slc6a-22

Overview
Nameslc6a-22 (AKN21442.1)
Smed IDSMED30032156
Length (bp)1960
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc6a-22 (SMED30032156) t-SNE clustered cells

Violin plots show distribution of expression levels for slc6a-22 (SMED30032156) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc6a-22 (SMED30032156) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc6a-22 (SMED30032156) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032156

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30032156SMESG000005685.1 dd_Smed_v4_12115_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30032156SMESG000005685.1 dd_Smed_v4_12115_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc6a-22 vs. Ensembl Human
Match: SLC6A5 (solute carrier family 6 member 5 [Source:HGNC Symbol;Acc:HGNC:11051])

HSP 1 Score: 184.882 bits (468), Expect = 5.887e-49
Identity = 169/611 (27.66%), Postives = 281/611 (45.99%), Query Frame = 2
Query:  131 TAYMNSNCENLDTNEDHLENSNPQR--ISQRFDYXXXXXXXXXXXXXXXKTPYLV-HKYTAAFFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWGCSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPW--------SPEAMQ--------------------------TPDPNLSSQRFLEYQGFKTINATGT-------LKIGLPV-------WEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFL--RISDLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYL-NLKKFNFQILKDTTNLGVGFIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSILELFSKNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLCTALLVTIMMLVLYKGTEISTDINFMLSNDPITLKIWKKIKWYFIVLWYGPVQIVLMIFLVYKIYIFGEHPFTFYVNSQVYNYTSSELAGGWFIGSCVPLSVLITIGIYLMKFKGPLVKRLKGLLNQNENDKP 1801
            T+ +  +   + T ED   + N  R   S + D+IL M+GY VG+G + + PYL       AF IPY +   + GLP+F LEV +GQ  S+G +  W   P L+  G+ M+ ++V   I Y + + + L Y F +F S LPW        +PE                             T  PN++   F   Q  KT  +          LKI   +       W + LC    W ++  +   GI    KVVYFT T  YV + IL++  ++L G+  G+ YF+  +   L +  +W DAA QI   LS A GG++  SS+ +   N   +TLI+T  + +TSI A     +  G++ N +K N + + D    G+ F+  P+ ++ +P + F+A +++++L+T+G DT    +  +  SI + F K     +   T+G C   FI+  P+   GG+Y+F L DT++ S+  +  A+   + +  +Y       DI  M+   P    I+ K+ W F+         +L   L +  Y +   P T+      Y Y +  +  GW + +C  + + I   I +    G  ++RLK + +   +  P
Sbjct:  167 TSVLPGSVATVATQEDEQGDENKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVISDHPKIQIKNSTFCMTAYPNVTMVNFTS-QANKTFVSGSEEYFKYFVLKISAGIEYPGEIRWPLALCLFLAWVIVYASLAKGIKTSGKVVYFTATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQ-GPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPKYLRTHKPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGLQRFCEDIEMMIGFQP---NIFWKVCWAFV------TPTILTFILCFSFYQW--EPMTY----GSYRYPNWSMVLGWLMLACSVIWIPIMFVIKMHLAPGRFIERLKLVCSPQPDWGP 760          
BLAST of slc6a-22 vs. Ensembl Human
Match: SLC6A2 (solute carrier family 6 member 2 [Source:HGNC Symbol;Acc:HGNC:11048])

HSP 1 Score: 172.555 bits (436), Expect = 2.767e-45
Identity = 152/578 (26.30%), Postives = 271/578 (46.89%), Query Frame = 2
Query:  272 KTPYLVHKYTA-AFFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWGCSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPWSPEAMQTPDPNLSSQRFL---------EYQGFKTINA--------------TGTLKIGLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFLRIS--DLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYL-NLKKFNFQILKDTTNLGVGFIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSILELFSKNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLCTALLVTIMMLVLYKGTEISTDINFMLSNDPITLKIWKKIKWYFI----VLWYGPVQIVLMIFLVYKIYIFGEHPFTFYVNSQVYNYTSSELAGGWFIGSCVPLSVLITIGIYLM-KF---KGPLVKRLKGLLNQNENDKPWYPVSPNDKNDLLAFKKVT*INI*SIQETRIFT 1900
            + PYL +K    AF IPYT+F  I G+PLF +E+ +GQ    G    W   P  K +G  ++ + +     Y + + W+L Y F +F  NLPW+        PN +  + L         +Y  +K   A              +G   IGLP W+++LC + +  +L  +   G+    KVV+ T T+ Y  +F+L+VH ++L G+ +G+  +L I    L    +W DAA QI   L    G ++ F+S+ +   N   + L+ + ++  TS ++     +  GY+ +  K N + +  T   G+ FI  P+ IST+  + F+A V++++L+ +G D+++G +  V   + + F      ++ + T G+   +F++++     GG+Y+  L DTF+   + L   L+  I +   Y     S DI  M+   P    ++ ++ W F+    +L+   V I+    L Y  YIF   P+  +V              GW I     LS ++ + IY++ KF   +G L +RL             Y ++P +++ L+A + +    + + Q  R  T
Sbjct:   81 RFPYLCYKNGGGAFLIPYTLFLIIAGMPLFYMELALGQYNREGAATVWKICPFFKGVGYAVILIALYVGFYYNVIIAWSLYYLFSSFTLNLPWTDCGHTWNSPNCTDPKLLNGSVLGNHTKYSKYKFTPAAEFYERGVLHLHESSGIHDIGLPQWQLLLCLMVVVIVLYFSLWKGVKTSGKVVWITATLPYFVLFVLLVHGVTLPGASNGINAYLHIDFYRLKEATVWIDAATQIFFSLGAGFGVLIAFASYNKFDNNCYRDALLTSSINCITSFVSGFAIFSILGYMAHEHKVNIEDVA-TEGAGLVFILYPEAISTLSGSTFWAVVFFVMLLALGLDSSMGGMEAVITGLADDFQVLKRHRKLF-TFGVTFSTFLLALFCITKGGIYVLTLLDTFAAGTSILFAVLMEAIGVSWFYGