVLFASQEIPASPFRVKVDPS----HDASKVKAEGPGLSKAGVENGKPTHFTVYTKGAG 876          

HSP 7 Score: 45.4394 bits (106), Expect = 5.825e-6
Identity = 35/118 (29.66%), Postives = 50/118 (42.37%), Query Frame = 3
Query:    9 QVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
             V YLP  PGEY V +L  +  I  SPF   I        D +K  A GPG+E     V +    +VD  + GP    +    D  GT   +  +   +GT    Y P + G + + +
Sbjct: 1096 SVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPF----DPSKVVASGPGLEHG--KVGEAGLLSVDCSEAGPGALGLEAVSDS-GTKAEVSIQNNKDGTYAVTYVPLTAGMYTLTM 1206          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Human
Match: FLNB (filamin B [Source:HGNC Symbol;Acc:HGNC:3755])

HSP 1 Score: 69.3218 bits (168), Expect = 2.373e-14
Identity = 42/118 (35.59%), Postives = 63/118 (53.39%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKC-DLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V+Y P+ PGEY+V ++C+D DI++SP+M  I PA      DL   +A+GPG+E     V+    FTVD +D G   P      D  G  + ++ + + +GT    Y P    +H I V
Sbjct:  606 VKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGGYNPDLV--RAYGPGLEKSGCIVNNLAEFTVDPKDAGK-APLKIFAQDGEGQRIDIQMKNRMDGTYACSYTPVKAIKHTIAV 720          

HSP 2 Score: 56.225 bits (134), Expect = 9.932e-10
Identity = 39/117 (33.33%), Postives = 51/117 (43.59%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y P   G Y V V   D +I  SPF V + P      D +K  A GPG+ S  +P      F +D RD G  + AV +  D+ G P         +GT    Y P   G ++I V
Sbjct: 1512 VTYTPSQEGPYMVSVKYADEEIPRSPFKVKVLPTY----DASKVTASGPGLSSYGVPASLPVDFAIDARDAGEGLLAV-QITDQEGKPKRAIVHDNKDGTYAVTYIPDKTGRYMIGV 1623          

HSP 3 Score: 50.447 bits (119), Expect = 1.010e-7
Identity = 40/119 (33.61%), Postives = 58/119 (48.74%), Query Frame = 3
Query:    9 QVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRG-TPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
             VEYLP++ G + V VL     I  SPF V +  A   + D +K  A GPG+E+     +K T F + T   G V     +  D +G   + L  E + N   + VYKP   G HV+++
Sbjct:  316 SVEYLPKVTGLHKVTVLFAGQHISKSPFEVSVDKA---QGDASKVTAKGPGLEAVGNIANKPTYFDIYTAGAG-VGDIGVEVEDPQGKNTVELLVEDKGNQVYRCVYKPMQPGPHVVKI 430          

HSP 4 Score: 47.7506 bits (112), Expect = 8.258e-7
Identity = 36/119 (30.25%), Postives = 55/119 (46.22%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCY--DKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y+P   G Y++ +      + + P  V + PA+    D ++ K FGPGIE K +  +  T FTVD+R    V     K +  +  G           +GT Q  Y P  +G HV++V
Sbjct: 1192 VTYVPLTAGMYTLTMKYGGELVPHFPARVKVEPAV----DTSRIKVFGPGIEGKDVFREATTDFTVDSRPLTQVGGDHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEV 1306          

HSP 5 Score: 46.595 bits (109), Expect = 2.011e-6
Identity = 27/72 (37.50%), Postives = 39/72 (54.17%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCG 227
            V+Y+P   G Y+++VL    +I  SPF V + P+     D +K KA GPG+    +   K T FTV T+  G
Sbjct:  809 VKYVPPAAGRYTIKVLFASQEIPASPFRVKVDPS----HDASKVKAEGPGLSKAGVENGKPTHFTVYTKGAG 876          

HSP 6 Score: 45.4394 bits (106), Expect = 6.117e-6
Identity = 35/118 (29.66%), Postives = 50/118 (42.37%), Query Frame = 3
Query:    9 QVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
             V YLP  PGEY V +L  +  I  SPF   I        D +K  A GPG+E     V +    +VD  + GP    +    D  GT   +  +   +GT    Y P + G + + +
Sbjct: 1096 SVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPF----DPSKVVASGPGLEHG--KVGEAGLLSVDCSEAGPGALGLEAVSDS-GTKAEVSIQNNKDGTYAVTYVPLTAGMYTLTM 1206          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Celegans
Match: fln-1 (FiLamiN (Actin binding protein) homolog [Source:UniProtKB/TrEMBL;Acc:U4PM09])

HSP 1 Score: 45.8246 bits (107), Expect = 1.489e-6
Identity = 43/119 (36.13%), Postives = 53/119 (44.54%), Query Frame = 3
Query:    9 QVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDT-RDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
             V+Y    PGEY V V  ND  I +SPF V I PA  +   L  A+  G GI     P  K  TFTV T R  G +   V    ++  T   +  E   +   +FV  PK  G H I V
Sbjct: 1906 HVDYKVATPGEYVVAVKFNDQHIPDSPFKVYIAPATGEVRKLELAQFHGQGI-----PAGKAFTFTVLTHRAKGHLEAKVVTPNNEVDTIDIVPIEDGESYAMRFV--PKETGNHFIHV 2017          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Celegans
Match: fln-1 (FiLamiN (Actin binding protein) homolog [Source:UniProtKB/TrEMBL;Acc:U4PM09])

HSP 1 Score: 45.8246 bits (107), Expect = 1.489e-6
Identity = 43/119 (36.13%), Postives = 53/119 (44.54%), Query Frame = 3
Query:    9 QVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDT-RDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
             V+Y    PGEY V V  ND  I +SPF V I PA  +   L  A+  G GI     P  K  TFTV T R  G +   V    ++  T   +  E   +   +FV  PK  G H I V
Sbjct: 1908 HVDYKVATPGEYVVAVKFNDQHIPDSPFKVYIAPATGEVRKLELAQFHGQGI-----PAGKAFTFTVLTHRAKGHLEAKVVTPNNEVDTIDIVPIEDGESYAMRFV--PKETGNHFIHV 2019          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Celegans
Match: fln-1 (FiLamiN (Actin binding protein) homolog [Source:UniProtKB/TrEMBL;Acc:U4PM09])

HSP 1 Score: 45.8246 bits (107), Expect = 1.532e-6
Identity = 43/119 (36.13%), Postives = 53/119 (44.54%), Query Frame = 3
Query:    9 QVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDT-RDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
             V+Y    PGEY V V  ND  I +SPF V I PA  +   L  A+  G GI     P  K  TFTV T R  G +   V    ++  T   +  E   +   +FV  PK  G H I V
Sbjct: 1908 HVDYKVATPGEYVVAVKFNDQHIPDSPFKVYIAPATGEVRKLELAQFHGQGI-----PAGKAFTFTVLTHRAKGHLEAKVVTPNNEVDTIDIVPIEDGESYAMRFV--PKETGNHFIHV 2019          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Celegans
Match: fln-1 (FiLamiN (Actin binding protein) homolog [Source:UniProtKB/TrEMBL;Acc:U4PM09])

HSP 1 Score: 45.8246 bits (107), Expect = 1.547e-6
Identity = 43/119 (36.13%), Postives = 53/119 (44.54%), Query Frame = 3
Query:    9 QVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDT-RDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
             V+Y    PGEY V V  ND  I +SPF V I PA  +   L  A+  G GI     P  K  TFTV T R  G +   V    ++  T   +  E   +   +FV  PK  G H I V
Sbjct: 1910 HVDYKVATPGEYVVAVKFNDQHIPDSPFKVYIAPATGEVRKLELAQFHGQGI-----PAGKAFTFTVLTHRAKGHLEAKVVTPNNEVDTIDIVPIEDGESYAMRFV--PKETGNHFIHV 2021          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Celegans
Match: fln-1 (FiLamiN (Actin binding protein) homolog [Source:UniProtKB/TrEMBL;Acc:U4PM09])

HSP 1 Score: 45.8246 bits (107), Expect = 1.547e-6
Identity = 43/119 (36.13%), Postives = 53/119 (44.54%), Query Frame = 3
Query:    9 QVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDT-RDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
             V+Y    PGEY V V  ND  I +SPF V I PA  +   L  A+  G GI     P  K  TFTV T R  G +   V    ++  T   +  E   +   +FV  PK  G H I V
Sbjct: 1910 HVDYKVATPGEYVVAVKFNDQHIPDSPFKVYIAPATGEVRKLELAQFHGQGI-----PAGKAFTFTVLTHRAKGHLEAKVVTPNNEVDTIDIVPIEDGESYAMRFV--PKETGNHFIHV 2021          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Fly
Match: cher (gene:FBgn0014141 transcript:FBtr0089471)

HSP 1 Score: 72.4034 bits (176), Expect = 9.900e-16
Identity = 43/117 (36.75%), Postives = 64/117 (54.70%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V+Y P   GEY+V +LC++ DI  SPF+  I P      +L KA   GPG+E   + +++ T+FTVD    G   P      D  GT LP++ +  P+GT++  Y P S   H ++V
Sbjct:  605 VKYHPTAVGEYAVHILCDNEDIPKSPFIAQILPRTDFHPELVKAS--GPGLEKNGVTINQPTSFTVDPSKAGN-APLDVVVQDVFGTKLPVELKNNPDGTKKVTYTPTSGVPHTVEV 718          

HSP 2 Score: 48.9062 bits (115), Expect = 1.696e-7
Identity = 38/112 (33.93%), Postives = 51/112 (45.54%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLP-LKSETQPNGTQQFVYKPKSEG 344
            V+YL   PGEY + +   D  I  SPF V +     +  D +K K +GPGIE   +     T F VD  + GP   AV K  +  G P+  L+ E + N      Y P   G
Sbjct:  992 VDYLATDPGEYDITIRFADKHIPGSPFRVLVE----ETVDPSKVKVYGPGIEHGQVRESVPTFFNVDVGEAGPGRIAV-KLTNSEGIPVDNLRVEDKGNCIYAVHYVPPKAG 1098          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Fly
Match: cher (gene:FBgn0014141 transcript:FBtr0303364)

HSP 1 Score: 72.4034 bits (176), Expect = 1.010e-15
Identity = 43/117 (36.75%), Postives = 64/117 (54.70%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V+Y P   GEY+V +LC++ DI  SPF+  I P      +L KA   GPG+E   + +++ T+FTVD    G   P      D  GT LP++ +  P+GT++  Y P S   H ++V
Sbjct:  635 VKYHPTAVGEYAVHILCDNEDIPKSPFIAQILPRTDFHPELVKAS--GPGLEKNGVTINQPTSFTVDPSKAGN-APLDVVVQDVFGTKLPVELKNNPDGTKKVTYTPTSGVPHTVEV 748          

HSP 2 Score: 48.9062 bits (115), Expect = 1.747e-7
Identity = 38/112 (33.93%), Postives = 51/112 (45.54%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLP-LKSETQPNGTQQFVYKPKSEG 344
            V+YL   PGEY + +   D  I  SPF V +     +  D +K K +GPGIE   +     T F VD  + GP   AV K  +  G P+  L+ E + N      Y P   G
Sbjct: 1022 VDYLATDPGEYDITIRFADKHIPGSPFRVLVE----ETVDPSKVKVYGPGIEHGQVRESVPTFFNVDVGEAGPGRIAV-KLTNSEGIPVDNLRVEDKGNCIYAVHYVPPKAG 1128          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Fly
Match: cher (gene:FBgn0014141 transcript:FBtr0337102)

HSP 1 Score: 72.4034 bits (176), Expect = 1.012e-15
Identity = 43/117 (36.75%), Postives = 64/117 (54.70%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V+Y P   GEY+V +LC++ DI  SPF+  I P      +L KA   GPG+E   + +++ T+FTVD    G   P      D  GT LP++ +  P+GT++  Y P S   H ++V
Sbjct:  610 VKYHPTAVGEYAVHILCDNEDIPKSPFIAQILPRTDFHPELVKAS--GPGLEKNGVTINQPTSFTVDPSKAGN-APLDVVVQDVFGTKLPVELKNNPDGTKKVTYTPTSGVPHTVEV 723          

HSP 2 Score: 48.9062 bits (115), Expect = 1.768e-7
Identity = 38/112 (33.93%), Postives = 51/112 (45.54%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLP-LKSETQPNGTQQFVYKPKSEG 344
            V+YL   PGEY + +   D  I  SPF V +     +  D +K K +GPGIE   +     T F VD  + GP   AV K  +  G P+  L+ E + N      Y P   G
Sbjct: 1186 VDYLATDPGEYDITIRFADKHIPGSPFRVLVE----ETVDPSKVKVYGPGIEHGQVRESVPTFFNVDVGEAGPGRIAV-KLTNSEGIPVDNLRVEDKGNCIYAVHYVPPKAG 1292          

HSP 3 Score: 44.2838 bits (103), Expect = 7.185e-6
Identity = 34/122 (27.87%), Postives = 52/122 (42.62%), Query Frame = 3
Query:    9 QVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPA---VAKCYDKRGTPLPLKSETQP-NGTQQFVYKPKSEGEHVIQV 362
             V YLP   G+Y+V +  N+  I  SPF   I P      +L   +  G GI+   + ++  T F VD    G  + +       +D  G  LP K    P +   + +Y P   G H I++
Sbjct:  990 NVAYLPTEAGDYTVNITFNERHITGSPFQPLIVPV----PNLKNTRVSGIGIQPHGVIMNAATDFMVDMSKVGSNIDSGKLSCAIFDPMGHVLPSKIVQGPTDDIFRIMYTPFEAGRHTIEL 1107          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Fly
Match: cher (gene:FBgn0014141 transcript:FBtr0290014)

HSP 1 Score: 72.4034 bits (176), Expect = 1.032e-15
Identity = 43/117 (36.75%), Postives = 64/117 (54.70%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V+Y P   GEY+V +LC++ DI  SPF+  I P      +L KA   GPG+E   + +++ T+FTVD    G   P      D  GT LP++ +  P+GT++  Y P S   H ++V
Sbjct:  605 VKYHPTAVGEYAVHILCDNEDIPKSPFIAQILPRTDFHPELVKAS--GPGLEKNGVTINQPTSFTVDPSKAGN-APLDVVVQDVFGTKLPVELKNNPDGTKKVTYTPTSGVPHTVEV 718          

HSP 2 Score: 48.9062 bits (115), Expect = 1.700e-7
Identity = 38/112 (33.93%), Postives = 51/112 (45.54%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLP-LKSETQPNGTQQFVYKPKSEG 344
            V+YL   PGEY + +   D  I  SPF V +     +  D +K K +GPGIE   +     T F VD  + GP   AV K  +  G P+  L+ E + N      Y P   G
Sbjct: 1181 VDYLATDPGEYDITIRFADKHIPGSPFRVLVE----ETVDPSKVKVYGPGIEHGQVRESVPTFFNVDVGEAGPGRIAV-KLTNSEGIPVDNLRVEDKGNCIYAVHYVPPKAG 1287          

HSP 3 Score: 44.2838 bits (103), Expect = 7.254e-6
Identity = 34/122 (27.87%), Postives = 52/122 (42.62%), Query Frame = 3
Query:    9 QVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPA---VAKCYDKRGTPLPLKSETQP-NGTQQFVYKPKSEGEHVIQV 362
             V YLP   G+Y+V +  N+  I  SPF   I P      +L   +  G GI+   + ++  T F VD    G  + +       +D  G  LP K    P +   + +Y P   G H I++
Sbjct:  985 NVAYLPTEAGDYTVNITFNERHITGSPFQPLIVPV----PNLKNTRVSGIGIQPHGVIMNAATDFMVDMSKVGSNIDSGKLSCAIFDPMGHVLPSKIVQGPTDDIFRIMYTPFEAGRHTIEL 1102          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Fly
Match: cher (gene:FBgn0014141 transcript:FBtr0337100)

HSP 1 Score: 72.4034 bits (176), Expect = 1.032e-15
Identity = 43/117 (36.75%), Postives = 64/117 (54.70%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V+Y P   GEY+V +LC++ DI  SPF+  I P      +L KA   GPG+E   + +++ T+FTVD    G   P      D  GT LP++ +  P+GT++  Y P S   H ++V
Sbjct:  605 VKYHPTAVGEYAVHILCDNEDIPKSPFIAQILPRTDFHPELVKAS--GPGLEKNGVTINQPTSFTVDPSKAGN-APLDVVVQDVFGTKLPVELKNNPDGTKKVTYTPTSGVPHTVEV 718          

HSP 2 Score: 48.9062 bits (115), Expect = 1.700e-7
Identity = 38/112 (33.93%), Postives = 51/112 (45.54%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLP-LKSETQPNGTQQFVYKPKSEG 344
            V+YL   PGEY + +   D  I  SPF V +     +  D +K K +GPGIE   +     T F VD  + GP   AV K  +  G P+  L+ E + N      Y P   G
Sbjct: 1181 VDYLATDPGEYDITIRFADKHIPGSPFRVLVE----ETVDPSKVKVYGPGIEHGQVRESVPTFFNVDVGEAGPGRIAV-KLTNSEGIPVDNLRVEDKGNCIYAVHYVPPKAG 1287          

HSP 3 Score: 44.2838 bits (103), Expect = 7.254e-6
Identity = 34/122 (27.87%), Postives = 52/122 (42.62%), Query Frame = 3
Query:    9 QVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPA---VAKCYDKRGTPLPLKSETQP-NGTQQFVYKPKSEGEHVIQV 362
             V YLP   G+Y+V +  N+  I  SPF   I P      +L   +  G GI+   + ++  T F VD    G  + +       +D  G  LP K    P +   + +Y P   G H I++
Sbjct:  985 NVAYLPTEAGDYTVNITFNERHITGSPFQPLIVPV----PNLKNTRVSGIGIQPHGVIMNAATDFMVDMSKVGSNIDSGKLSCAIFDPMGHVLPSKIVQGPTDDIFRIMYTPFEAGRHTIEL 1102          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Zebrafish
Match: flna (filamin A, alpha (actin binding protein 280) [Source:ZFIN;Acc:ZDB-GENE-030131-2145])

HSP 1 Score: 82.4185 bits (202), Expect = 4.185e-19
Identity = 47/117 (40.17%), Postives = 62/117 (52.99%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y P  PGEY+V VLC + DIQ SPFM  I PA        K KA+GPG++S  L V K   FTVD +  G   P   +  D+ G P+ ++ +   NGT    Y P+   +H + V
Sbjct:  637 VRYWPTEPGEYAVHVLCKNEDIQLSPFMAEIMPAPGKDFYPDKVKAYGPGLQSSGLSVGKPAEFTVDAK-LGGKAPLKIQAQDRDGNPVDVQVKDNGNGTYSCSYTPRKPVKHTVMV 752          

HSP 2 Score: 55.0694 bits (131), Expect = 1.764e-9
Identity = 36/117 (30.77%), Postives = 53/117 (45.30%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y+P   G YS+ VL  D +I  SP+ V + P      D +K +  GPG+ +  +P      FT+D +D G  + AV +  D  G P         +GT    Y P   G + I +
Sbjct: 1420 VSYVPTREGPYSINVLYADEEIPQSPYKVKVLPTH----DASKVRCSGPGLNTTGVPASLPVEFTIDAKDAGEGLLAV-QITDPDGKPKKANIRDNQDGTYLVSYVPDMTGRYTILI 1531          

HSP 3 Score: 53.9138 bits (128), Expect = 4.180e-9
Identity = 36/123 (29.27%), Postives = 57/123 (46.34%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQP------NGTQQFVYKPKSEGEHVIQV 362
            + Y+P  PG Y++ +   D D+ N P  + + PA+    + +  K FGPG+E K +  +  T FTVD R     +      + K     P  + T+       +GT Q  Y P  EG H ++V
Sbjct: 1131 ITYVPLYPGAYTLTIRYGDQDVPNFPARLHVEPAV----ETSGVKVFGPGVEGKGVFREATTDFTVDAR----ALTKTGGNHIKTCINNPSGNRTEALIRDLGDGTYQVEYTPYEEGTHSVEV 1245          

HSP 4 Score: 48.1358 bits (113), Expect = 4.003e-7
Identity = 38/119 (31.93%), Postives = 57/119 (47.90%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDC--GPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y+P++ G++ V VL     I  SPF V +  A   + D +K  A GPG+E      +K T F V T     G V   +     K+ T +    E + N + +  YKP  EG+H+I +
Sbjct:  347 VFYVPKVTGQHKVTVLFAGQHISKSPFEVDVGMA---QGDSSKVTAQGPGLEPAGNIANKTTYFDVYTAGAGVGEVEVVIMDPSGKKDT-VECSVEDKGNSSYRCTYKPTQEGQHIIYI 461          

HSP 5 Score: 44.669 bits (104), Expect = 6.185e-6
Identity = 25/72 (34.72%), Postives = 39/72 (54.17%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCG 227
            V+Y P   G Y++ VL  D  I  +P  + + P+     D +K KA GPG+    + ++K T FTV+T+  G
Sbjct:  841 VKYTPPGAGSYTIMVLFADQTIPMTPIRIKVDPSH----DASKVKAEGPGLSRSGVELNKPTHFTVNTKAAG 908          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Zebrafish
Match: CR352234.3 (filamin A, alpha (actin binding protein 280) [Source:NCBI gene;Acc:562529])

HSP 1 Score: 82.4185 bits (202), Expect = 4.350e-19
Identity = 47/117 (40.17%), Postives = 62/117 (52.99%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y P  PGEY+V VLC + DIQ SPFM  I PA        K KA+GPG++S  L V K   FTVD +  G   P   +  D+ G P+ ++ +   NGT    Y P+   +H + V
Sbjct:  636 VRYWPTEPGEYAVHVLCKNEDIQLSPFMAEIMPAPGKDFYPDKVKAYGPGLQSSGLSVGKPAEFTVDAK-LGGKAPLKIQAQDRDGNPVDVQVKDNGNGTYSCSYTPRKPVKHTVMV 751          

HSP 2 Score: 54.6842 bits (130), Expect = 1.852e-9
Identity = 36/117 (30.77%), Postives = 53/117 (45.30%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y+P   G YS+ VL  D +I  SP+ V + P      D +K +  GPG+ +  +P      FT+D +D G  + AV +  D  G P         +GT    Y P   G + I +
Sbjct: 1419 VSYVPTREGPYSINVLYADEEIPQSPYKVKVLPTH----DASKVRCSGPGLNTTGVPASLPVEFTIDAKDAGEGLLAV-QITDPDGKPKKANIRDNQDGTYLVSYVPDMTGRYTILI 1530          

HSP 3 Score: 53.9138 bits (128), Expect = 4.179e-9
Identity = 36/123 (29.27%), Postives = 57/123 (46.34%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQP------NGTQQFVYKPKSEGEHVIQV 362
            + Y+P  PG Y++ +   D D+ N P  + + PA+    + +  K FGPG+E K +  +  T FTVD R     +      + K     P  + T+       +GT Q  Y P  EG H ++V
Sbjct: 1130 ITYVPLYPGAYTLTIRYGDQDVPNFPARLHVEPAV----ETSGVKVFGPGVEGKGVFREATTDFTVDAR----ALTKTGGNHIKTCINNPSGNRTEALIRDLGDGTYQVEYTPYEEGTHSVEV 1244          

HSP 4 Score: 48.1358 bits (113), Expect = 3.888e-7
Identity = 38/120 (31.67%), Postives = 57/120 (47.50%), Query Frame = 3
Query:    9 QVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDC--GPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
             V Y+P++ G++ V VL     I  SPF V +  A   + D +K  A GPG+E      +K T F V T     G V   +     K+ T +    E + N + +  YKP  EG+H+I +
Sbjct:  345 SVFYVPKVTGQHKVTVLFAGQHISKSPFEVDVGMA---QGDSSKVTAQGPGLEPAGNIANKTTYFDVYTAGAGVGEVEVVIMDPSGKKDT-VECSVEDKGNSSYRCTYKPTQEGQHIIYI 460          

HSP 5 Score: 44.669 bits (104), Expect = 6.245e-6
Identity = 25/72 (34.72%), Postives = 39/72 (54.17%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCG 227
            V+Y P   G Y++ VL  D  I  +P  + + P+     D +K KA GPG+    + ++K T FTV+T+  G
Sbjct:  840 VKYTPPGAGSYTIMVLFADQTIPMTPIRIKVDPSH----DASKVKAEGPGLSRSGVELNKPTHFTVNTKAAG 907          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Zebrafish
Match: CR352234.2 (filamin A, alpha (actin binding protein 280) [Source:NCBI gene;Acc:562529])

HSP 1 Score: 82.4185 bits (202), Expect = 4.350e-19
Identity = 47/117 (40.17%), Postives = 62/117 (52.99%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y P  PGEY+V VLC + DIQ SPFM  I PA        K KA+GPG++S  L V K   FTVD +  G   P   +  D+ G P+ ++ +   NGT    Y P+   +H + V
Sbjct:  636 VRYWPTEPGEYAVHVLCKNEDIQLSPFMAEIMPAPGKDFYPDKVKAYGPGLQSSGLSVGKPAEFTVDAK-LGGKAPLKIQAQDRDGNPVDVQVKDNGNGTYSCSYTPRKPVKHTVMV 751          

HSP 2 Score: 54.6842 bits (130), Expect = 1.852e-9
Identity = 36/117 (30.77%), Postives = 53/117 (45.30%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y+P   G YS+ VL  D +I  SP+ V + P      D +K +  GPG+ +  +P      FT+D +D G  + AV +  D  G P         +GT    Y P   G + I +
Sbjct: 1419 VSYVPTREGPYSINVLYADEEIPQSPYKVKVLPTH----DASKVRCSGPGLNTTGVPASLPVEFTIDAKDAGEGLLAV-QITDPDGKPKKANIRDNQDGTYLVSYVPDMTGRYTILI 1530          

HSP 3 Score: 53.9138 bits (128), Expect = 4.179e-9
Identity = 36/123 (29.27%), Postives = 57/123 (46.34%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQP------NGTQQFVYKPKSEGEHVIQV 362
            + Y+P  PG Y++ +   D D+ N P  + + PA+    + +  K FGPG+E K +  +  T FTVD R     +      + K     P  + T+       +GT Q  Y P  EG H ++V
Sbjct: 1130 ITYVPLYPGAYTLTIRYGDQDVPNFPARLHVEPAV----ETSGVKVFGPGVEGKGVFREATTDFTVDAR----ALTKTGGNHIKTCINNPSGNRTEALIRDLGDGTYQVEYTPYEEGTHSVEV 1244          

HSP 4 Score: 48.1358 bits (113), Expect = 3.888e-7
Identity = 38/120 (31.67%), Postives = 57/120 (47.50%), Query Frame = 3
Query:    9 QVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDC--GPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
             V Y+P++ G++ V VL     I  SPF V +  A   + D +K  A GPG+E      +K T F V T     G V   +     K+ T +    E + N + +  YKP  EG+H+I +
Sbjct:  345 SVFYVPKVTGQHKVTVLFAGQHISKSPFEVDVGMA---QGDSSKVTAQGPGLEPAGNIANKTTYFDVYTAGAGVGEVEVVIMDPSGKKDT-VECSVEDKGNSSYRCTYKPTQEGQHIIYI 460          

HSP 5 Score: 44.669 bits (104), Expect = 6.245e-6
Identity = 25/72 (34.72%), Postives = 39/72 (54.17%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCG 227
            V+Y P   G Y++ VL  D  I  +P  + + P+     D +K KA GPG+    + ++K T FTV+T+  G
Sbjct:  840 VKYTPPGAGSYTIMVLFADQTIPMTPIRIKVDPSH----DASKVKAEGPGLSRSGVELNKPTHFTVNTKAAG 907          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Zebrafish
Match: flnca (filamin C, gamma a (actin binding protein 280) [Source:ZFIN;Acc:ZDB-GENE-070503-1])

HSP 1 Score: 76.6406 bits (187), Expect = 4.644e-17
Identity = 48/119 (40.34%), Postives = 65/119 (54.62%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCY--DKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y P  PG+Y+V V+C+D DI++SPFM  I PA  D     K KAFGPG+E   + V+K T FTVD R+ G       K Y  D  G  + ++   + +GT   VY P    +H I +
Sbjct:  635 VRYWPTEPGDYAVHVICDDEDIKDSPFMAHILPAANDVFP-EKVKAFGPGLEPTGVTVNKSTQFTVDAREAG---KGGLKIYAQDAEGCVIDIQITDKGDGTFVCVYVPTKPVKHTIII 749          

HSP 2 Score: 51.6026 bits (122), Expect = 2.538e-8
Identity = 40/120 (33.33%), Postives = 57/120 (47.50%), Query Frame = 3
Query:    9 QVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGP--VVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
             V Y+P++ G + V+VL    DI  SPFMV +  AL    D  K +A GPG+E +     K T F + T   G   V   +    +K  T + +  E + +   +  YKP  EG H I V
Sbjct:  344 SVTYVPKVEGRHKVKVLFAGQDIDKSPFMVNVAKAL---GDPNKVQARGPGLEPEGNVAHKPTYFDIYTAGAGAGDVSVVIVDPQNKNNT-VEVILENKGDNIFRCTYKPVLEGPHTIHV 459          

HSP 3 Score: 49.2914 bits (116), Expect = 1.677e-7
Identity = 29/78 (37.18%), Postives = 42/78 (53.85%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAV 245
            V+Y P  PG Y++ V+  D +I +SPF V + P+     D  K +A GPGI    + V+  T FT+ T+  G   P V
Sbjct:  838 VKYTPPGPGRYTIMVVFADQEIPSSPFKVKVDPSH----DAGKVRAEGPGINKTGVQVEIPTHFTIFTKGAGKAKPEV 911          

HSP 4 Score: 48.1358 bits (113), Expect = 4.248e-7
Identity = 35/118 (29.66%), Postives = 50/118 (42.37%), Query Frame = 3
Query:    9 QVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
             V YLP   G+Y++ +L  ++ I  SPF   + PAL    D  K  A GPG+E       +  +FTVD    G     +    D  G    +  +   +GT    Y P   G H I +
Sbjct: 1125 SVVYLPTEAGDYNINILYGEAHIPGSPFKAVVKPAL----DAGKVTASGPGLERA--KAGEVASFTVDCSRAGEAELTIEIVSDS-GAQAEVCIQNNKDGTFSVTYTPLFHGVHTITI 1235          

HSP 5 Score: 47.3654 bits (111), Expect = 8.611e-7
Identity = 32/117 (27.35%), Postives = 52/117 (44.44%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y P   G ++V V   + ++ +SP+ V   P+     D +K +A GPG+++  +       FT+D RD G  +  V +  D  G P         +GT    Y P   G + I +
Sbjct: 1511 VNYTPAQEGPHTVSVKYANQEVPSSPYKVNSAPSH----DASKVRASGPGLDTTGVAASLPVEFTIDARDAGKGLLTV-QILDPEGKPKKASIHDNRDGTYTVSYVPDMTGRYTITI 1622          

HSP 6 Score: 46.595 bits (109), Expect = 1.662e-6
Identity = 37/118 (31.36%), Postives = 54/118 (45.76%), Query Frame = 3
Query:    9 QVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
             VEY+P   G+Y + +      I  SPF V +   +     ++K K  GPG+ +K +      TFTVD    G V P   + Y  +GT  P+  +   +GT    Y P  EG H + V
Sbjct: 1414 SVEYMPFTAGDYDINIAYGGQPIPGSPFRVQVKDVVD----VSKVKCSGPGLANK-VTAHVPQTFTVDCSKAG-VAPLEVQLYGPKGTLEPVVVKNNRDGTHTVNYTPAQEGPHTVSV 1525          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Zebrafish
Match: flnca (filamin C, gamma a (actin binding protein 280) [Source:ZFIN;Acc:ZDB-GENE-070503-1])

HSP 1 Score: 76.6406 bits (187), Expect = 4.971e-17
Identity = 48/119 (40.34%), Postives = 65/119 (54.62%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCY--DKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y P  PG+Y+V V+C+D DI++SPFM  I PA  D     K KAFGPG+E   + V+K T FTVD R+ G       K Y  D  G  + ++   + +GT   VY P    +H I +
Sbjct:  653 VRYWPTEPGDYAVHVICDDEDIKDSPFMAHILPAANDVFP-EKVKAFGPGLEPTGVTVNKSTQFTVDAREAG---KGGLKIYAQDAEGCVIDIQITDKGDGTFVCVYVPTKPVKHTIII 767          

HSP 2 Score: 51.6026 bits (122), Expect = 2.490e-8
Identity = 40/120 (33.33%), Postives = 57/120 (47.50%), Query Frame = 3
Query:    9 QVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGP--VVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
             V Y+P++ G + V+VL    DI  SPFMV +  AL    D  K +A GPG+E +     K T F + T   G   V   +    +K  T + +  E + +   +  YKP  EG H I V
Sbjct:  344 SVTYVPKVEGRHKVKVLFAGQDIDKSPFMVNVAKAL---GDPNKVQARGPGLEPEGNVAHKPTYFDIYTAGAGAGDVSVVIVDPQNKNNT-VEVILENKGDNIFRCTYKPVLEGPHTIHV 459          

HSP 3 Score: 49.2914 bits (116), Expect = 1.678e-7
Identity = 29/78 (37.18%), Postives = 42/78 (53.85%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAV 245
            V+Y P  PG Y++ V+  D +I +SPF V + P+     D  K +A GPGI    + V+  T FT+ T+  G   P V
Sbjct:  856 VKYTPPGPGRYTIMVVFADQEIPSSPFKVKVDPSH----DAGKVRAEGPGINKTGVQVEIPTHFTIFTKGAGKAKPEV 929          

HSP 4 Score: 48.1358 bits (113), Expect = 4.332e-7
Identity = 35/118 (29.66%), Postives = 50/118 (42.37%), Query Frame = 3
Query:    9 QVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
             V YLP   G+Y++ +L  ++ I  SPF   + PAL    D  K  A GPG+E       +  +FTVD    G     +    D  G    +  +   +GT    Y P   G H I +
Sbjct: 1143 SVVYLPTEAGDYNINILYGEAHIPGSPFKAVVKPAL----DAGKVTASGPGLERA--KAGEVASFTVDCSRAGEAELTIEIVSDS-GAQAEVCIQNNKDGTFSVTYTPLFHGVHTITI 1253          

HSP 5 Score: 47.3654 bits (111), Expect = 8.126e-7
Identity = 32/117 (27.35%), Postives = 52/117 (44.44%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y P   G ++V V   + ++ +SP+ V   P+     D +K +A GPG+++  +       FT+D RD G  +  V +  D  G P         +GT    Y P   G + I +
Sbjct: 1529 VNYTPAQEGPHTVSVKYANQEVPSSPYKVNSAPSH----DASKVRASGPGLDTTGVAASLPVEFTIDARDAGKGLLTV-QILDPEGKPKKASIHDNRDGTYTVSYVPDMTGRYTITI 1640          

HSP 6 Score: 46.2098 bits (108), Expect = 1.679e-6
Identity = 37/118 (31.36%), Postives = 54/118 (45.76%), Query Frame = 3
Query:    9 QVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
             VEY+P   G+Y + +      I  SPF V +   +     ++K K  GPG+ +K +      TFTVD    G V P   + Y  +GT  P+  +   +GT    Y P  EG H + V
Sbjct: 1432 SVEYMPFTAGDYDINIAYGGQPIPGSPFRVQVKDVVD----VSKVKCSGPGLANK-VTAHVPQTFTVDCSKAG-VAPLEVQLYGPKGTLEPVVVKNNRDGTHTVNYTPAQEGPHTVSV 1543          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Xenopus
Match: FLNB (filamin B [Source:NCBI gene;Acc:100485165])

HSP 1 Score: 80.8777 bits (198), Expect = 2.008e-18
Identity = 47/119 (39.50%), Postives = 64/119 (53.78%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCY--DKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y P+ PGEY++ ++C+D DIQNSP+M  I PA  D  D  K KA+GPG+E     V     F VD  D G    A  K Y  D  G P+ + ++ +P+GT    Y P    +H + V
Sbjct:  614 VRYWPKEPGEYAIHIMCDDEDIQNSPYMALIQPASGD-IDPDKVKAYGPGLEKTGCIVSTPAEFAVDPTDAG---KAALKIYSQDVEGNPVDIMTKEKPDGTYACSYTPAKPIKHTVAV 728          

HSP 2 Score: 52.7582 bits (125), Expect = 1.358e-8
Identity = 38/118 (32.20%), Postives = 53/118 (44.92%), Query Frame = 3
Query:    9 QVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
             VEY P + G+Y V +  +   I  SPF VP+     D  D +K K  GPG+ +  +       FTVDT   G + P   +    RGT  P+      +GT    Y P  EG + + V
Sbjct: 1392 SVEYTPYVTGDYDVNITYDGEHIPGSPFRVPVK----DVVDPSKVKISGPGLGTA-VRAKIPQQFTVDTSKAG-IAPLAVQVTGPRGTVEPVDLVDNGDGTHTVSYTPTLEGPYTVAV 1503          

HSP 3 Score: 52.7582 bits (125), Expect = 1.426e-8
Identity = 35/117 (29.91%), Postives = 53/117 (45.30%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y P L G Y+V V   D +I  SPF V + P      D +K  A GPG+ ++ +       F VD ++ G + P   +  D+ G P   + +   +GT    Y P   G + + V
Sbjct: 1489 VSYTPTLEGPYTVAVQYADEEIPRSPFKVKVLPTY----DASKVTASGPGLCAQGISASLPVNFAVDAKNAG-LGPLSVQITDQEGKPKKAQIQDNNDGTYSVSYIPDRTGRYHVAV 1600          

HSP 4 Score: 45.4394 bits (106), Expect = 5.599e-6
Identity = 24/72 (33.33%), Postives = 39/72 (54.17%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCG 227
            V+Y+P   G Y+++VL    +I  SPF + + P+     D +K +A GPG+    +   K + FTV T+  G
Sbjct:  817 VKYMPPAAGRYTIKVLFAGEEIPESPFRIKVDPS----HDASKVRAEGPGLSKSGVENGKPSHFTVYTKGAG 884          

HSP 5 Score: 45.0542 bits (105), Expect = 6.993e-6
Identity = 37/121 (30.58%), Postives = 52/121 (42.98%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVD----TRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y+P   G Y++ +      +   P  V + PA+    D +K K FGPGIE K +  +  T FTVD    T+  G  V    K  +  G           +GT    Y P  +G H I+V
Sbjct: 1200 VTYVPLFAGMYTLALKYGGEQVPKFPARVKVDPAV----DTSKIKVFGPGIEEKGVFREATTDFTVDAKSLTKTGGNHVK--TKITNPSGASTDYLLRDNGDGTYYVEYTPFEKGAHAIKV 1314          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Xenopus
Match: FLNB (filamin B [Source:NCBI gene;Acc:100485165])

HSP 1 Score: 80.8777 bits (198), Expect = 2.107e-18
Identity = 47/119 (39.50%), Postives = 64/119 (53.78%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCY--DKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y P+ PGEY++ ++C+D DIQNSP+M  I PA  D  D  K KA+GPG+E     V     F VD  D G    A  K Y  D  G P+ + ++ +P+GT    Y P    +H + V
Sbjct:  613 VRYWPKEPGEYAIHIMCDDEDIQNSPYMALIQPASGD-IDPDKVKAYGPGLEKTGCIVSTPAEFAVDPTDAG---KAALKIYSQDVEGNPVDIMTKEKPDGTYACSYTPAKPIKHTVAV 727          

HSP 2 Score: 52.7582 bits (125), Expect = 1.439e-8
Identity = 38/118 (32.20%), Postives = 53/118 (44.92%), Query Frame = 3
Query:    9 QVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
             VEY P + G+Y V +  +   I  SPF VP+     D  D +K K  GPG+ +  +       FTVDT   G + P   +    RGT  P+      +GT    Y P  EG + + V
Sbjct: 1390 SVEYTPYVTGDYDVNITYDGEHIPGSPFRVPVK----DVVDPSKVKISGPGLGTA-VRAKIPQQFTVDTSKAG-IAPLAVQVTGPRGTVEPVDLVDNGDGTHTVSYTPTLEGPYTVAV 1501          

HSP 3 Score: 52.7582 bits (125), Expect = 1.525e-8
Identity = 35/117 (29.91%), Postives = 53/117 (45.30%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y P L G Y+V V   D +I  SPF V + P      D +K  A GPG+ ++ +       F VD ++ G + P   +  D+ G P   + +   +GT    Y P   G + + V
Sbjct: 1487 VSYTPTLEGPYTVAVQYADEEIPRSPFKVKVLPTY----DASKVTASGPGLCAQGISASLPVNFAVDAKNAG-LGPLSVQITDQEGKPKKAQIQDNNDGTYSVSYIPDRTGRYHVAV 1598          

HSP 4 Score: 45.4394 bits (106), Expect = 5.597e-6
Identity = 24/72 (33.33%), Postives = 39/72 (54.17%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCG 227
            V+Y+P   G Y+++VL    +I  SPF + + P+     D +K +A GPG+    +   K + FTV T+  G
Sbjct:  816 VKYMPPAAGRYTIKVLFAGEEIPESPFRIKVDPS----HDASKVRAEGPGLSKSGVENGKPSHFTVYTKGAG 883          

HSP 5 Score: 45.0542 bits (105), Expect = 7.127e-6
Identity = 37/121 (30.58%), Postives = 52/121 (42.98%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVD----TRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y+P   G Y++ +      +   P  V + PA+    D +K K FGPGIE K +  +  T FTVD    T+  G  V    K  +  G           +GT    Y P  +G H I+V
Sbjct: 1198 VTYVPLFAGMYTLALKYGGEQVPKFPARVKVDPAV----DTSKIKVFGPGIEEKGVFREATTDFTVDAKSLTKTGGNHVK--TKITNPSGASTDYLLRDNGDGTYYVEYTPFEKGAHAIKV 1312          

HSP 6 Score: 44.669 bits (104), Expect = 8.482e-6
Identity = 36/118 (30.51%), Postives = 53/118 (44.92%), Query Frame = 3
Query:    9 QVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
             VEY+P++ G + V VL     I  SPF V +  A   + D +K  A GPG+E      +K T F + T   G +   V     +  T + L  E + N   +  YKP   G H + +
Sbjct:  324 SVEYVPKVTGMHKVTVLFAGQHIAKSPFEVNVEKA---QGDASKVTAKGPGLEPIGNIANKPTYFDIYTAGIGDIGIEVIDPQGRNNT-VELALEDKGNCVYRCTYKPIKAGPHNVAI 437          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Xenopus
Match: FLNB (filamin B [Source:NCBI gene;Acc:100485165])

HSP 1 Score: 80.8777 bits (198), Expect = 2.149e-18
Identity = 47/119 (39.50%), Postives = 64/119 (53.78%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCY--DKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y P+ PGEY++ ++C+D DIQNSP+M  I PA  D  D  K KA+GPG+E     V     F VD  D G    A  K Y  D  G P+ + ++ +P+GT    Y P    +H + V
Sbjct:  607 VRYWPKEPGEYAIHIMCDDEDIQNSPYMALIQPASGD-IDPDKVKAYGPGLEKTGCIVSTPAEFAVDPTDAG---KAALKIYSQDVEGNPVDIMTKEKPDGTYACSYTPAKPIKHTVAV 721          

HSP 2 Score: 52.7582 bits (125), Expect = 1.468e-8
Identity = 38/118 (32.20%), Postives = 53/118 (44.92%), Query Frame = 3
Query:    9 QVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
             VEY P + G+Y V +  +   I  SPF VP+     D  D +K K  GPG+ +  +       FTVDT   G + P   +    RGT  P+      +GT    Y P  EG + + V
Sbjct: 1385 SVEYTPYVTGDYDVNITYDGEHIPGSPFRVPVK----DVVDPSKVKISGPGLGTA-VRAKIPQQFTVDTSKAG-IAPLAVQVTGPRGTVEPVDLVDNGDGTHTVSYTPTLEGPYTVAV 1496          

HSP 3 Score: 52.7582 bits (125), Expect = 1.511e-8
Identity = 35/117 (29.91%), Postives = 53/117 (45.30%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y P L G Y+V V   D +I  SPF V + P      D +K  A GPG+ ++ +       F VD ++ G + P   +  D+ G P   + +   +GT    Y P   G + + V
Sbjct: 1482 VSYTPTLEGPYTVAVQYADEEIPRSPFKVKVLPTY----DASKVTASGPGLCAQGISASLPVNFAVDAKNAG-LGPLSVQITDQEGKPKKAQIQDNNDGTYSVSYIPDRTGRYHVAV 1593          

HSP 4 Score: 45.0542 bits (105), Expect = 6.049e-6
Identity = 24/72 (33.33%), Postives = 39/72 (54.17%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCG 227
            V+Y+P   G Y+++VL    +I  SPF + + P+     D +K +A GPG+    +   K + FTV T+  G
Sbjct:  810 VKYMPPAAGRYTIKVLFAGEEIPESPFRIKVDPS----HDASKVRAEGPGLSKSGVENGKPSHFTVYTKGAG 877          

HSP 5 Score: 45.0542 bits (105), Expect = 7.129e-6
Identity = 37/121 (30.58%), Postives = 52/121 (42.98%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVD----TRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y+P   G Y++ +      +   P  V + PA+    D +K K FGPGIE K +  +  T FTVD    T+  G  V    K  +  G           +GT    Y P  +G H I+V
Sbjct: 1193 VTYVPLFAGMYTLALKYGGEQVPKFPARVKVDPAV----DTSKIKVFGPGIEEKGVFREATTDFTVDAKSLTKTGGNHVK--TKITNPSGASTDYLLRDNGDGTYYVEYTPFEKGAHAIKV 1307          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Xenopus
Match: FLNB (filamin B [Source:NCBI gene;Acc:100485165])

HSP 1 Score: 80.8777 bits (198), Expect = 2.149e-18
Identity = 47/119 (39.50%), Postives = 64/119 (53.78%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCY--DKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y P+ PGEY++ ++C+D DIQNSP+M  I PA  D  D  K KA+GPG+E     V     F VD  D G    A  K Y  D  G P+ + ++ +P+GT    Y P    +H + V
Sbjct:  607 VRYWPKEPGEYAIHIMCDDEDIQNSPYMALIQPASGD-IDPDKVKAYGPGLEKTGCIVSTPAEFAVDPTDAG---KAALKIYSQDVEGNPVDIMTKEKPDGTYACSYTPAKPIKHTVAV 721          

HSP 2 Score: 52.7582 bits (125), Expect = 1.556e-8
Identity = 35/117 (29.91%), Postives = 53/117 (45.30%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y P L G Y+V V   D +I  SPF V + P      D +K  A GPG+ ++ +       F VD ++ G + P   +  D+ G P   + +   +GT    Y P   G + + V
Sbjct: 1512 VSYTPTLEGPYTVAVQYADEEIPRSPFKVKVLPTY----DASKVTASGPGLCAQGISASLPVNFAVDAKNAG-LGPLSVQITDQEGKPKKAQIQDNNDGTYSVSYIPDRTGRYHVAV 1623          

HSP 3 Score: 45.4394 bits (106), Expect = 5.876e-6
Identity = 24/72 (33.33%), Postives = 39/72 (54.17%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCG 227
            V+Y+P   G Y+++VL    +I  SPF + + P+     D +K +A GPG+    +   K + FTV T+  G
Sbjct:  810 VKYMPPAAGRYTIKVLFAGEEIPESPFRIKVDPS----HDASKVRAEGPGLSKSGVENGKPSHFTVYTKGAG 877          

HSP 4 Score: 45.0542 bits (105), Expect = 7.778e-6
Identity = 37/121 (30.58%), Postives = 52/121 (42.98%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVD----TRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y+P   G Y++ +      +   P  V + PA+    D +K K FGPGIE K +  +  T FTVD    T+  G  V    K  +  G           +GT    Y P  +G H I+V
Sbjct: 1193 VTYVPLFAGMYTLALKYGGEQVPKFPARVKVDPAV----DTSKIKVFGPGIEEKGVFREATTDFTVDAKSLTKTGGNHVK--TKITNPSGASTDYLLRDNGDGTYYVEYTPFEKGAHAIKV 1307          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Xenopus
Match: FLNB (filamin B [Source:NCBI gene;Acc:100485165])

HSP 1 Score: 80.8777 bits (198), Expect = 2.168e-18
Identity = 47/119 (39.50%), Postives = 64/119 (53.78%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCY--DKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y P+ PGEY++ ++C+D DIQNSP+M  I PA  D  D  K KA+GPG+E     V     F VD  D G    A  K Y  D  G P+ + ++ +P+GT    Y P    +H + V
Sbjct:  607 VRYWPKEPGEYAIHIMCDDEDIQNSPYMALIQPASGD-IDPDKVKAYGPGLEKTGCIVSTPAEFAVDPTDAG---KAALKIYSQDVEGNPVDIMTKEKPDGTYACSYTPAKPIKHTVAV 721          

HSP 2 Score: 52.7582 bits (125), Expect = 1.397e-8
Identity = 38/118 (32.20%), Postives = 53/118 (44.92%), Query Frame = 3
Query:    9 QVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
             VEY P + G+Y V +  +   I  SPF VP+     D  D +K K  GPG+ +  +       FTVDT   G + P   +    RGT  P+      +GT    Y P  EG + + V
Sbjct: 1385 SVEYTPYVTGDYDVNITYDGEHIPGSPFRVPVK----DVVDPSKVKISGPGLGTA-VRAKIPQQFTVDTSKAG-IAPLAVQVTGPRGTVEPVDLVDNGDGTHTVSYTPTLEGPYTVAV 1496          

HSP 3 Score: 52.7582 bits (125), Expect = 1.570e-8
Identity = 35/117 (29.91%), Postives = 53/117 (45.30%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y P L G Y+V V   D +I  SPF V + P      D +K  A GPG+ ++ +       F VD ++ G + P   +  D+ G P   + +   +GT    Y P   G + + V
Sbjct: 1482 VSYTPTLEGPYTVAVQYADEEIPRSPFKVKVLPTY----DASKVTASGPGLCAQGISASLPVNFAVDAKNAG-LGPLSVQITDQEGKPKKAQIQDNNDGTYSVSYIPDRTGRYHVAV 1593          

HSP 4 Score: 45.4394 bits (106), Expect = 5.649e-6
Identity = 24/72 (33.33%), Postives = 39/72 (54.17%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCG 227
            V+Y+P   G Y+++VL    +I  SPF + + P+     D +K +A GPG+    +   K + FTV T+  G
Sbjct:  810 VKYMPPAAGRYTIKVLFAGEEIPESPFRIKVDPS----HDASKVRAEGPGLSKSGVENGKPSHFTVYTKGAG 877          

HSP 5 Score: 45.0542 bits (105), Expect = 7.772e-6
Identity = 37/121 (30.58%), Postives = 52/121 (42.98%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVD----TRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y+P   G Y++ +      +   P  V + PA+    D +K K FGPGIE K +  +  T FTVD    T+  G  V    K  +  G           +GT    Y P  +G H I+V
Sbjct: 1193 VTYVPLFAGMYTLALKYGGEQVPKFPARVKVDPAV----DTSKIKVFGPGIEEKGVFREATTDFTVDAKSLTKTGGNHVK--TKITNPSGASTDYLLRDNGDGTYYVEYTPFEKGAHAIKV 1307          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Mouse
Match: Flnc (filamin C, gamma [Source:MGI Symbol;Acc:MGI:95557])

HSP 1 Score: 74.7146 bits (182), Expect = 2.415e-16
Identity = 49/119 (41.18%), Postives = 63/119 (52.94%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCY--DKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y P  PGEY+V V+C+D DI++SPF+  I PA  D C   K KAFGPG+E     VD+   FT+D R  G       K Y  D  G P+ +K     +GT +  Y P    +H I V
Sbjct:  629 VRYWPTEPGEYAVHVICDDEDIRDSPFIAHIQPAPPD-CFPDKVKAFGPGLEPTGCIVDRPAEFTIDARAAG---KGDLKLYAQDADGCPIDIKVIPNGDGTFRCSYVPTKPIKHTIIV 743          

HSP 2 Score: 56.225 bits (134), Expect = 6.134e-10
Identity = 35/117 (29.91%), Postives = 52/117 (44.44%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y P   G Y+V V   D ++  SPF + + P+     D +K +A GPG+ +  +P      FT+D RD G  +  V +  D  G P         +GT    Y P   G + I +
Sbjct: 1504 VHYTPATDGPYTVAVKYADQEVPRSPFKIKVLPSH----DASKVRASGPGLNASGIPASLPVEFTIDARDAGQGLLTV-QILDPEGKPKKANIRDNGDGTYTVSYLPDMSGRYTITI 1615          

HSP 3 Score: 54.299 bits (129), Expect = 3.444e-9
Identity = 36/117 (30.77%), Postives = 52/117 (44.44%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V YLP  PGEY++ +L  ++ I  SPF   I P      D +K +A GPG+E       +  TFTVD  + G     +    D  G    +  +   +GT    Y P   G + I +
Sbjct: 1120 VSYLPTEPGEYTINILFAEAHIPGSPFKATIQPVF----DPSKVRASGPGLERG--KAGEAATFTVDCSEAGEAELTIEILSDA-GVKAEVLIQNNADGTYHITYSPAFPGTYTITI 1229          

HSP 4 Score: 47.7506 bits (112), Expect = 5.354e-7
Identity = 36/117 (30.77%), Postives = 50/117 (42.74%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            VEY+P  PG+Y V +      I  SPF VP+     D  D  K K  GPG+ +  +      TFTVD    G   P         G   P++     +GT    Y P ++G + + V
Sbjct: 1408 VEYIPFTPGDYDVNITFGGQPIPGSPFRVPVK----DVVDPGKVKCSGPGLGTG-VRARVPQTFTVDCSQAG-RAPLQVAVLGPTGVAEPVEVRDNGDGTHTVHYTPATDGPYTVAV 1518          

HSP 5 Score: 47.3654 bits (111), Expect = 9.476e-7
Identity = 37/119 (31.09%), Postives = 56/119 (47.06%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGP--VVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y+P++ G + V VL    +I+ SPF V +  AL    D  K  A GPG+E      +K T F + T   G   V   +     +R T + +  E + + T +  Y+P  EG H + V
Sbjct:  339 VSYVPKVAGLHKVTVLFAGQNIERSPFEVNVGMAL---GDANKVSARGPGLEPVGNVANKPTYFDIYTAGAGTGDVAVVIVDPQGRRDT-VEVALEDKGDNTFRCTYRPVMEGPHTVHV 453          

HSP 6 Score: 46.595 bits (109), Expect = 1.409e-6
Identity = 27/72 (37.50%), Postives = 39/72 (54.17%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCG 227
            V+Y P   G Y++ VL  + +I  SPF + + P+     D +K KA GPG+    + V K T FTV T+  G
Sbjct:  832 VKYTPPGAGHYTIMVLFANQEIPASPFHIKVDPSH----DASKVKAEGPGLSRTGVEVGKPTHFTVLTKGAG 899          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Mouse
Match: Flnc (filamin C, gamma [Source:MGI Symbol;Acc:MGI:95557])

HSP 1 Score: 74.3294 bits (181), Expect = 2.793e-16
Identity = 49/119 (41.18%), Postives = 63/119 (52.94%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCY--DKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y P  PGEY+V V+C+D DI++SPF+  I PA  D C   K KAFGPG+E     VD+   FT+D R  G       K Y  D  G P+ +K     +GT +  Y P    +H I V
Sbjct:  629 VRYWPTEPGEYAVHVICDDEDIRDSPFIAHIQPAPPD-CFPDKVKAFGPGLEPTGCIVDRPAEFTIDARAAG---KGDLKLYAQDADGCPIDIKVIPNGDGTFRCSYVPTKPIKHTIIV 743          

HSP 2 Score: 56.225 bits (134), Expect = 6.073e-10
Identity = 35/117 (29.91%), Postives = 52/117 (44.44%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y P   G Y+V V   D ++  SPF + + P+     D +K +A GPG+ +  +P      FT+D RD G  +  V +  D  G P         +GT    Y P   G + I +
Sbjct: 1504 VHYTPATDGPYTVAVKYADQEVPRSPFKIKVLPSH----DASKVRASGPGLNASGIPASLPVEFTIDARDAGQGLLTV-QILDPEGKPKKANIRDNGDGTYTVSYLPDMSGRYTITI 1615          

HSP 3 Score: 54.299 bits (129), Expect = 3.377e-9
Identity = 36/117 (30.77%), Postives = 52/117 (44.44%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V YLP  PGEY++ +L  ++ I  SPF   I P      D +K +A GPG+E       +  TFTVD  + G     +    D  G    +  +   +GT    Y P   G + I +
Sbjct: 1120 VSYLPTEPGEYTINILFAEAHIPGSPFKATIQPVF----DPSKVRASGPGLERG--KAGEAATFTVDCSEAGEAELTIEILSDA-GVKAEVLIQNNADGTYHITYSPAFPGTYTITI 1229          

HSP 4 Score: 47.7506 bits (112), Expect = 6.070e-7
Identity = 36/117 (30.77%), Postives = 50/117 (42.74%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            VEY+P  PG+Y V +      I  SPF VP+     D  D  K K  GPG+ +  +      TFTVD    G   P         G   P++     +GT    Y P ++G + + V
Sbjct: 1408 VEYIPFTPGDYDVNITFGGQPIPGSPFRVPVK----DVVDPGKVKCSGPGLGTG-VRARVPQTFTVDCSQAGR-APLQVAVLGPTGVAEPVEVRDNGDGTHTVHYTPATDGPYTVAV 1518          

HSP 5 Score: 47.3654 bits (111), Expect = 9.382e-7
Identity = 37/119 (31.09%), Postives = 56/119 (47.06%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGP--VVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y+P++ G + V VL    +I+ SPF V +  AL    D  K  A GPG+E      +K T F + T   G   V   +     +R T + +  E + + T +  Y+P  EG H + V
Sbjct:  339 VSYVPKVAGLHKVTVLFAGQNIERSPFEVNVGMAL---GDANKVSARGPGLEPVGNVANKPTYFDIYTAGAGTGDVAVVIVDPQGRRDT-VEVALEDKGDNTFRCTYRPVMEGPHTVHV 453          

HSP 6 Score: 46.595 bits (109), Expect = 1.368e-6
Identity = 27/72 (37.50%), Postives = 39/72 (54.17%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCG 227
            V+Y P   G Y++ VL  + +I  SPF + + P+     D +K KA GPG+    + V K T FTV T+  G
Sbjct:  832 VKYTPPGAGHYTIMVLFANQEIPASPFHIKVDPSH----DASKVKAEGPGLSRTGVEVGKPTHFTVLTKGAG 899          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Mouse
Match: Flnb (filamin, beta [Source:MGI Symbol;Acc:MGI:2446089])

HSP 1 Score: 73.559 bits (179), Expect = 5.094e-16
Identity = 42/118 (35.59%), Postives = 65/118 (55.08%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKC-DLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V+Y P+ PGEY+V ++C+D DI++SP+M  I PA  D   DL   +A+GPG+E     ++    F VD +D G   P      D  G P+ ++ +++ +GT    Y P    +H I V
Sbjct:  606 VKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGDYNPDLV--QAYGPGLEKSGCTINNPAEFIVDPKDAGS-APLKILAQDGEGQPIDIQMKSRMDGTYACSYTPLKAIKHTIAV 720          

HSP 2 Score: 55.8398 bits (133), Expect = 1.014e-9
Identity = 38/117 (32.48%), Postives = 51/117 (43.59%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y P   G Y V V   D +I  SPF V + P      D +K  A GPG+ +  +P      F +D RD G  + AV +  D+ G P         +GT    Y P   G ++I V
Sbjct: 1481 VTYTPSQEGPYIVSVKYADEEIPRSPFKVKVLPTY----DASKVTASGPGLSAYGVPASLPVEFAIDARDAGEGLLAV-QITDQEGKPQRATVHDNKDGTYAVTYIPDKTGRYMIGV 1592          

HSP 3 Score: 51.6026 bits (122), Expect = 2.736e-8
Identity = 38/121 (31.40%), Postives = 53/121 (43.80%), Query Frame = 3
Query:    9 QVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIES---KPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
              EY+P  PG+Y V +      I  SPF VP      D  D +K K  GPG+ S     +P     +FTVD+   G + P   +    RG   P+      +GT    Y P  EG +++ V
Sbjct: 1384 SAEYIPFAPGDYDVNITYGGVHIPGSPFRVPSK----DVVDPSKVKIAGPGLSSCVRACIP----QSFTVDSSKAG-LAPLEVRVLGPRGLVEPVNVVDNGDGTHTVTYTPSQEGPYIVSV 1495          

HSP 4 Score: 50.447 bits (119), Expect = 7.493e-8
Identity = 28/72 (38.89%), Postives = 40/72 (55.56%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCG 227
            V+Y+P  PG Y+++VL    +I  SPF V + P+     D +K KA GPG+    +   K T FTV T+  G
Sbjct:  809 VKYVPPAPGRYTIKVLFASQEIPASPFRVKVDPS----HDASKVKAEGPGLSKAGVENGKPTHFTVHTKGAG 876          

HSP 5 Score: 49.6766 bits (117), Expect = 1.136e-7
Identity = 41/119 (34.45%), Postives = 58/119 (48.74%), Query Frame = 3
Query:    9 QVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRG-TPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
             VEYLP++ G + V VL     I  SPF V +  A   + D +K  A GPG+E+     +K T F + T   G V     +  D +G   + L  E + N   + VYKP   G HV++V
Sbjct:  316 SVEYLPKVTGLHKVIVLFAGQHISKSPFEVNVDKA---QGDASKVTAKGPGLETTGNIANKPTYFDIYTAGAG-VGDIGIEVEDPQGKNSVELLVEDRGNQVYRCVYKPVQPGPHVVKV 430          

HSP 6 Score: 48.9062 bits (115), Expect = 2.282e-7
Identity = 37/119 (31.09%), Postives = 56/119 (47.06%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVP--AVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y+P   G Y++ +      + + P  V + PA+    D +  KAFGPGIE K +  +  T FTVD+R    V      A+  +  G       +   +GT Q  Y P  +G HV++V
Sbjct: 1192 VTYVPLTAGMYTLTMKYGGELVPHFPAWVKVEPAI----DTSGIKAFGPGIEGKDVFREATTDFTVDSRPLTQVGGDHIKAQITNPSGASTECFVKDNADGTYQVEYTPFEKGFHVVEV 1306          

HSP 7 Score: 44.2838 bits (103), Expect = 9.926e-6
Identity = 32/118 (27.12%), Postives = 54/118 (45.76%), Query Frame = 3
Query:   15 EYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDT--RDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            EY P  PG+YSV V      I  SPF V + P    +  + K +A+GPG+      V +   F V++   + G +  A+      +     ++ + Q +G+    Y PK  GE+ + +
Sbjct:  514 EYYPSTPGKYSVAVTWGGHHIPKSPFEVQVGP----EAGMQKVRAWGPGLHGG--IVGRSADFVVESIGSEVGTLGFAIEGPSQAK-----IEYDDQNDGSCDVKYWPKEPGEYAVHI 620          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Mouse
Match: Flna (filamin, alpha [Source:MGI Symbol;Acc:MGI:95556])

HSP 1 Score: 67.3958 bits (163), Expect = 7.053e-14
Identity = 43/117 (36.75%), Postives = 56/117 (47.86%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y P+  GEY+V VLCN  DI+ SPFM  I  A  D     + KA GPG+E   + V+K   FTVD +  G   P   +  D  G  +    +   NGT    Y P+   +H   V
Sbjct:  633 VRYWPQEAGEYAVHVLCNSEDIRLSPFMADIREAPQD-FHPDRVKARGPGLEKTGVAVNKPAEFTVDAKHAGK-APLRVQVQDNEGCSVEATVKDNGNGTYSCSYVPRKPVKHTAMV 747          

HSP 2 Score: 59.6918 bits (143), Expect = 3.682e-11
Identity = 37/117 (31.62%), Postives = 55/117 (47.01%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y+P   G YS+ VL  + ++  SPF V + P      D +K KA GPG+ +  +P      FT+D +D G  + AV +  D  G P     +   +GT    Y P   G + I +
Sbjct: 1509 VNYVPSREGSYSISVLYGEEEVPRSPFKVKVLPTH----DASKVKASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAV-QITDPEGKPKKTHIQDNHDGTYTVAYVPDVPGRYTILI 1620          

HSP 3 Score: 55.8398 bits (133), Expect = 8.199e-10
Identity = 39/117 (33.33%), Postives = 52/117 (44.44%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            VEY+P   G YS+ V      +  SPF VP+     D  D +K K  GPG+    +  +   +F VDT   G V P   K    +G   P+      +GTQ   Y P  EG + I V
Sbjct: 1412 VEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVH----DVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAG-VAPLQVKVQGPKGLVEPVDVVDNADGTQTVNYVPSREGSYSISV 1523          

HSP 4 Score: 49.2914 bits (116), Expect = 1.955e-7
Identity = 32/117 (27.35%), Postives = 50/117 (42.74%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y+P  PG+Y++ +L  D+ I  SPF   + P      D +K K  GPG+E       +   F VD    G     +  C  + G P  +  +   +GT    Y P   G + + +
Sbjct: 1124 VSYVPTEPGDYNINILFADTHIPGSPFKAHVAPCF----DASKVKCSGPGLERA--TAGEVGQFQVDCSSAGSAELTIEIC-SEAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTI 1233          

HSP 5 Score: 46.2098 bits (108), Expect = 2.155e-6
Identity = 37/119 (31.09%), Postives = 56/119 (47.06%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDC--GPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y+PE+ G + V VL     I  SPF V +  +   + D +K  A GPG+E      +K T F + T     G V   +     ++GT  P + E + + T +  Y+P  EG H + V
Sbjct:  344 VWYVPEVTGTHKVTVLFAGQHIAKSPFEVYVDKS---QGDASKVTAQGPGLEPSGNIANKTTYFEIFTAGAGMGEVEVVIQDPTGQKGTVEP-QLEARGDSTYRCSYQPTMEGVHTVHV 458          

HSP 6 Score: 45.4394 bits (106), Expect = 3.776e-6
Identity = 34/121 (28.10%), Postives = 55/121 (45.45%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDC----GPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            + Y+P  PG Y+V +      + N P  + + PA+    D +  + +GPGIE + +  +  T F+VD R      GP V   A+  +  G       +   +GT +  Y P  EG H + V
Sbjct: 1219 ITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAV----DTSGVQCYGPGIEGQGVFREATTEFSVDARALTQTGGPHVK--ARVANPSGNLTDTYVQDCGDGTYKVEYTPYEEGVHSVDV 1333          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Mouse
Match: Flna (filamin, alpha [Source:MGI Symbol;Acc:MGI:95556])

HSP 1 Score: 67.3958 bits (163), Expect = 7.191e-14
Identity = 43/117 (36.75%), Postives = 56/117 (47.86%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y P+  GEY+V VLCN  DI+ SPFM  I  A  D     + KA GPG+E   + V+K   FTVD +  G   P   +  D  G  +    +   NGT    Y P+   +H   V
Sbjct:  633 VRYWPQEAGEYAVHVLCNSEDIRLSPFMADIREAPQD-FHPDRVKARGPGLEKTGVAVNKPAEFTVDAKHAGK-APLRVQVQDNEGCSVEATVKDNGNGTYSCSYVPRKPVKHTAMV 747          

HSP 2 Score: 59.6918 bits (143), Expect = 3.791e-11
Identity = 37/117 (31.62%), Postives = 55/117 (47.01%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y+P   G YS+ VL  + ++  SPF V + P      D +K KA GPG+ +  +P      FT+D +D G  + AV +  D  G P     +   +GT    Y P   G + I +
Sbjct: 1509 VNYVPSREGSYSISVLYGEEEVPRSPFKVKVLPTH----DASKVKASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAV-QITDPEGKPKKTHIQDNHDGTYTVAYVPDVPGRYTILI 1620          

HSP 3 Score: 55.8398 bits (133), Expect = 8.605e-10
Identity = 39/117 (33.33%), Postives = 52/117 (44.44%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            VEY+P   G YS+ V      +  SPF VP+     D  D +K K  GPG+    +  +   +F VDT   G V P   K    +G   P+      +GTQ   Y P  EG + I V
Sbjct: 1412 VEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVH----DVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAG-VAPLQVKVQGPKGLVEPVDVVDNADGTQTVNYVPSREGSYSISV 1523          

HSP 4 Score: 49.2914 bits (116), Expect = 2.032e-7
Identity = 32/117 (27.35%), Postives = 50/117 (42.74%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y+P  PG+Y++ +L  D+ I  SPF   + P      D +K K  GPG+E       +   F VD    G     +  C  + G P  +  +   +GT    Y P   G + + +
Sbjct: 1124 VSYVPTEPGDYNINILFADTHIPGSPFKAHVAPCF----DASKVKCSGPGLERA--TAGEVGQFQVDCSSAGSAELTIEIC-SEAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTI 1233          

HSP 5 Score: 46.2098 bits (108), Expect = 2.262e-6
Identity = 37/119 (31.09%), Postives = 56/119 (47.06%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDC--GPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y+PE+ G + V VL     I  SPF V +  +   + D +K  A GPG+E      +K T F + T     G V   +     ++GT  P + E + + T +  Y+P  EG H + V
Sbjct:  344 VWYVPEVTGTHKVTVLFAGQHIAKSPFEVYVDKS---QGDASKVTAQGPGLEPSGNIANKTTYFEIFTAGAGMGEVEVVIQDPTGQKGTVEP-QLEARGDSTYRCSYQPTMEGVHTVHV 458          

HSP 6 Score: 45.4394 bits (106), Expect = 3.850e-6
Identity = 34/121 (28.10%), Postives = 55/121 (45.45%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDC----GPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            + Y+P  PG Y+V +      + N P  + + PA+    D +  + +GPGIE + +  +  T F+VD R      GP V   A+  +  G       +   +GT +  Y P  EG H + V
Sbjct: 1219 ITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAV----DTSGVQCYGPGIEGQGVFREATTEFSVDARALTQTGGPHVK--ARVANPSGNLTDTYVQDCGDGTYKVEYTPYEEGVHSVDV 1333          
BLAST of Calponin-homology (CH) domain-containing protein vs. UniProt/SwissProt
Match: sp|Q14315|FLNC_HUMAN (Filamin-C OS=Homo sapiens OX=9606 GN=FLNC PE=1 SV=3)

HSP 1 Score: 74.7146 bits (182), Expect = 1.446e-15
Identity = 49/119 (41.18%), Postives = 63/119 (52.94%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCY--DKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y P  PGEY+V V+C+D DI++SPF+  I PA  D C   K KAFGPG+E     VDK   FT+D R  G       K Y  D  G P+ +K     +GT +  Y P    +H I +
Sbjct:  628 VRYWPTEPGEYAVHVICDDEDIRDSPFIAHILPAPPD-CFPDKVKAFGPGLEPTGCIVDKPAEFTIDARAAG---KGDLKLYAQDADGCPIDIKVIPNGDGTFRCSYVPTKPIKHTIII 742          

HSP 2 Score: 57.7658 bits (138), Expect = 1.535e-9
Identity = 36/117 (30.77%), Postives = 52/117 (44.44%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y P   G Y+V V   D ++  SPF + + PA     D +K +A GPG+ +  +P      FT+D RD G  +  V +  D  G P         +GT    Y P   G + I +
Sbjct: 1503 VHYTPATDGPYTVAVKYADQEVPRSPFKIKVLPAH----DASKVRASGPGLNASGIPASLPVEFTIDARDAGEGLLTV-QILDPEGKPKKANIRDNGDGTYTVSYLPDMSGRYTITI 1614          

HSP 3 Score: 55.0694 bits (131), Expect = 1.037e-8
Identity = 37/117 (31.62%), Postives = 52/117 (44.44%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V YLP  PGEY++ +L  ++ I  SPF   I P      D +K +A GPG+E     V +  TFTVD  + G     +    D  G    +      +GT    Y P   G + I +
Sbjct: 1119 VSYLPTEPGEYTINILFAEAHIPGSPFKATIRPVF----DPSKVRASGPGLERG--KVGEAATFTVDCSEAGEAELTIEILSDA-GVKAEVLIHNNADGTYHITYSPAFPGTYTITI 1228          

HSP 4 Score: 47.7506 bits (112), Expect = 3.893e-6
Identity = 37/119 (31.09%), Postives = 56/119 (47.06%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGP--VVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y+P++ G + V VL    +I+ SPF V +  AL    D  K  A GPG+E      +K T F + T   G   V   +     +R T + +  E + + T +  Y+P  EG H + V
Sbjct:  338 VSYVPKVAGLHKVTVLFAGQNIERSPFEVNVGMAL---GDANKVSARGPGLEPVGNVANKPTYFDIYTAGAGTGDVAVVIVDPQGRRDT-VEVALEDKGDSTFRCTYRPAMEGPHTVHV 452          

HSP 5 Score: 47.7506 bits (112), Expect = 3.931e-6
Identity = 36/117 (30.77%), Postives = 50/117 (42.74%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            VEY+P  PG+Y V +      I  SPF VP+     D  D  K K  GPG+ +  +      TFTVD    G   P         G   P++     +GT    Y P ++G + + V
Sbjct: 1407 VEYIPFTPGDYDVNITFGGRPIPGSPFRVPVK----DVVDPGKVKCSGPGLGAG-VRARVPQTFTVDCSQAG-RAPLQVAVLGPTGVAEPVEVRDNGDGTHTVHYTPATDGPYTVAV 1517          
BLAST of Calponin-homology (CH) domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8VHX6|FLNC_MOUSE (Filamin-C OS=Mus musculus OX=10090 GN=Flnc PE=1 SV=3)

HSP 1 Score: 74.7146 bits (182), Expect = 1.689e-15
Identity = 49/119 (41.18%), Postives = 63/119 (52.94%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCY--DKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y P  PGEY+V V+C+D DI++SPF+  I PA  D C   K KAFGPG+E     VD+   FT+D R  G       K Y  D  G P+ +K     +GT +  Y P    +H I V
Sbjct:  629 VRYWPTEPGEYAVHVICDDEDIRDSPFIAHIQPAPPD-CFPDKVKAFGPGLEPTGCIVDRPAEFTIDARAAG---KGDLKLYAQDADGCPIDIKVIPNGDGTFRCSYVPTKPIKHTIIV 743          

HSP 2 Score: 56.225 bits (134), Expect = 4.291e-9
Identity = 35/117 (29.91%), Postives = 52/117 (44.44%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y P   G Y+V V   D ++  SPF + + P+     D +K +A GPG+ +  +P      FT+D RD G  +  V +  D  G P         +GT    Y P   G + I +
Sbjct: 1504 VHYTPATDGPYTVAVKYADQEVPRSPFKIKVLPSH----DASKVRASGPGLNASGIPASLPVEFTIDARDAGQGLLTV-QILDPEGKPKKANIRDNGDGTYTVSYLPDMSGRYTITI 1615          

HSP 3 Score: 54.299 bits (129), Expect = 2.409e-8
Identity = 36/117 (30.77%), Postives = 52/117 (44.44%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V YLP  PGEY++ +L  ++ I  SPF   I P      D +K +A GPG+E       +  TFTVD  + G     +    D  G    +  +   +GT    Y P   G + I +
Sbjct: 1120 VSYLPTEPGEYTINILFAEAHIPGSPFKATIQPVF----DPSKVRASGPGLERG--KAGEAATFTVDCSEAGEAELTIEILSDA-GVKAEVLIQNNADGTYHITYSPAFPGTYTITI 1229          

HSP 4 Score: 47.7506 bits (112), Expect = 3.745e-6
Identity = 36/117 (30.77%), Postives = 50/117 (42.74%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            VEY+P  PG+Y V +      I  SPF VP+     D  D  K K  GPG+ +  +      TFTVD    G   P         G   P++     +GT    Y P ++G + + V
Sbjct: 1408 VEYIPFTPGDYDVNITFGGQPIPGSPFRVPVK----DVVDPGKVKCSGPGLGTG-VRARVPQTFTVDCSQAG-RAPLQVAVLGPTGVAEPVEVRDNGDGTHTVHYTPATDGPYTVAV 1518          

HSP 5 Score: 47.3654 bits (111), Expect = 6.629e-6
Identity = 37/119 (31.09%), Postives = 56/119 (47.06%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGP--VVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y+P++ G + V VL    +I+ SPF V +  AL    D  K  A GPG+E      +K T F + T   G   V   +     +R T + +  E + + T +  Y+P  EG H + V
Sbjct:  339 VSYVPKVAGLHKVTVLFAGQNIERSPFEVNVGMAL---GDANKVSARGPGLEPVGNVANKPTYFDIYTAGAGTGDVAVVIVDPQGRRDT-VEVALEDKGDNTFRCTYRPVMEGPHTVHV 453          

HSP 6 Score: 46.595 bits (109), Expect = 9.856e-6
Identity = 27/72 (37.50%), Postives = 39/72 (54.17%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCG 227
            V+Y P   G Y++ VL  + +I  SPF + + P+     D +K KA GPG+    + V K T FTV T+  G
Sbjct:  832 VKYTPPGAGHYTIMVLFANQEIPASPFHIKVDPSH----DASKVKAEGPGLSRTGVEVGKPTHFTVLTKGAG 899          
BLAST of Calponin-homology (CH) domain-containing protein vs. UniProt/SwissProt
Match: sp|Q80X90|FLNB_MOUSE (Filamin-B OS=Mus musculus OX=10090 GN=Flnb PE=1 SV=3)

HSP 1 Score: 73.559 bits (179), Expect = 3.563e-15
Identity = 42/118 (35.59%), Postives = 65/118 (55.08%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKC-DLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V+Y P+ PGEY+V ++C+D DI++SP+M  I PA  D   DL   +A+GPG+E     ++    F VD +D G   P      D  G P+ ++ +++ +GT    Y P    +H I V
Sbjct:  606 VKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGDYNPDLV--QAYGPGLEKSGCTINNPAEFIVDPKDAGS-APLKILAQDGEGQPIDIQMKSRMDGTYACSYTPLKAIKHTIAV 720          

HSP 2 Score: 55.8398 bits (133), Expect = 7.095e-9
Identity = 38/117 (32.48%), Postives = 51/117 (43.59%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y P   G Y V V   D +I  SPF V + P      D +K  A GPG+ +  +P      F +D RD G  + AV +  D+ G P         +GT    Y P   G ++I V
Sbjct: 1481 VTYTPSQEGPYIVSVKYADEEIPRSPFKVKVLPTY----DASKVTASGPGLSAYGVPASLPVEFAIDARDAGEGLLAV-QITDQEGKPQRATVHDNKDGTYAVTYIPDKTGRYMIGV 1592          

HSP 3 Score: 51.6026 bits (122), Expect = 1.914e-7
Identity = 38/121 (31.40%), Postives = 53/121 (43.80%), Query Frame = 3
Query:    9 QVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIES---KPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
              EY+P  PG+Y V +      I  SPF VP      D  D +K K  GPG+ S     +P     +FTVD+   G + P   +    RG   P+      +GT    Y P  EG +++ V
Sbjct: 1384 SAEYIPFAPGDYDVNITYGGVHIPGSPFRVPSK----DVVDPSKVKIAGPGLSSCVRACIP----QSFTVDSSKAG-LAPLEVRVLGPRGLVEPVNVVDNGDGTHTVTYTPSQEGPYIVSV 1495          

HSP 4 Score: 50.447 bits (119), Expect = 5.241e-7
Identity = 28/72 (38.89%), Postives = 40/72 (55.56%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCG 227
            V+Y+P  PG Y+++VL    +I  SPF V + P+     D +K KA GPG+    +   K T FTV T+  G
Sbjct:  809 VKYVPPAPGRYTIKVLFASQEIPASPFRVKVDPS----HDASKVKAEGPGLSKAGVENGKPTHFTVHTKGAG 876          

HSP 5 Score: 49.6766 bits (117), Expect = 7.948e-7
Identity = 41/119 (34.45%), Postives = 58/119 (48.74%), Query Frame = 3
Query:    9 QVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRG-TPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
             VEYLP++ G + V VL     I  SPF V +  A   + D +K  A GPG+E+     +K T F + T   G V     +  D +G   + L  E + N   + VYKP   G HV++V
Sbjct:  316 SVEYLPKVTGLHKVIVLFAGQHISKSPFEVNVDKA---QGDASKVTAKGPGLETTGNIANKPTYFDIYTAGAG-VGDIGIEVEDPQGKNSVELLVEDRGNQVYRCVYKPVQPGPHVVKV 430          

HSP 6 Score: 48.9062 bits (115), Expect = 1.596e-6
Identity = 37/119 (31.09%), Postives = 56/119 (47.06%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVP--AVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y+P   G Y++ +      + + P  V + PA+    D +  KAFGPGIE K +  +  T FTVD+R    V      A+  +  G       +   +GT Q  Y P  +G HV++V
Sbjct: 1192 VTYVPLTAGMYTLTMKYGGELVPHFPAWVKVEPAI----DTSGIKAFGPGIEGKDVFREATTDFTVDSRPLTQVGGDHIKAQITNPSGASTECFVKDNADGTYQVEYTPFEKGFHVVEV 1306          
BLAST of Calponin-homology (CH) domain-containing protein vs. UniProt/SwissProt
Match: sp|D3ZHA0|FLNC_RAT (Filamin-C OS=Rattus norvegicus OX=10116 GN=Flnc PE=1 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 4.248e-15
Identity = 47/119 (39.50%), Postives = 63/119 (52.94%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCY--DKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y P  PGEY+V V+C+D DI++SPF+  I PA  D C   K KAFGPG+E     VD+   FT+D R  G       K Y  D  G P+ +K     +GT +  Y P    +H + +
Sbjct:  629 VRYWPTEPGEYAVHVICDDEDIRDSPFIAHIQPAPPD-CFPDKVKAFGPGLEPTGCIVDRPAEFTIDARAAG---KGDLKLYAQDADGCPIDIKVIPNGDGTFRCSYVPTKPIKHTVII 743          

HSP 2 Score: 57.3806 bits (137), Expect = 1.611e-9
Identity = 36/117 (30.77%), Postives = 52/117 (44.44%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y P   G Y+V V   D ++  SPF + + PA     D +K +A GPG+ +  +P      FT+D RD G  +  V +  D  G P         +GT    Y P   G + I +
Sbjct: 1504 VHYTPATDGPYTVAVKYADQEVPRSPFKIKVLPAH----DASKVRASGPGLNASGIPASLPVEFTIDARDAGEGLLTV-QILDPEGKPKKANIRDNGDGTYTVSYLPDMSGRYTITI 1615          

HSP 3 Score: 53.5286 bits (127), Expect = 3.620e-8
Identity = 36/117 (30.77%), Postives = 51/117 (43.59%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V YLP  PGEY++ +L  ++ I  SPF   I P      D +K +A GPG+E       +  TFTVD  + G     +    D  G    +      +GT    Y P   G + I +
Sbjct: 1120 VSYLPTEPGEYTINILFAEAHIPGSPFKATIQPVF----DPSKVRASGPGLERG--KAGEAATFTVDCSEAGEAELTIEILSDA-GVKAEVLIHNNADGTYHITYSPAFPGTYTITI 1229          

HSP 4 Score: 47.3654 bits (111), Expect = 5.306e-6
Identity = 36/117 (30.77%), Postives = 50/117 (42.74%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            VEY+P  PG+Y V +      I  SPF VP+     D  D  K K  GPG+ +  +      TFTVD    G   P         G   P++     +GT    Y P ++G + + V
Sbjct: 1408 VEYVPFTPGDYDVNITFGGQPIPGSPFRVPVK----DVVDPGKVKCSGPGLGTG-VRARVPQTFTVDCSQAG-RAPLQVAVLGPTGVAEPVEVRDNGDGTHTVHYTPATDGPYTVAV 1518          

HSP 5 Score: 46.9802 bits (110), Expect = 7.025e-6
Identity = 37/119 (31.09%), Postives = 56/119 (47.06%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGP--VVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y+P++ G + V VL    +I+ SPF V +  AL    D  K  A GPG+E      +K T F + T   G   V   +     +R T + +  E + + T +  Y+P  EG H + V
Sbjct:  339 VSYVPKVAGLHKVTVLFAGQNIERSPFEVNVGMAL---GDANKVSARGPGLEPVGNVANKPTYFDIYTAGAGTGDVAVVIVDPQGRRDT-VEVALEDKGDNTFRCTYRPVMEGPHTVHV 453          
BLAST of Calponin-homology (CH) domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9VEN1|FLNA_DROME (Filamin-A OS=Drosophila melanogaster OX=7227 GN=cher PE=1 SV=2)

HSP 1 Score: 72.4034 bits (176), Expect = 9.924e-15
Identity = 43/117 (36.75%), Postives = 64/117 (54.70%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V+Y P   GEY+V +LC++ DI  SPF+  I P      +L KA   GPG+E   + +++ T+FTVD    G   P      D  GT LP++ +  P+GT++  Y P S   H ++V
Sbjct:  605 VKYHPTAVGEYAVHILCDNEDIPKSPFIAQILPRTDFHPELVKAS--GPGLEKNGVTINQPTSFTVDPSKAGN-APLDVVVQDVFGTKLPVELKNNPDGTKKVTYTPTSGVPHTVEV 718          

HSP 2 Score: 48.9062 bits (115), Expect = 1.701e-6
Identity = 38/112 (33.93%), Postives = 51/112 (45.54%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLP-LKSETQPNGTQQFVYKPKSEG 344
            V+YL   PGEY + +   D  I  SPF V +     +  D +K K +GPGIE   +     T F VD  + GP   AV K  +  G P+  L+ E + N      Y P   G
Sbjct:  992 VDYLATDPGEYDITIRFADKHIPGSPFRVLVE----ETVDPSKVKVYGPGIEHGQVRESVPTFFNVDVGEAGPGRIAV-KLTNSEGIPVDNLRVEDKGNCIYAVHYVPPKAG 1098          
BLAST of Calponin-homology (CH) domain-containing protein vs. TrEMBL
Match: A0A448WIZ9 (Uncharacterized protein (Fragment) OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS6339 PE=4 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 1.137e-22
Identity = 48/117 (41.03%), Postives = 68/117 (58.12%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y P +PGEY+V +LCN+ +I  SP++VPI P +  +CD  +AKA+GPGI    +   + T FTVD RD G   P   +C +  G P+PLK     +GT   +Y P    +H + V
Sbjct:   19 VSYWPTVPGEYAVHILCNEENIPKSPYIVPIEPDM-GRCDPERAKAYGPGIMPTGVVAGQPTEFTVDIRDAGGPAPLTVECRNNEGEPVPLKVRDNGDGTYTCLYTPTVPKKHTVLV 134          
BLAST of Calponin-homology (CH) domain-containing protein vs. TrEMBL
Match: A0A183QDA9 (Uncharacterized protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 2.315e-20
Identity = 52/117 (44.44%), Postives = 63/117 (53.85%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y P  PGEY+V +LCND +I  SPFMVPI P +  KCD  + KA GPGI        + T FTVD RD G   P   +C D  G P+ LK     +GT    Y PK   +H + V
Sbjct:   70 VAYWPTAPGEYAVHILCNDENIPKSPFMVPIEPDM-GKCDPERVKAHGPGIMPTGNVAGQPTEFTVDIRDSGGPAPLTVECRDNEGEPVALKVRDNGDGTYTCSYTPKVPKKHTVLV 185          

HSP 2 Score: 54.6842 bits (130), Expect = 5.036e-6
Identity = 32/83 (38.55%), Postives = 46/83 (55.42%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKET--TFTVDTRDCGPVVPAVAKC 254
            V+YLP  PG Y V VL  D+ I+ SPF V + P   +  D+++  A+GPG++  P  V KE+   FTVD +   P    + K 
Sbjct:  470 VDYLPTEPGPYIVNVLYKDTHIKGSPFPVRVAPLGREHIDVSRVHAYGPGLQ--PTGVFKESFAKFTVDAKAVDPQSRGIVKA 550          
BLAST of Calponin-homology (CH) domain-containing protein vs. TrEMBL
Match: A0A5K4E8T7 (Filamin OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 2.335e-20
Identity = 52/117 (44.44%), Postives = 63/117 (53.85%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y P  PGEY+V +LCND +I  SPFMVPI P +  KCD  + KA GPGI        + T FTVD RD G   P   +C D  G P+ LK     +GT    Y PK   +H + V
Sbjct:  790 VAYWPTAPGEYAVHILCNDENIPKSPFMVPIEPDM-GKCDPERVKAHGPGIMPTGNVAGQPTEFTVDIRDSGGPAPLTVECRDNEGEPVALKVRDNGDGTYTCSYTPKVPKKHTVLV 905          

HSP 2 Score: 61.2326 bits (147), Expect = 2.810e-8
Identity = 42/123 (34.15%), Postives = 67/123 (54.47%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKET--TFTVDTRDCGP----VVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V+YLP  PG Y V VL  D+ I+ SPF V + P   +  D+++  A+GPG++  P  V KE+   FTVD +   P    +V A+    +K+ T   +++    +GT +  Y P  +G H ++V
Sbjct: 1203 VDYLPTEPGPYIVNVLYKDTHIKGSPFPVRVAPLGREHIDVSRVHAYGPGLQ--PTGVFKESFAKFTVDAKAVDPQSRGIVKAIVVSPNKQRTACLIQNNG--DGTYKCSYSPIDDGLHHVEV 1321          

HSP 3 Score: 56.9954 bits (136), Expect = 7.674e-7
Identity = 40/119 (33.61%), Postives = 54/119 (45.38%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPN--GTQQFVYKPKSEGEHVIQV 362
            V+YLP   G Y + V  ND +I  SPF VPI     D  D T+ + +GPG+E +     +   FTVD    G   P      D+ G   P     +PN  G     Y P ++G   I+V
Sbjct: 1400 VDYLPTRAGTYDIFVKFNDMNIPGSPFQVPIR----DVVDPTRVRCYGPGLEPRGARAQQPAHFTVDASQAGD-APIQVATVDRVGRTAPAHVVPRPNQPGVYDVTYVPDTDGPCQIEV 1513          
BLAST of Calponin-homology (CH) domain-containing protein vs. TrEMBL
Match: A0A430PXY8 (Filamin (Fragment) OS=Schistosoma bovis OX=6184 GN=DC041_0004512 PE=4 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 2.391e-20
Identity = 52/117 (44.44%), Postives = 63/117 (53.85%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y P  PGEY+V +LCND +I  SPFMVPI P +  KCD  + KA GPGI        + T FTVD RD G   P   +C D  G P+ LK     +GT    Y PK   +H + V
Sbjct:   23 VAYWPTAPGEYAVHILCNDENIPKSPFMVPIEPDM-GKCDPERVKAHGPGIMPTGNVAGQPTEFTVDIRDSGGPAPLTVECRDNEGEPVALKVRDNGDGTYTCSYTPKVPKKHTVLV 138          
BLAST of Calponin-homology (CH) domain-containing protein vs. TrEMBL
Match: A0A5K4E873 (Filamin OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 2.451e-20
Identity = 52/117 (44.44%), Postives = 63/117 (53.85%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y P  PGEY+V +LCND +I  SPFMVPI P +  KCD  + KA GPGI        + T FTVD RD G   P   +C D  G P+ LK     +GT    Y PK   +H + V
Sbjct:  784 VAYWPTAPGEYAVHILCNDENIPKSPFMVPIEPDM-GKCDPERVKAHGPGIMPTGNVAGQPTEFTVDIRDSGGPAPLTVECRDNEGEPVALKVRDNGDGTYTCSYTPKVPKKHTVLV 899          

HSP 2 Score: 60.8474 bits (146), Expect = 2.865e-8
Identity = 42/123 (34.15%), Postives = 67/123 (54.47%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKET--TFTVDTRDCGP----VVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V+YLP  PG Y V VL  D+ I+ SPF V + P   +  D+++  A+GPG++  P  V KE+   FTVD +   P    +V A+    +K+ T   +++    +GT +  Y P  +G H ++V
Sbjct: 1197 VDYLPTEPGPYIVNVLYKDTHIKGSPFPVRVAPLGREHIDVSRVHAYGPGLQ--PTGVFKESFAKFTVDAKAVDPQSRGIVKAIVVSPNKQRTACLIQNNG--DGTYKCSYSPIDDGLHHVEV 1315          

HSP 3 Score: 56.9954 bits (136), Expect = 7.900e-7
Identity = 40/119 (33.61%), Postives = 54/119 (45.38%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPN--GTQQFVYKPKSEGEHVIQV 362
            V+YLP   G Y + V  ND +I  SPF VPI     D  D T+ + +GPG+E +     +   FTVD    G   P      D+ G   P     +PN  G     Y P ++G   I+V
Sbjct: 1394 VDYLPTRAGTYDIFVKFNDMNIPGSPFQVPIR----DVVDPTRVRCYGPGLEPRGARAQQPAHFTVDASQAGD-APIQVATVDRVGRTAPAHVVPRPNQPGVYDVTYVPDTDGPCQIEV 1507          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Cavefish
Match: flna (filamin A, alpha (actin binding protein 280) [Source:ZFIN;Acc:ZDB-GENE-030131-2145])

HSP 1 Score: 83.5741 bits (205), Expect = 1.538e-19
Identity = 47/117 (40.17%), Postives = 63/117 (53.85%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y P  PGEY+V VLC + DIQ+SPFM  I PA        K KA+GPG++S  L V K   FTVD +  G   P   +  D+ G P+ ++ +   NGT    Y P+   +H + V
Sbjct:  636 VRYWPTEPGEYAVHVLCKNEDIQHSPFMAEIKPAPDRDFYPDKVKAYGPGLQSSGLSVGKPAEFTVDAK-LGGKAPLKIQAQDRDGNPVDVQVKDNGNGTYSCSYTPRKPLKHTVMV 751          

HSP 2 Score: 57.3806 bits (137), Expect = 1.771e-10
Identity = 37/117 (31.62%), Postives = 54/117 (46.15%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y+P   G YS+ VL  D +I  SP+ V + P      D +K +A GPG+ +  +P      FT+D +D G  + AV +  D  G P         +GT    Y P   G + I +
Sbjct: 1386 VSYVPTREGPYSINVLYADEEIPRSPYKVKVLPTH----DASKVRASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAV-QITDPEGKPKKANIRDNQDGTYLVSYVPDMTGRYTILI 1497          

HSP 3 Score: 50.8322 bits (120), Expect = 4.526e-8
Identity = 34/119 (28.57%), Postives = 54/119 (45.38%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPV-VPAVAKCYDK-RGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            + Y+P  PG Y++ +     D+ N P  + + PA+    + +  K FGPG+E K +  +  T FTVD R         +  C +   G         Q +GT +  Y P  EG H ++V
Sbjct: 1097 ITYIPLYPGAYTLTIRYGGQDVPNFPARLHVEPAV----ETSGVKVFGPGVEGKGVFREATTEFTVDARALTKTGGKHIKTCVNNPSGNCTEALIRDQGDGTYKVEYTPYEEGPHSVEV 1211          

HSP 4 Score: 47.3654 bits (111), Expect = 6.300e-7
Identity = 38/119 (31.93%), Postives = 58/119 (48.74%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDC--GPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y+P++ G + V VL     I  SPF V +  A   + D +K  A GPG+E+     +K T F V T     G V   +     K+ T +  + E + N + +  YKP  EG+H+I +
Sbjct:  346 VFYIPKVTGMHKVTVLFAGLHISKSPFEVDVGMA---QGDSSKVTAQGPGLEAVGNIANKTTYFDVYTAGAGVGEVEVVIMDPSGKKDT-VECQIEDKGNSSYRCTYKPTQEGQHIIYI 460          

HSP 5 Score: 45.0542 bits (105), Expect = 3.808e-6
Identity = 36/117 (30.77%), Postives = 50/117 (42.74%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            VEY+P  PG Y++ +      I  SPF VP+     D  D TK K  G GI +  +  +    FTVD    G + P   +    +G   P +     + T    Y P  EG + I V
Sbjct: 1290 VEYIPYEPGTYNLNITYGGQPITGSPFSVPVQ----DTVDPTKVKCQGQGIGTN-VRANIPQVFTVDASKAG-MAPLQVRVQGPKGVVEPAEVVDNGDQTHTVSYVPTREGPYSINV 1400          

HSP 6 Score: 43.8986 bits (102), Expect = 9.090e-6
Identity = 27/68 (39.71%), Postives = 38/68 (55.88%), Query Frame = 3
Query:    9 QVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVD 212
            +VEY P   G +SV V  +DS + NSPF VP+T    + CD  + +  GPG+  K    +K   FTV+
Sbjct: 1196 KVEYTPYEEGPHSVEVAYDDSPVPNSPFRVPVT----EGCDPARVRVHGPGL--KAGLTNKPNKFTVE 1257          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Cavefish
Match: FLNB (filamin B [Source:NCBI gene;Acc:103028460])

HSP 1 Score: 72.4034 bits (176), Expect = 1.294e-15
Identity = 42/118 (35.59%), Postives = 64/118 (54.24%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDK-CDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V+Y P  PGEY+V V+C+D DI++SPFM  I P   DK  D ++ KA+GPG+E     ++K   FTV+ ++ G   P      +  G P+ +K   + +      Y P S  +H + V
Sbjct:  606 VKYWPTEPGEYAVHVMCDDEDIEDSPFMAYIVPD--DKSSDPSQVKAYGPGLEKSGCIINKPAEFTVEAKNAGK-GPLKIIAQNADGEPIEVKMRNKGDNVYSCTYTPTSALKHTVAV 720          

HSP 2 Score: 54.299 bits (129), Expect = 2.524e-9
Identity = 39/118 (33.05%), Postives = 50/118 (42.37%), Query Frame = 3
Query:    9 QVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
             VEY P  PG Y V +      IQ SPF VP+     D  D +K K  GPG+ S  +      +FTVD    G V P        +G   P+      +GT    Y P  EG + + V
Sbjct: 1384 NVEYTPYAPGLYDVNITYGGQHIQGSPFKVPVK----DVVDASKVKLSGPGVGSG-VRAKIPQSFTVDCSKAG-VAPLAVAVTGPKGVAEPVDVIDNGDGTHTVAYTPSVEGPYSVVV 1495          

HSP 3 Score: 47.3654 bits (111), Expect = 6.006e-7
Identity = 39/121 (32.23%), Postives = 56/121 (46.28%), Query Frame = 3
Query:    6 VQVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFV--YKPKSEGEHVIQV 362
            + V+Y+P   G  +++VL  D +I  SPF V + P+     D +K KA GPG+    +   K T FTV T+  G     V      +G P+    E   N    +   Y P  +GE VI V
Sbjct:  807 ITVKYIPPGAGRLTIKVLFTDQEIPVSPFRVKVEPS----HDASKVKADGPGLARAGVESGKPTHFTVHTKGAGKAPLDVQFSGPIKGEPVQ-DFEIIDNYDYSYTVKYTPVQQGEMVINV 922          

HSP 4 Score: 46.595 bits (109), Expect = 1.328e-6
Identity = 35/117 (29.91%), Postives = 53/117 (45.30%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y P + G YSV V   D ++  SPF + + P      D +K +A GPG+ +  LP      FT+D +D G    +V +  D+ G           +GT +  Y P   G + I +
Sbjct: 1481 VAYTPSVEGPYSVVVKYADEEVPRSPFKLRVLPT----HDASKVRASGPGLTTG-LPASLPVEFTIDAKDAGEGQLSV-QITDQDGKLKTANISDNQDGTYKVSYVPDKVGRYTIVI 1591          

HSP 5 Score: 46.2098 bits (108), Expect = 1.881e-6
Identity = 36/119 (30.25%), Postives = 51/119 (42.86%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKR--GTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y+P   G Y++ +      + N P  V + PA+    D +K K FGPG+  + L  +  T FTVD R    V     K   K   G         Q +GT +  Y P   G H ++V
Sbjct: 1192 VTYVPLTAGMYTLLLKYGGQAVPNFPAKVVVDPAV----DTSKVKVFGPGVAGEGLFREATTDFTVDARALTKVGGKHIKAQVKNPSGAATDCVIADQGDGTYKVEYTPFENGVHAVEV 1306          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Cavefish
Match: flnca (filamin-C [Source:NCBI gene;Acc:103033794])

HSP 1 Score: 70.8626 bits (172), Expect = 3.483e-15
Identity = 45/119 (37.82%), Postives = 63/119 (52.94%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCY--DKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y P  PG+Y+V V+C+D DI++SPFM  I PA  D     K +AFGPG++   + V+    FT+D R  G       K Y  D  G  + +K   + +GT   VY PK   +H I +
Sbjct:  608 VRYWPTEPGDYAVHVICDDEDIKDSPFMAHILPAANDVFP-EKVRAFGPGLQPTGVIVNMPAEFTIDARQAG---KGELKIYAQDAEGCIIDIKITDKGDGTFVCVYVPKKPIKHTIII 722          

HSP 2 Score: 57.3806 bits (137), Expect = 1.934e-10
Identity = 38/117 (32.48%), Postives = 53/117 (45.30%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y P   G Y+V V   D D+  SPF V  +PA     D +K +A GPG++   +P      FT+D RD G  +  V +  D  G P     +   +GT    Y P   G + I +
Sbjct: 1483 VNYTPSEEGPYTVAVKYADKDVPRSPFKVHSSPAH----DASKVRASGPGLDKAGVPASLPVEFTIDARDAGEGLLTV-QILDPEGKPKKASIQDNKDGTYTVSYVPDVTGRYTITI 1594          

HSP 3 Score: 51.9878 bits (123), Expect = 1.703e-8
Identity = 35/118 (29.66%), Postives = 52/118 (44.07%), Query Frame = 3
Query:    9 QVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
             V YLP   G+Y++ +L  +  I  SPF   + PAL    D ++    GPG+E       +  TFTVD    G     V    D  G    ++     +GT    Y P+S+G + I +
Sbjct: 1098 SVSYLPTEAGDYNINILYGEKHIPGSPFKAAVKPAL----DASRVTVSGPGLERA--KAGEVATFTVDCSRAGEAELTVEIVSDS-GATAEVRIYNNNDGTFSVTYTPQSDGPYTISI 1208          

HSP 4 Score: 50.447 bits (119), Expect = 5.187e-8
Identity = 37/118 (31.36%), Postives = 50/118 (42.37%), Query Frame = 3
Query:    9 QVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
             VEY+P +PG Y + +      I  SPF V +     D  D +K K  GPG+ S  +      TFTVD    G +     K Y   G   P+      +GT    Y P  EG + + V
Sbjct: 1386 SVEYVPFIPGNYDINITYGGQPIPGSPFHVLVR----DVVDASKVKCSGPGLGSG-VRAHVPQTFTVDCSKAG-LASLDVKLYGPGGATEPVAVLNNGDGTHTVNYTPSEEGPYTVAV 1497          

HSP 5 Score: 50.0618 bits (118), Expect = 6.737e-8
Identity = 30/89 (33.71%), Postives = 46/89 (51.69%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPL 278
            V+Y P  PG Y+V VL  + +I +SP+ V + P+     D  K +A GPG+      +D  T FT+ T+  G   P V     ++G P+
Sbjct:  811 VKYTPPAPGRYTVMVLFAEKEIPSSPYKVKVEPSH----DAGKVRAEGPGLNKTGECMDTPTHFTIFTKGAGKAKPEVHFSTGQKGNPV 895          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Cavefish
Match: flnca (filamin-C [Source:NCBI gene;Acc:103033794])

HSP 1 Score: 70.8626 bits (172), Expect = 3.590e-15
Identity = 45/119 (37.82%), Postives = 63/119 (52.94%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCY--DKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y P  PG+Y+V V+C+D DI++SPFM  I PA  D     K +AFGPG++   + V+    FT+D R  G       K Y  D  G  + +K   + +GT   VY PK   +H I +
Sbjct:  665 VRYWPTEPGDYAVHVICDDEDIKDSPFMAHILPAANDVFP-EKVRAFGPGLQPTGVIVNMPAEFTIDARQAG---KGELKIYAQDAEGCIIDIKITDKGDGTFVCVYVPKKPIKHTIII 779          

HSP 2 Score: 57.3806 bits (137), Expect = 1.844e-10
Identity = 38/117 (32.48%), Postives = 53/117 (45.30%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y P   G Y+V V   D D+  SPF V  +PA     D +K +A GPG++   +P      FT+D RD G  +  V +  D  G P     +   +GT    Y P   G + I +
Sbjct: 1540 VNYTPSEEGPYTVAVKYADKDVPRSPFKVHSSPAH----DASKVRASGPGLDKAGVPASLPVEFTIDARDAGEGLLTV-QILDPEGKPKKASIQDNKDGTYTVSYVPDVTGRYTITI 1651          

HSP 3 Score: 53.5286 bits (127), Expect = 4.024e-9
Identity = 31/89 (34.83%), Postives = 47/89 (52.81%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPL 278
            V+Y P  PG Y+V VL  + +I +SP+ V + P+     D  K +A GPG+    + VD  T FT+ T+  G   P V     ++G P+
Sbjct:  868 VKYTPPAPGRYTVMVLFAEKEIPSSPYKVKVEPSH----DAGKVRAEGPGLNKTGVQVDTPTHFTIFTKGAGKAKPEVHFSTGQKGNPV 952          

HSP 4 Score: 51.9878 bits (123), Expect = 1.656e-8
Identity = 35/118 (29.66%), Postives = 52/118 (44.07%), Query Frame = 3
Query:    9 QVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
             V YLP   G+Y++ +L  +  I  SPF   + PAL    D ++    GPG+E       +  TFTVD    G     V    D  G    ++     +GT    Y P+S+G + I +
Sbjct: 1155 SVSYLPTEAGDYNINILYGEKHIPGSPFKAAVKPAL----DASRVTVSGPGLERA--KAGEVATFTVDCSRAGEAELTVEIVSDS-GATAEVRIYNNNDGTFSVTYTPQSDGPYTISI 1265          

HSP 5 Score: 50.447 bits (119), Expect = 5.777e-8
Identity = 37/118 (31.36%), Postives = 50/118 (42.37%), Query Frame = 3
Query:    9 QVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
             VEY+P +PG Y + +      I  SPF V +     D  D +K K  GPG+ S  +      TFTVD    G +     K Y   G   P+      +GT    Y P  EG + + V
Sbjct: 1443 SVEYVPFIPGNYDINITYGGQPIPGSPFHVLVR----DVVDASKVKCSGPGLGSG-VRAHVPQTFTVDCSKAG-LASLDVKLYGPGGATEPVAVLNNGDGTHTVNYTPSEEGPYTVAV 1554          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Cavefish
Match: flnca (filamin-C [Source:NCBI gene;Acc:103033794])

HSP 1 Score: 70.8626 bits (172), Expect = 3.625e-15
Identity = 45/119 (37.82%), Postives = 63/119 (52.94%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCY--DKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y P  PG+Y+V V+C+D DI++SPFM  I PA  D     K +AFGPG++   + V+    FT+D R  G       K Y  D  G  + +K   + +GT   VY PK   +H I +
Sbjct:  636 VRYWPTEPGDYAVHVICDDEDIKDSPFMAHILPAANDVFP-EKVRAFGPGLQPTGVIVNMPAEFTIDARQAG---KGELKIYAQDAEGCIIDIKITDKGDGTFVCVYVPKKPIKHTIII 750          

HSP 2 Score: 57.3806 bits (137), Expect = 2.133e-10
Identity = 38/117 (32.48%), Postives = 53/117 (45.30%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y P   G Y+V V   D D+  SPF V  +PA     D +K +A GPG++   +P      FT+D RD G  +  V +  D  G P     +   +GT    Y P   G + I +
Sbjct: 1511 VNYTPSEEGPYTVAVKYADKDVPRSPFKVHSSPAH----DASKVRASGPGLDKAGVPASLPVEFTIDARDAGEGLLTV-QILDPEGKPKKASIQDNKDGTYTVSYVPDVTGRYTITI 1622          

HSP 3 Score: 53.5286 bits (127), Expect = 4.264e-9
Identity = 31/89 (34.83%), Postives = 47/89 (52.81%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPL 278
            V+Y P  PG Y+V VL  + +I +SP+ V + P+     D  K +A GPG+    + VD  T FT+ T+  G   P V     ++G P+
Sbjct:  839 VKYTPPAPGRYTVMVLFAEKEIPSSPYKVKVEPSH----DAGKVRAEGPGLNKTGVQVDTPTHFTIFTKGAGKAKPEVHFSTGQKGNPV 923          

HSP 4 Score: 51.9878 bits (123), Expect = 1.688e-8
Identity = 35/118 (29.66%), Postives = 52/118 (44.07%), Query Frame = 3
Query:    9 QVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
             V YLP   G+Y++ +L  +  I  SPF   + PAL    D ++    GPG+E       +  TFTVD    G     V    D  G    ++     +GT    Y P+S+G + I +
Sbjct: 1126 SVSYLPTEAGDYNINILYGEKHIPGSPFKAAVKPAL----DASRVTVSGPGLERA--KAGEVATFTVDCSRAGEAELTVEIVSDS-GATAEVRIYNNNDGTFSVTYTPQSDGPYTISI 1236          

HSP 5 Score: 50.0618 bits (118), Expect = 6.615e-8
Identity = 37/118 (31.36%), Postives = 50/118 (42.37%), Query Frame = 3
Query:    9 QVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
             VEY+P +PG Y + +      I  SPF V +     D  D +K K  GPG+ S  +      TFTVD    G +     K Y   G   P+      +GT    Y P  EG + + V
Sbjct: 1414 SVEYVPFIPGNYDINITYGGQPIPGSPFHVLVR----DVVDASKVKCSGPGLGSG-VRAHVPQTFTVDCSKAG-LASLDVKLYGPGGATEPVAVLNNGDGTHTVNYTPSEEGPYTVAV 1525          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001908.1 (pep scaffold:Pmarinus_7.0:GL483086:279:38879:-1 gene:ENSPMAG00000001731.1 transcript:ENSPMAT00000001908.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.0922 bits (170), Expect = 1.633e-15
Identity = 43/120 (35.83%), Postives = 59/120 (49.17%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPA-----LLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVI 356
            V Y P   G+Y+V V+C+D DI++SPFM  I         +     TK K FGPG+ES  + V K   FTVD R  G   P      D  GTP+ ++ +   +GT    Y P+   +H  
Sbjct:  426 VVYWPGEAGDYAVHVVCDDQDIKHSPFMAEIVETGVRGLFVPNALTTKVKVFGPGLESGKVVVGKPIEFTVDAR-AGGRAPFKVYAQDAEGTPIDVQVKDNGDGTFLCRYTPRKAIKHTF 544          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001912.1 (pep scaffold:Pmarinus_7.0:GL483086:7328:38879:-1 gene:ENSPMAG00000001731.1 transcript:ENSPMAT00000001912.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.6178 bits (148), Expect = 1.177e-12
Identity = 32/72 (44.44%), Postives = 41/72 (56.94%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCG 227
            V Y P   G+Y+V V+C+D DI++SPFM  I       C   + K FGPG+ES  + V K   FTVD R  G
Sbjct:  424 VVYWPGEAGDYAVHVVCDDQDIKHSPFMAEIV-ETGGACSPAQVKVFGPGLESGKVVVGKPIEFTVDARAGG 494          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004210.1 (pep scaffold:Pmarinus_7.0:GL476636:147693:235244:1 gene:ENSPMAG00000003806.1 transcript:ENSPMAT00000004210.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.9802 bits (110), Expect = 1.654e-7
Identity = 33/115 (28.70%), Postives = 48/115 (41.74%), Query Frame = 3
Query:   18 YLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            Y P L G YS+ V     D+ +SPF V +  A     D  + +  G G+ +  +P    T FT+DTR+ G   P      D  G P   +     +G     Y P   G + + V
Sbjct: 1396 YTPSLVGPYSLHVQYAGQDVPHSPFGVDVLAAY----DAGRVRVSGAGVSASGVPASLPTDFTIDTREAGD-APLSITIVDPDGFPRRARVLDGGDGLFSVSYLPDVAGRYSVAV 1505          

HSP 2 Score: 44.669 bits (104), Expect = 1.156e-6
Identity = 24/72 (33.33%), Postives = 37/72 (51.39%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCG 227
            VEY+P   G ++V V    + +  SPF V    A+ D CD ++ +  GPG+E       +   F++DTR  G
Sbjct: 1196 VEYVPSSAGPHAVEVTYAGARVPRSPFRV----AVADGCDPSRVRVHGPGLEGG--LTHRANVFSIDTRAAG 1261          

HSP 3 Score: 44.2838 bits (103), Expect = 1.376e-6
Identity = 35/119 (29.41%), Postives = 55/119 (46.22%), Query Frame = 3
Query:    6 VQVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            ++  Y P +PG + V V    + + +SPF V I  A    C+    +A G G++S+ + V     F V T+  G     V    + RG   P++      G  +F YKP + G HVI +
Sbjct:  322 LRCTYRPLVPGPHIVSVGYAGAAVPHSPFSVNIGEA----CNPGACRASGRGLQSRGVRVGDAAGFRVLTKQAGSGELNVL-LRNPRGEE-PMRHREVGEGVHEFEYKPLALGPHVITI 434          

HSP 4 Score: 44.2838 bits (103), Expect = 1.590e-6
Identity = 22/74 (29.73%), Postives = 40/74 (54.05%), Query Frame = 3
Query:    6 VQVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCG 227
            + V+Y P   G +++ V  ++ ++++SPF + + P+     D +K +  GPGI +  +   K   FTV TR  G
Sbjct:  711 LTVKYTPPCAGRFTIMVFFSEQEVRDSPFGIDVVPSH----DASKVRVEGPGINATGVEAAKPAHFTVYTRGAG 780          

HSP 5 Score: 44.2838 bits (103), Expect = 1.621e-6
Identity = 19/37 (51.35%), Postives = 25/37 (67.57%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLD 122
            V Y+P  PG+Y+V VLC++ D+  SPFM  I PA  D
Sbjct:  513 VRYVPTEPGDYAVHVLCDEEDVALSPFMAHILPASRD 549          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004223.1 (pep scaffold:Pmarinus_7.0:GL476636:147693:235187:1 gene:ENSPMAG00000003806.1 transcript:ENSPMAT00000004223.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.9802 bits (110), Expect = 1.675e-7
Identity = 33/115 (28.70%), Postives = 48/115 (41.74%), Query Frame = 3
Query:   18 YLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            Y P L G YS+ V     D+ +SPF V +  A     D  + +  G G+ +  +P    T FT+DTR+ G   P      D  G P   +     +G     Y P   G + + V
Sbjct: 1386 YTPSLVGPYSLHVQYAGQDVPHSPFGVDVLAAY----DAGRVRVSGAGVSASGVPASLPTDFTIDTREAGD-APLSITIVDPDGFPRRARVLDGGDGLFSVSYLPDVAGRYSVAV 1495          

HSP 2 Score: 45.0542 bits (105), Expect = 8.588e-7
Identity = 34/119 (28.57%), Postives = 53/119 (44.54%), Query Frame = 3
Query:    6 VQVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            ++  Y P +PG + V V    + + +SPF V I  A    C+    +A G G++S+ + V     F V T+  G        C  K     P++      G  +F YKP + G HVI +
Sbjct:  322 LRCTYRPLVPGPHIVSVGYAGAAVPHSPFSVNIGEA----CNPGACRASGRGLQSRGVRVGDAAGFRVLTKQAGS---DFGMC--KASGEEPMRHREVGEGVHEFEYKPLALGPHVITI 431          

HSP 3 Score: 44.669 bits (104), Expect = 1.314e-6
Identity = 24/72 (33.33%), Postives = 37/72 (51.39%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCG 227
            VEY+P   G ++V V    + +  SPF V    A+ D CD ++ +  GPG+E       +   F++DTR  G
Sbjct: 1186 VEYVPSSAGPHAVEVTYAGARVPRSPFRV----AVADGCDPSRVRVHGPGLEGG--LTHRANVFSIDTRAAG 1251          

HSP 4 Score: 44.2838 bits (103), Expect = 1.393e-6
Identity = 19/37 (51.35%), Postives = 25/37 (67.57%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLD 122
            V Y+P  PG+Y+V VLC++ D+  SPFM  I PA  D
Sbjct:  510 VRYVPTEPGDYAVHVLCDEEDVALSPFMAHILPASRD 546          

HSP 5 Score: 44.2838 bits (103), Expect = 1.534e-6
Identity = 22/74 (29.73%), Postives = 40/74 (54.05%), Query Frame = 3
Query:    6 VQVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCG 227
            + V+Y P   G +++ V  ++ ++++SPF + + P+     D +K +  GPGI +  +   K   FTV TR  G
Sbjct:  697 LTVKYTPPCAGRFTIMVFFSEQEVRDSPFGIDVVPSH----DASKVRVEGPGINATGVEAAKPAHFTVYTRGAG 766          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004195.1 (pep scaffold:Pmarinus_7.0:GL476636:147693:235244:1 gene:ENSPMAG00000003806.1 transcript:ENSPMAT00000004195.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.9802 bits (110), Expect = 1.830e-7
Identity = 33/115 (28.70%), Postives = 48/115 (41.74%), Query Frame = 3
Query:   18 YLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            Y P L G YS+ V     D+ +SPF V +  A     D  + +  G G+ +  +P    T FT+DTR+ G   P      D  G P   +     +G     Y P   G + + V
Sbjct: 1388 YTPSLVGPYSLHVQYAGQDVPHSPFGVDVLAAY----DAGRVRVSGAGVSASGVPASLPTDFTIDTREAGD-APLSITIVDPDGFPRRARVLDGGDGLFSVSYLPDVAGRYSVAV 1497          

HSP 2 Score: 44.669 bits (104), Expect = 1.230e-6
Identity = 24/72 (33.33%), Postives = 37/72 (51.39%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCG 227
            VEY+P   G ++V V    + +  SPF V    A+ D CD ++ +  GPG+E       +   F++DTR  G
Sbjct: 1188 VEYVPSSAGPHAVEVTYAGARVPRSPFRV----AVADGCDPSRVRVHGPGLEGG--LTHRANVFSIDTRAAG 1253          

HSP 3 Score: 44.669 bits (104), Expect = 1.291e-6
Identity = 35/119 (29.41%), Postives = 55/119 (46.22%), Query Frame = 3
Query:    6 VQVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            ++  Y P +PG + V V    + + +SPF V I  A    C+    +A G G++S+ + V     F V T+  G     V    + RG   P++      G  +F YKP + G HVI +
Sbjct:  322 LRCTYRPLVPGPHIVSVGYAGAAVPHSPFSVNIGEA----CNPGACRASGRGLQSRGVRVGDAAGFRVLTKQAGSGELNVL-LRNPRGEE-PMRHREVGEGVHEFEYKPLALGPHVITI 434          

HSP 4 Score: 44.2838 bits (103), Expect = 1.381e-6
Identity = 19/37 (51.35%), Postives = 25/37 (67.57%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLD 122
            V Y+P  PG+Y+V VLC++ D+  SPFM  I PA  D
Sbjct:  513 VRYVPTEPGDYAVHVLCDEEDVALSPFMAHILPASRD 549          

HSP 5 Score: 44.2838 bits (103), Expect = 1.436e-6
Identity = 22/74 (29.73%), Postives = 40/74 (54.05%), Query Frame = 3
Query:    6 VQVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCG 227
            + V+Y P   G +++ V  ++ ++++SPF + + P+     D +K +  GPGI +  +   K   FTV TR  G
Sbjct:  703 LTVKYTPPCAGRFTIMVFFSEQEVRDSPFGIDVVPSH----DASKVRVEGPGINATGVEAAKPAHFTVYTRGAG 772          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Nematostella
Match: EDO46947 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNL3])

HSP 1 Score: 73.559 bits (179), Expect = 1.699e-16
Identity = 46/120 (38.33%), Postives = 63/120 (52.50%), Query Frame = 3
Query:    3 KVQVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            K +V Y P +PG+Y+V V C D DI+NSPFMVPI+PA     D +K  A GPG+E + +       FTV T + G     + K  D +G   P + +   +GT    Y P   G H + V
Sbjct: 1059 KCEVTYYPLVPGKYAVHVTCGDVDIKNSPFMVPISPA----GDASKVYAKGPGLEPEGVCAGCPAEFTVYTNEAGDGDVDI-KVMDSQGKKSPSEIKDNKDGTYTVTYYPDKPGMHTVAV 1173          

HSP 2 Score: 51.6026 bits (122), Expect = 7.664e-9
Identity = 36/117 (30.77%), Postives = 53/117 (45.30%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y+P+ PG Y++ V   D  +  SPF   + P+     D +K K  G G   K +  ++E  F VD R+ G   P V  C       +P+      +GT    Y P+ EG H + V
Sbjct: 1830 VAYVPDKPGRYNIDVKYGDRRVPRSPFRPTVKPS----GDASKVKVKGLGPNEKVM-TNQENDFLVDARNAGKGTP-VCTCIGPNKKDVPVDVVPNKDGTYSCYYTPEDEGRHSVDV 1940          

HSP 3 Score: 47.3654 bits (111), Expect = 2.501e-7
Identity = 40/118 (33.90%), Postives = 55/118 (46.61%), Query Frame = 3
Query:   15 EYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFV--YKPKSEGEHVIQV 362
             Y+    G+Y V V  N   I  SPF V ++  L    D  KA A GPG+    +   K T FTV T   G    +V K  D RG    +    +P   Q+F+  Y+P + G+H I+V
Sbjct:  773 RYVSNTQGKYDVHVKWNGRHIPKSPFRVEVSSDL----DAGKAYAKGPGLAPTGVVAGKYTDFTVFTAGAGEGKVSV-KVIDPRGGE-DVDVIIEPQDNQEFLVEYQPVNTGKHTIKV 884          

HSP 4 Score: 47.3654 bits (111), Expect = 2.600e-7
Identity = 35/118 (29.66%), Postives = 50/118 (42.37%), Query Frame = 3
Query:    9 QVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
             + YLP  PGEY++ +   D DI  SPF V +T  + D+    K       +ES  L V +  +F+V T    PV    A      GT           G     + PK  G+H++ V
Sbjct: 3043 NISYLPTAPGEYTIHIRFADEDIPGSPFKVFVTTEVEDRFRDLKLSD----LESSGLKVGQPASFSVQTN--APVGKVSATVIAPSGTESKAVISDLGKGNYAIRFVPKEFGDHLVNV 3154          

HSP 5 Score: 45.8246 bits (107), Expect = 9.323e-7
Identity = 27/72 (37.50%), Postives = 37/72 (51.39%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCG 227
            VEY P   G+++++V      I  SPF V ++P  +D    +K K FG G+E   L       FTVDTR  G
Sbjct:  870 VEYQPVNTGKHTIKVGYGGQPIHGSPFHVMVSPPKVDPIP-SKVKVFGAGVEPTGLKAGMRAPFTVDTRGAG 940          

HSP 6 Score: 44.2838 bits (103), Expect = 3.032e-6
Identity = 27/72 (37.50%), Postives = 37/72 (51.39%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCG 227
            V Y P+ PG ++V V  ND  I  SPF V I      KC     +A+GPG+E     VD+   F ++T+  G
Sbjct: 1159 VTYYPDKPGMHTVAVHFNDKPIPKSPFKVNICSTNTSKC-----RAYGPGLEKG--FVDQRNDFKIETKGAG 1223          

HSP 7 Score: 43.5134 bits (101), Expect = 4.916e-6
Identity = 37/117 (31.62%), Postives = 49/117 (41.88%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y P  PG+Y V +L  D  I  SPF   I+       D +K K  GPGIE   + V       +DTR  G  +  V K  D    P+    E +  G     Y P+ +  H + V
Sbjct: 1251 VHYWPNEPGDYMVNILYADKHIPGSPFKARISHPF----DPSKVKVEGPGIEPG-ICVGDPADIDIDTRLAGDNLLEV-KVVDDLNQPVKCDIEEEEYGMYACTYTPEKDVPHRVNV 1361          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Medaka
Match: flna (filamin-A [Source:NCBI gene;Acc:101173301])

HSP 1 Score: 78.1814 bits (191), Expect = 1.033e-17
Identity = 46/117 (39.32%), Postives = 60/117 (51.28%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y P  PGEY+V VLC++ DIQ+SPFM  I           K KA+GPG++S  L V K T FTVD +  G   P      D  G P+ ++ +   NGT    Y P    +H + V
Sbjct:  634 VRYWPTEPGEYAVHVLCSNEDIQHSPFMAEIVNPPEKDFYPDKVKAYGPGLQSSGLAVGKLTEFTVDAKQGGK-APLKILSQDAEGNPVDVQVKDNGNGTYTCTYTPAKPVKHTVMV 749          

HSP 2 Score: 58.151 bits (139), Expect = 1.073e-10
Identity = 37/117 (31.62%), Postives = 54/117 (46.15%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y+P   G YS+ VL  D +I  SP+ V + P      D +K +A GPG+ +  +P      FT+D +D G  + AV +  D  G P         +GT    Y P   G + I +
Sbjct: 1417 VNYIPTREGPYSINVLYADEEIPRSPYKVKVLPTH----DASKVRASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAV-QITDPEGKPKKANIRDNHDGTYLVSYVPDMTGRYTILI 1528          

HSP 3 Score: 50.8322 bits (120), Expect = 4.083e-8
Identity = 38/126 (30.16%), Postives = 55/126 (43.65%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDC----GPVVPAV-----AKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            + Y+P  PG Y++ +     D+ N P  + + PA+    D +    FGPG+E K +  D  T FTVD R      G  + A+       C D   T L        +GT    Y P  EG H ++V
Sbjct: 1128 ITYIPLYPGCYTLTIRYGGQDVPNFPAQLSVEPAV----DTSGVHVFGPGVEGKGVFRDATTDFTVDARALTQTGGEHIKALISNPSGSCTDALITDL-------RDGTYNVEYTPYEEGPHSVEV 1242          

HSP 4 Score: 48.9062 bits (115), Expect = 1.979e-7
Identity = 40/120 (33.33%), Postives = 56/120 (46.67%), Query Frame = 3
Query:    9 QVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDC--GPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
             V Y+P++ G + V VL     I  SPF V +  A   + D +KA A GPG+E      +K T F V T     G V   +     K+ T +    E + N + +  YKP  EG+H I V
Sbjct:  343 SVVYIPKVTGMHKVTVLFAGQHISKSPFEVEVGMA---QGDSSKATAQGPGLEPSGNIANKTTYFEVYTAGAGVGEVEVVIMDPAGKKNT-VTCNIEDKGNSSYRCTYKPTQEGQHTIFV 458          

HSP 5 Score: 47.7506 bits (112), Expect = 4.729e-7
Identity = 37/118 (31.36%), Postives = 51/118 (43.22%), Query Frame = 3
Query:    9 QVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
             VEY+P   G Y++ V      I  SPF VP++    D  D TK K  GPG+    +  +    FTVD    G V P   +    +G   P++     + T    Y P  EG + I V
Sbjct: 1320 SVEYIPYEAGTYNLNVTYGGQPITGSPFTVPVS----DTVDSTKVKCQGPGL-GNSVRANIPQAFTVDASKAG-VAPLQVRVQGPQGVVEPVELVDNGDQTHTVNYIPTREGPYSINV 1431          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Medaka
Match: flna (filamin-A [Source:NCBI gene;Acc:101173301])

HSP 1 Score: 78.1814 bits (191), Expect = 1.074e-17
Identity = 46/117 (39.32%), Postives = 60/117 (51.28%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y P  PGEY+V VLC++ DIQ+SPFM  I           K KA+GPG++S  L V K T FTVD +  G   P      D  G P+ ++ +   NGT    Y P    +H + V
Sbjct:  634 VRYWPTEPGEYAVHVLCSNEDIQHSPFMAEIVNPPEKDFYPDKVKAYGPGLQSSGLAVGKLTEFTVDAKQGGK-APLKILSQDAEGNPVDVQVKDNGNGTYTCTYTPAKPVKHTVMV 749          

HSP 2 Score: 58.151 bits (139), Expect = 1.138e-10
Identity = 37/117 (31.62%), Postives = 54/117 (46.15%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y+P   G YS+ VL  D +I  SP+ V + P      D +K +A GPG+ +  +P      FT+D +D G  + AV +  D  G P         +GT    Y P   G + I +
Sbjct: 1417 VNYIPTREGPYSINVLYADEEIPRSPYKVKVLPTH----DASKVRASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAV-QITDPEGKPKKANIRDNHDGTYLVSYVPDMTGRYTILI 1528          

HSP 3 Score: 50.8322 bits (120), Expect = 4.164e-8
Identity = 38/126 (30.16%), Postives = 55/126 (43.65%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDC----GPVVPAV-----AKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            + Y+P  PG Y++ +     D+ N P  + + PA+    D +    FGPG+E K +  D  T FTVD R      G  + A+       C D   T L        +GT    Y P  EG H ++V
Sbjct: 1128 ITYIPLYPGCYTLTIRYGGQDVPNFPAQLSVEPAV----DTSGVHVFGPGVEGKGVFRDATTDFTVDARALTQTGGEHIKALISNPSGSCTDALITDL-------RDGTYNVEYTPYEEGPHSVEV 1242          

HSP 4 Score: 48.9062 bits (115), Expect = 2.160e-7
Identity = 40/120 (33.33%), Postives = 56/120 (46.67%), Query Frame = 3
Query:    9 QVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDC--GPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
             V Y+P++ G + V VL     I  SPF V +  A   + D +KA A GPG+E      +K T F V T     G V   +     K+ T +    E + N + +  YKP  EG+H I V
Sbjct:  343 SVVYIPKVTGMHKVTVLFAGQHISKSPFEVEVGMA---QGDSSKATAQGPGLEPSGNIANKTTYFEVYTAGAGVGEVEVVIMDPAGKKNT-VTCNIEDKGNSSYRCTYKPTQEGQHTIFV 458          

HSP 5 Score: 47.7506 bits (112), Expect = 5.013e-7
Identity = 37/118 (31.36%), Postives = 51/118 (43.22%), Query Frame = 3
Query:    9 QVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
             VEY+P   G Y++ V      I  SPF VP++    D  D TK K  GPG+    +  +    FTVD    G V P   +    +G   P++     + T    Y P  EG + I V
Sbjct: 1320 SVEYIPYEAGTYNLNVTYGGQPITGSPFTVPVS----DTVDSTKVKCQGPGL-GNSVRANIPQAFTVDASKAG-VAPLQVRVQGPQGVVEPVELVDNGDQTHTVNYIPTREGPYSINV 1431          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Medaka
Match: flna (filamin-A [Source:NCBI gene;Acc:101173301])

HSP 1 Score: 78.1814 bits (191), Expect = 1.084e-17
Identity = 46/117 (39.32%), Postives = 60/117 (51.28%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y P  PGEY+V VLC++ DIQ+SPFM  I           K KA+GPG++S  L V K T FTVD +  G   P      D  G P+ ++ +   NGT    Y P    +H + V
Sbjct:  634 VRYWPTEPGEYAVHVLCSNEDIQHSPFMAEIVNPPEKDFYPDKVKAYGPGLQSSGLAVGKLTEFTVDAKQGGK-APLKILSQDAEGNPVDVQVKDNGNGTYTCTYTPAKPVKHTVMV 749          

HSP 2 Score: 58.151 bits (139), Expect = 1.149e-10
Identity = 37/117 (31.62%), Postives = 54/117 (46.15%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y+P   G YS+ VL  D +I  SP+ V + P      D +K +A GPG+ +  +P      FT+D +D G  + AV +  D  G P         +GT    Y P   G + I +
Sbjct: 1417 VNYIPTREGPYSINVLYADEEIPRSPYKVKVLPTH----DASKVRASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAV-QITDPEGKPKKANIRDNHDGTYLVSYVPDMTGRYTILI 1528          

HSP 3 Score: 50.8322 bits (120), Expect = 4.044e-8
Identity = 38/126 (30.16%), Postives = 55/126 (43.65%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDC----GPVVPAV-----AKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            + Y+P  PG Y++ +     D+ N P  + + PA+    D +    FGPG+E K +  D  T FTVD R      G  + A+       C D   T L        +GT    Y P  EG H ++V
Sbjct: 1128 ITYIPLYPGCYTLTIRYGGQDVPNFPAQLSVEPAV----DTSGVHVFGPGVEGKGVFRDATTDFTVDARALTQTGGEHIKALISNPSGSCTDALITDL-------RDGTYNVEYTPYEEGPHSVEV 1242          

HSP 4 Score: 48.521 bits (114), Expect = 2.223e-7
Identity = 40/120 (33.33%), Postives = 56/120 (46.67%), Query Frame = 3
Query:    9 QVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDC--GPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
             V Y+P++ G + V VL     I  SPF V +  A   + D +KA A GPG+E      +K T F V T     G V   +     K+ T +    E + N + +  YKP  EG+H I V
Sbjct:  343 SVVYIPKVTGMHKVTVLFAGQHISKSPFEVEVGMA---QGDSSKATAQGPGLEPSGNIANKTTYFEVYTAGAGVGEVEVVIMDPAGKKNT-VTCNIEDKGNSSYRCTYKPTQEGQHTIFV 458          

HSP 5 Score: 47.7506 bits (112), Expect = 5.110e-7
Identity = 37/118 (31.36%), Postives = 51/118 (43.22%), Query Frame = 3
Query:    9 QVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
             VEY+P   G Y++ V      I  SPF VP++    D  D TK K  GPG+    +  +    FTVD    G V P   +    +G   P++     + T    Y P  EG + I V
Sbjct: 1320 SVEYIPYEAGTYNLNVTYGGQPITGSPFTVPVS----DTVDSTKVKCQGPGL-GNSVRANIPQAFTVDASKAG-VAPLQVRVQGPQGVVEPVELVDNGDQTHTVNYIPTREGPYSINV 1431          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Medaka
Match: flna (filamin-A [Source:NCBI gene;Acc:101173301])

HSP 1 Score: 78.1814 bits (191), Expect = 1.095e-17
Identity = 46/117 (39.32%), Postives = 60/117 (51.28%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y P  PGEY+V VLC++ DIQ+SPFM  I           K KA+GPG++S  L V K T FTVD +  G   P      D  G P+ ++ +   NGT    Y P    +H + V
Sbjct:  634 VRYWPTEPGEYAVHVLCSNEDIQHSPFMAEIVNPPEKDFYPDKVKAYGPGLQSSGLAVGKLTEFTVDAKQGGK-APLKILSQDAEGNPVDVQVKDNGNGTYTCTYTPAKPVKHTVMV 749          

HSP 2 Score: 58.151 bits (139), Expect = 1.183e-10
Identity = 37/117 (31.62%), Postives = 54/117 (46.15%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y+P   G YS+ VL  D +I  SP+ V + P      D +K +A GPG+ +  +P      FT+D +D G  + AV +  D  G P         +GT    Y P   G + I +
Sbjct: 1417 VNYIPTREGPYSINVLYADEEIPRSPYKVKVLPTH----DASKVRASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAV-QITDPEGKPKKANIRDNHDGTYLVSYVPDMTGRYTILI 1528          

HSP 3 Score: 50.8322 bits (120), Expect = 4.287e-8
Identity = 38/126 (30.16%), Postives = 55/126 (43.65%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDC----GPVVPAV-----AKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            + Y+P  PG Y++ +     D+ N P  + + PA+    D +    FGPG+E K +  D  T FTVD R      G  + A+       C D   T L        +GT    Y P  EG H ++V
Sbjct: 1128 ITYIPLYPGCYTLTIRYGGQDVPNFPAQLSVEPAV----DTSGVHVFGPGVEGKGVFRDATTDFTVDARALTQTGGEHIKALISNPSGSCTDALITDL-------RDGTYNVEYTPYEEGPHSVEV 1242          

HSP 4 Score: 48.9062 bits (115), Expect = 2.160e-7
Identity = 40/120 (33.33%), Postives = 56/120 (46.67%), Query Frame = 3
Query:    9 QVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDC--GPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
             V Y+P++ G + V VL     I  SPF V +  A   + D +KA A GPG+E      +K T F V T     G V   +     K+ T +    E + N + +  YKP  EG+H I V
Sbjct:  343 SVVYIPKVTGMHKVTVLFAGQHISKSPFEVEVGMA---QGDSSKATAQGPGLEPSGNIANKTTYFEVYTAGAGVGEVEVVIMDPAGKKNT-VTCNIEDKGNSSYRCTYKPTQEGQHTIFV 458          

HSP 5 Score: 47.7506 bits (112), Expect = 5.313e-7
Identity = 37/118 (31.36%), Postives = 51/118 (43.22%), Query Frame = 3
Query:    9 QVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
             VEY+P   G Y++ V      I  SPF VP++    D  D TK K  GPG+    +  +    FTVD    G V P   +    +G   P++     + T    Y P  EG + I V
Sbjct: 1320 SVEYIPYEAGTYNLNVTYGGQPITGSPFTVPVS----DTVDSTKVKCQGPGL-GNSVRANIPQAFTVDASKAG-VAPLQVRVQGPQGVVEPVELVDNGDQTHTVNYIPTREGPYSINV 1431          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Medaka
Match: flnc (filamin C [Source:NCBI gene;Acc:101165476])

HSP 1 Score: 71.633 bits (174), Expect = 2.196e-15
Identity = 44/119 (36.97%), Postives = 65/119 (54.62%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCY--DKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y P  PG+Y+V V+C+D DI++SPFM  I PA ++     K KA+GPG++   + V+K T FT+D R  G       + Y  D  G  + +K   + +GT   VY P    +H I +
Sbjct:  674 VHYWPTEPGDYAVHVICDDEDIKDSPFMAHILPA-VNNVFPEKVKAYGPGLQPTGVIVNKPTEFTIDARMAG---KGHLRIYAQDVEGCTIDIKITDRGDGTFMCVYTPVKPIKHTIII 788          

HSP 2 Score: 56.6102 bits (135), Expect = 3.509e-10
Identity = 38/117 (32.48%), Postives = 55/117 (47.01%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y P   G Y+V V  +D ++ +SPF V   P      D +K +A GPG++ K +P      FT+D RD G  +  V +  D  G P     +   +GT    Y P S G + I +
Sbjct: 1527 VHYTPAQDGPYTVSVKYSDQEVPHSPFKVMSQPG----HDASKVRASGPGLDIKGVPASLPVEFTIDARDAGEGLLTV-QILDPEGKPKNATIQDNRDGTYTVSYVPDSTGPYTITI 1638          

HSP 3 Score: 54.299 bits (129), Expect = 2.369e-9
Identity = 38/118 (32.20%), Postives = 51/118 (43.22%), Query Frame = 3
Query:    9 QVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
             V YLP  PGEY++ +L  +  I  SPF   I PAL    D  K  A GPG+E       +  TFTVD    G     + +   + G    +  +    GT    Y P  +G H I +
Sbjct: 1164 SVSYLPTEPGEYAINILFAEQHISGSPFKAAIRPAL----DPIKVVASGPGLERA--KAGEPATFTVDCSRAGDAELTI-EIVSETGVKAEVHIQKTAEGTFSVTYIPSFQGTHTITI 1274          

HSP 4 Score: 47.3654 bits (111), Expect = 5.918e-7
Identity = 28/78 (35.90%), Postives = 40/78 (51.28%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAV 245
            V+Y P  PG +++ VL  D +I  SPF V + P+     D  K +A GPG+    + V   T FT+ T+  G   P V
Sbjct:  877 VKYTPPAPGRFTIMVLFADQEIPISPFKVKVDPS----HDAGKVRAEGPGLNKTGVEVGTPTHFTIYTKGAGKAKPEV 950          

HSP 5 Score: 45.8246 bits (107), Expect = 2.003e-6
Identity = 34/118 (28.81%), Postives = 55/118 (46.61%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSET-QPNGTQQFVYKPKSEGEHVIQV 362
            V+Y     G  ++ +      I  SPF + + PA+    DL K K    G+++K + V K+  FTV+T+  G +     K     G P+P K E+ +  G     Y P  EG++ + V
Sbjct:  976 VKYTALQQGNMAISIALGGDTIPKSPFHITVAPAM----DLAKVKV--EGLDTK-VEVGKDQEFTVNTKGAGGLGNVGVKMTSPSGRPIPCKLESDKAKGNHSVKYIPPEEGQYKVDV 1086          

HSP 6 Score: 44.669 bits (104), Expect = 5.474e-6
Identity = 37/119 (31.09%), Postives = 54/119 (45.38%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGT--PLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y P++ G + V+VL    DI  SP+ V +     D  D +K  A GPG+E+     +K T F + T   G    +V    D RG    + L  E + +   +  Y P  EG H I +
Sbjct:  345 VTYTPKVEGVHKVKVLFAGQDIDKSPYTVNVDK---DMGDPSKVHARGPGLEATGNVANKPTYFDIYTAGAGNGDISVV-IVDPRGKKDTVELILENKGDSVFRCTYHPVLEGPHTIHI 459          

HSP 7 Score: 44.669 bits (104), Expect = 6.147e-6
Identity = 26/70 (37.14%), Postives = 41/70 (58.57%), Query Frame = 3
Query:    9 QVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTR 218
            +VEY     G + + VL +D+ +  SPF V    ++++ CD T+ +AFGPG+E      +K   FTV+TR
Sbjct: 1359 RVEYTAFEDGIHLIEVLYDDAPVPKSPFRV----SVVEGCDPTRVRAFGPGLEGG--ITNKPNRFTVETR 1422          
BLAST of Calponin-homology (CH) domain-containing protein vs. Planmine SMEST
Match: SMESG000017288.1 (SMESG000017288.1)

HSP 1 Score: 248.054 bits (632), Expect = 2.963e-77
Identity = 119/120 (99.17%), Postives = 119/120 (99.17%), Query Frame = 3
Query:    3 KVQVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            KVQVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAK FGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV
Sbjct: 2642 KVQVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKVFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 2761          

HSP 2 Score: 219.55 bits (558), Expect = 2.787e-67
Identity = 104/120 (86.67%), Postives = 110/120 (91.67%), Query Frame = 3
Query:    3 KVQVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            KVQVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAK FGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDK+G  +P+KS  QPNGT+ FVY PK   +HV+QV
Sbjct: 1836 KVQVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKVFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKQGNSVPVKSTKQPNGTETFVYTPKRNEDHVVQV 1955          

HSP 3 Score: 219.55 bits (558), Expect = 2.787e-67
Identity = 104/120 (86.67%), Postives = 110/120 (91.67%), Query Frame = 3
Query:    3 KVQVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            KVQVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAK FGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDK+G  +P+KS  QPNGT+ FVY PK   +HV+QV
Sbjct: 2239 KVQVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKVFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKQGNSVPVKSTKQPNGTETFVYTPKRNEDHVVQV 2358          

HSP 4 Score: 100.138 bits (248), Expect = 1.863e-25
Identity = 52/117 (44.44%), Postives = 66/117 (56.41%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V+Y P LPGEY+V VLCN  DI+ SPFM  I+     K D TK KAFGPG+E K + ++KET FTVD ++ G        C D  G  +P+K     N T    Y  K  G+H I +
Sbjct:  670 VQYFPVLPGEYAVHVLCNKEDIKGSPFMAQISDVPTVKFDATKVKAFGPGLEPKGVQINKETNFTVDIKNAGAPAEVKTLCIDINGNEVPIKITDNHNSTFTCTYTTKLIGKHTIYI 786          

HSP 5 Score: 85.5001 bits (210), Expect = 1.992e-20
Identity = 47/119 (39.50%), Postives = 64/119 (53.78%), Query Frame = 3
Query:    6 VQVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            + V+YLP   GEY V VL N+ +I  SPF V I  AL       K KA+GPG+++  +   K T FTVD+   GP+   + KCYDK G  +P+++    N      Y P   G+H I V
Sbjct: 1449 IGVQYLPVEKGEYIVHVLSNNEEIPKSPFAVDIENALESSVHPEKVKAYGPGLQTPGVVQGKPTQFTVDSTQTGPLKSVMVKCYDKDGILVPIQTNPVSNQVTTNTYNPTKPGKHTISV 1567          

HSP 6 Score: 80.1073 bits (196), Expect = 1.766e-18
Identity = 45/119 (37.82%), Postives = 61/119 (51.26%), Query Frame = 3
Query:    6 VQVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V V Y P  PGE++V +  N+ DI  SP+MV  T ++  K D  K K FGPGIE       K+  FTVD +      P   KC+D  GT +P++    P+ T    Y P +  +H I V
Sbjct: 1057 VSVVYHPTKPGEHAVHITANEQDIPKSPYMVMATESITPKGDNNKIKVFGPGIEPNGNVTGKQANFTVDAKAYKDKKPVETKCFDSDGTIIPVQVVENPDFTYSCTYTPLTAKKHTIYV 1175          

HSP 7 Score: 46.2098 bits (108), Expect = 1.151e-6
Identity = 35/117 (29.91%), Postives = 50/117 (42.74%), Query Frame = 3
Query:   18 YLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGI--ESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            Y+PE  G   + V  N S I  SPF   +    +    + K K  G GI   +  +       F VDT+D G     +   ++  G P+PL  E +PNG     Y+    G+H I V
Sbjct: 3609 YVPEELGPCLIDVKYNKSPISGSPFKTNV----VQPAQVEKVKVDGDGIIPPNGAILASMPAVFHVDTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISV 3721          

HSP 8 Score: 46.2098 bits (108), Expect = 1.424e-6
Identity = 36/119 (30.25%), Postives = 50/119 (42.02%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDK--RGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y   +PG Y++ VL ++  I  SP +VP+ P      DL+   A GPG+  + +  D    FTVD  +  P      K   +   G       +   NG     Y P  EG H I V
Sbjct: 3311 VVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSPNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINV 3429          
BLAST of Calponin-homology (CH) domain-containing protein vs. Planmine SMEST
Match: SMESG000017288.1 (SMESG000017288.1)

HSP 1 Score: 247.669 bits (631), Expect = 3.740e-77
Identity = 119/120 (99.17%), Postives = 119/120 (99.17%), Query Frame = 3
Query:    3 KVQVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            KVQVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAK FGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV
Sbjct: 2764 KVQVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKVFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 2883          

HSP 2 Score: 219.164 bits (557), Expect = 3.416e-67
Identity = 104/120 (86.67%), Postives = 110/120 (91.67%), Query Frame = 3
Query:    3 KVQVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            KVQVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAK FGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDK+G  +P+KS  QPNGT+ FVY PK   +HV+QV
Sbjct: 1958 KVQVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKVFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKQGNSVPVKSTKQPNGTETFVYTPKRNEDHVVQV 2077          

HSP 3 Score: 219.164 bits (557), Expect = 3.416e-67
Identity = 104/120 (86.67%), Postives = 110/120 (91.67%), Query Frame = 3
Query:    3 KVQVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            KVQVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAK FGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDK+G  +P+KS  QPNGT+ FVY PK   +HV+QV
Sbjct: 2361 KVQVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKVFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKQGNSVPVKSTKQPNGTETFVYTPKRNEDHVVQV 2480          

HSP 4 Score: 99.7525 bits (247), Expect = 1.938e-25
Identity = 52/117 (44.44%), Postives = 66/117 (56.41%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V+Y P LPGEY+V VLCN  DI+ SPFM  I+     K D TK KAFGPG+E K + ++KET FTVD ++ G        C D  G  +P+K     N T    Y  K  G+H I +
Sbjct:  792 VQYFPVLPGEYAVHVLCNKEDIKGSPFMAQISDVPTVKFDATKVKAFGPGLEPKGVQINKETNFTVDIKNAGAPAEVKTLCIDINGNEVPIKITDNHNSTFTCTYTTKLIGKHTIYI 908          

HSP 5 Score: 85.5001 bits (210), Expect = 2.112e-20
Identity = 47/119 (39.50%), Postives = 64/119 (53.78%), Query Frame = 3
Query:    6 VQVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            + V+YLP   GEY V VL N+ +I  SPF V I  AL       K KA+GPG+++  +   K T FTVD+   GP+   + KCYDK G  +P+++    N      Y P   G+H I V
Sbjct: 1571 IGVQYLPVEKGEYIVHVLSNNEEIPKSPFAVDIENALESSVHPEKVKAYGPGLQTPGVVQGKPTQFTVDSTQTGPLKSVMVKCYDKDGILVPIQTNPVSNQVTTNTYNPTKPGKHTISV 1689          

HSP 6 Score: 80.1073 bits (196), Expect = 1.891e-18
Identity = 45/119 (37.82%), Postives = 61/119 (51.26%), Query Frame = 3
Query:    6 VQVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V V Y P  PGE++V +  N+ DI  SP+MV  T ++  K D  K K FGPGIE       K+  FTVD +      P   KC+D  GT +P++    P+ T    Y P +  +H I V
Sbjct: 1179 VSVVYHPTKPGEHAVHITANEQDIPKSPYMVMATESITPKGDNNKIKVFGPGIEPNGNVTGKQANFTVDAKAYKDKKPVETKCFDSDGTIIPVQVVENPDFTYSCTYTPLTAKKHTIYV 1297          

HSP 7 Score: 46.2098 bits (108), Expect = 1.197e-6
Identity = 35/117 (29.91%), Postives = 50/117 (42.74%), Query Frame = 3
Query:   18 YLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGI--ESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            Y+PE  G   + V  N S I  SPF   +    +    + K K  G GI   +  +       F VDT+D G     +   ++  G P+PL  E +PNG     Y+    G+H I V
Sbjct: 3731 YVPEELGPCLIDVKYNKSPISGSPFKTNV----VQPAQVEKVKVDGDGIIPPNGAILASMPAVFHVDTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISV 3843          

HSP 8 Score: 45.8246 bits (107), Expect = 1.452e-6
Identity = 36/119 (30.25%), Postives = 50/119 (42.02%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDK--RGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V Y   +PG Y++ VL ++  I  SP +VP+ P      DL+   A GPG+  + +  D    FTVD  +  P      K   +   G       +   NG     Y P  EG H I V
Sbjct: 3433 VVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSPNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINV 3551          
BLAST of Calponin-homology (CH) domain-containing protein vs. Planmine SMEST
Match: SMESG000064795.1 (SMESG000064795.1)

HSP 1 Score: 77.411 bits (189), Expect = 1.444e-17
Identity = 38/115 (33.04%), Postives = 65/115 (56.52%), Query Frame = 3
Query:   18 YLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            Y P  PGEY+V +LC+  DI NSP+M  I P+  +K D++K K +GPG++ + + ++    FT+D  +    +   A C+   G  +P+   +  N   + VY+P ++G H + V
Sbjct:  608 YWPTAPGEYAVHILCDGEDIPNSPYMANIMPSN-EKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFV 721          
BLAST of Calponin-homology (CH) domain-containing protein vs. Planmine SMEST
Match: SMESG000011386.1 (SMESG000011386.1)

HSP 1 Score: 72.7886 bits (177), Expect = 5.959e-16
Identity = 43/121 (35.54%), Postives = 64/121 (52.89%), Query Frame = 3
Query:    6 VQVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDK--CDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
              V Y P +PGEY+V +LC+D +I  SP+M  I    LD    D  K  A+GPG+ S  +  +K   F V+T++ G      A+C+D  G  +P++     +GT    Y PK  G+H + V
Sbjct:  632 ANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQ---LDTKLFDPLKVTAYGPGLISG-ISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIV 748          

HSP 2 Score: 58.9214 bits (141), Expect = 4.346e-11
Identity = 41/125 (32.80%), Postives = 58/125 (46.40%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKC---DLTKAKAFGPGIESKPLPVDKETTFTV-----DTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEGEHVIQV 362
            V YLP+ PG Y V VL ND  I++SPF V I P         D+ K  A+GPG+    +  D  + FTV     D    G V   +   +++R T      +   +GT    Y P  +G+H I +
Sbjct: 1094 VNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRST---CTVDNNHDGTYSCSYSPAVDGQHKIDI 1215          

HSP 3 Score: 55.0694 bits (131), Expect = 8.528e-10
Identity = 30/72 (41.67%), Postives = 39/72 (54.17%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCG 227
            V+YLP+ PG Y V +  N+  I  SPF VPI     D  D++K K +GPG+E     V   + FTVD    G
Sbjct: 1294 VQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIH----DIVDISKVKCYGPGLERNGSRVFTPSQFTVDASKAG 1361          

HSP 4 Score: 49.2914 bits (116), Expect = 9.098e-8
Identity = 38/119 (31.93%), Postives = 55/119 (46.22%), Query Frame = 3
Query:   18 YLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKC--YDKRGTPLPLKSETQPNGTQQFV--YKPKSEGEHVIQV 362
            Y+P + GEY + +   +S+I NSPF V +  A     D +K  A GPGIE     V + T F V T + G   P    C   D +G    +K +       +++  Y  K EG H + V
Sbjct:  345 YIPTMEGEYRIIIKFANSEIPNSPFKVNVKNA---AGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAG---PGSVDCVILDTKGRKDSVKPKITKQSENKYLIEYTTKEEGLHSVNV 457          

HSP 5 Score: 46.2098 bits (108), Expect = 1.116e-6
Identity = 33/117 (28.21%), Postives = 59/117 (50.43%), Query Frame = 3
Query:   15 EYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKSEG-EHVIQV 362
             Y P++PG+++V V   + +I  SPF V +    ++  +    K +GPGIE     +  ET F VD +  G     ++   D++   +P+ ++   +GT    Y PK+ G  + IQ+
Sbjct:  735 RYTPKIPGKHTVIVSYGNVNIPESPFKVNV----IEAGNAANIKVYGPGIERAKTNI--ETYFVVDCKLAGSGDIGIS-VLDEKMRDVPVVTDDNGDGTFTIKYTPKTTGPTYTIQI 844          
BLAST of Calponin-homology (CH) domain-containing protein vs. Planmine SMEST
Match: SMESG000050428.1 (SMESG000050428.1)

HSP 1 Score: 65.0846 bits (157), Expect = 3.486e-13
Identity = 34/110 (30.91%), Postives = 62/110 (56.36%), Query Frame = 3
Query:   12 VEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAFGPGIESKPLPVDKETTFTVDTRDC-GPVVPAVAKCYDKRGTPLPLKSETQPNGTQQFVYKPKS 338
            V Y P   GEY++ +LC+D DI+NSPFM+ +     ++ + +K K +GP +    L + + TTFT+D  +  G +   + KCYD+ GT + +    + +  + + + P +
Sbjct:  525 VIYWPISIGEYAIHILCDDQDIKNSPFMIDVRKR-DNEFNSSKVKVYGPALNESFLTIGQLTTFTIDIAESKGILDKLMVKCYDRFGTTILINITKESSNQRTYSFIPNT 633          
The following BLAST results are available for this feature:
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FLNC2.813e-1641.18filamin C [Source:HGNC Symbol;Acc:HGNC:3756][more]
FLNC3.012e-1641.18filamin C [Source:HGNC Symbol;Acc:HGNC:3756][more]
FLNB2.173e-1435.59filamin B [Source:HGNC Symbol;Acc:HGNC:3755][more]
FLNB2.281e-1435.59filamin B [Source:HGNC Symbol;Acc:HGNC:3755][more]
FLNB2.373e-1435.59filamin B [Source:HGNC Symbol;Acc:HGNC:3755][more]
back to top
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fln-11.489e-636.13FiLamiN (Actin binding protein) homolog [Source:U... [more]
fln-11.489e-636.13FiLamiN (Actin binding protein) homolog [Source:U... [more]
fln-11.532e-636.13FiLamiN (Actin binding protein) homolog [Source:U... [more]
fln-11.547e-636.13FiLamiN (Actin binding protein) homolog [Source:U... [more]
fln-11.547e-636.13FiLamiN (Actin binding protein) homolog [Source:U... [more]
back to top
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cher9.900e-1636.75gene:FBgn0014141 transcript:FBtr0089471[more]
cher1.010e-1536.75gene:FBgn0014141 transcript:FBtr0303364[more]
cher1.012e-1536.75gene:FBgn0014141 transcript:FBtr0337102[more]
cher1.032e-1536.75gene:FBgn0014141 transcript:FBtr0290014[more]
cher1.032e-1536.75gene:FBgn0014141 transcript:FBtr0337100[more]
back to top
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
flna4.185e-1940.17filamin A, alpha (actin binding protein 280) [Sour... [more]
CR352234.34.350e-1940.17filamin A, alpha (actin binding protein 280) [Sour... [more]
CR352234.24.350e-1940.17filamin A, alpha (actin binding protein 280) [Sour... [more]
flnca4.644e-1740.34filamin C, gamma a (actin binding protein 280) [So... [more]
flnca4.971e-1740.34filamin C, gamma a (actin binding protein 280) [So... [more]
back to top
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FLNB2.008e-1839.50filamin B [Source:NCBI gene;Acc:100485165][more]
FLNB2.107e-1839.50filamin B [Source:NCBI gene;Acc:100485165][more]
FLNB2.149e-1839.50filamin B [Source:NCBI gene;Acc:100485165][more]
FLNB2.149e-1839.50filamin B [Source:NCBI gene;Acc:100485165][more]
FLNB2.168e-1839.50filamin B [Source:NCBI gene;Acc:100485165][more]
back to top
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Flnc2.415e-1641.18filamin C, gamma [Source:MGI Symbol;Acc:MGI:95557][more]
Flnc2.793e-1641.18filamin C, gamma [Source:MGI Symbol;Acc:MGI:95557][more]
Flnb5.094e-1635.59filamin, beta [Source:MGI Symbol;Acc:MGI:2446089][more]
Flna7.053e-1436.75filamin, alpha [Source:MGI Symbol;Acc:MGI:95556][more]
Flna7.191e-1436.75filamin, alpha [Source:MGI Symbol;Acc:MGI:95556][more]
back to top
BLAST of Calponin-homology (CH) domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q14315|FLNC_HUMAN1.446e-1541.18Filamin-C OS=Homo sapiens OX=9606 GN=FLNC PE=1 SV=... [more]
sp|Q8VHX6|FLNC_MOUSE1.689e-1541.18Filamin-C OS=Mus musculus OX=10090 GN=Flnc PE=1 SV... [more]
sp|Q80X90|FLNB_MOUSE3.563e-1535.59Filamin-B OS=Mus musculus OX=10090 GN=Flnb PE=1 SV... [more]
sp|D3ZHA0|FLNC_RAT4.248e-1539.50Filamin-C OS=Rattus norvegicus OX=10116 GN=Flnc PE... [more]
sp|Q9VEN1|FLNA_DROME9.924e-1536.75Filamin-A OS=Drosophila melanogaster OX=7227 GN=ch... [more]
back to top
BLAST of Calponin-homology (CH) domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A448WIZ91.137e-2241.03Uncharacterized protein (Fragment) OS=Protopolysto... [more]
A0A183QDA92.315e-2044.44Uncharacterized protein OS=Schistosoma rodhaini OX... [more]
A0A5K4E8T72.335e-2044.44Filamin OS=Schistosoma mansoni OX=6183 PE=4 SV=1[more]
A0A430PXY82.391e-2044.44Filamin (Fragment) OS=Schistosoma bovis OX=6184 GN... [more]
A0A5K4E8732.451e-2044.44Filamin OS=Schistosoma mansoni OX=6183 PE=4 SV=1[more]
back to top
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
flna1.538e-1940.17filamin A, alpha (actin binding protein 280) [Sour... [more]
FLNB1.294e-1535.59filamin B [Source:NCBI gene;Acc:103028460][more]
flnca3.483e-1537.82filamin-C [Source:NCBI gene;Acc:103033794][more]
flnca3.590e-1537.82filamin-C [Source:NCBI gene;Acc:103033794][more]
flnca3.625e-1537.82filamin-C [Source:NCBI gene;Acc:103033794][more]
back to top
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000001908.11.633e-1535.83pep scaffold:Pmarinus_7.0:GL483086:279:38879:-1 ge... [more]
ENSPMAT00000001912.11.177e-1244.44pep scaffold:Pmarinus_7.0:GL483086:7328:38879:-1 g... [more]
ENSPMAT00000004210.11.654e-728.70pep scaffold:Pmarinus_7.0:GL476636:147693:235244:1... [more]
ENSPMAT00000004223.11.675e-728.70pep scaffold:Pmarinus_7.0:GL476636:147693:235187:1... [more]
ENSPMAT00000004195.11.830e-728.70pep scaffold:Pmarinus_7.0:GL476636:147693:235244:1... [more]
back to top
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO469471.699e-1638.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
flna1.033e-1739.32filamin-A [Source:NCBI gene;Acc:101173301][more]
flna1.074e-1739.32filamin-A [Source:NCBI gene;Acc:101173301][more]
flna1.084e-1739.32filamin-A [Source:NCBI gene;Acc:101173301][more]
flna1.095e-1739.32filamin-A [Source:NCBI gene;Acc:101173301][more]
flnc2.196e-1536.97filamin C [Source:NCBI gene;Acc:101165476][more]
back to top
BLAST of Calponin-homology (CH) domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017288.12.963e-7799.17SMESG000017288.1[more]
SMESG000017288.13.740e-7799.17SMESG000017288.1[more]
SMESG000064795.11.444e-1733.04SMESG000064795.1[more]
SMESG000011386.15.959e-1635.54SMESG000011386.1[more]
SMESG000050428.13.486e-1330.91SMESG000050428.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032160 ID=SMED30032160|Name=Calponin-homology (CH) domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=362bp
GAAAGGTTCAAGTCGAATACCTACCAGAATTGCCTGGCGAATACAGCGTT
AGAGTTCTCTGCAACGATAGTGATATCCAAAACTCTCCATTCATGGTACC
CATCACTCCAGCCTTGCTAGACAAATGCGACCTGACCAAGGCCAAGGCAT
TTGGTCCTGGAATCGAATCTAAACCTTTACCAGTTGATAAGGAGACCACA
TTTACAGTGGACACTCGGGATTGTGGACCAGTAGTACCAGCAGTGGCTAA
ATGTTATGACAAACGTGGAACACCACTTCCTCTGAAATCTGAAACACAAC
CAAATGGCACCCAGCAGTTTGTTTATAAACCAAAGTCTGAAGGGGAACAT
GTTATCCAAGTA
back to top

protein sequence of SMED30032160-orf-1

>SMED30032160-orf-1 ID=SMED30032160-orf-1|Name=SMED30032160-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=120bp
KVQVEYLPELPGEYSVRVLCNDSDIQNSPFMVPITPALLDKCDLTKAKAF
GPGIESKPLPVDKETTFTVDTRDCGPVVPAVAKCYDKRGTPLPLKSETQP
NGTQQFVYKPKSEGEHVIQV
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000428musculature system
PLANA:0000478pharynx musculature
Vocabulary: INTERPRO
TermDefinition
IPR001298Filamin/ABP280_rpt
IPR013783Ig-like_fold
IPR017868Filamin/ABP280_repeat-like
IPR014756Ig_E-set
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001298Filamin/ABP280 repeatSMARTSM00557flmn_3coord: 43..120
e-value: 0.0058
score: 11.8
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 42..120
e-value: 2.6E-13
score: 51.7
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 1..41
e-value: 4.3E-9
score: 38.2
IPR017868Filamin/ABP280 repeat-likePFAMPF00630Filamincoord: 42..120
e-value: 2.5E-7
score: 31.5
IPR017868Filamin/ABP280 repeat-likePROSITEPS50194FILAMIN_REPEATcoord: 1..34
score: 12.917
IPR017868Filamin/ABP280 repeat-likePROSITEPS50194FILAMIN_REPEATcoord: 39..120
score: 15.465
NoneNo IPR availablePANTHERPTHR38537FAMILY NOT NAMEDcoord: 2..120
NoneNo IPR availablePANTHERPTHR38537:SF8FILAMIN-Acoord: 2..120
IPR014756Immunoglobulin E-setSUPERFAMILYSSF81296E set domainscoord: 33..120
IPR014756Immunoglobulin E-setSUPERFAMILYSSF81296E set domainscoord: 3..36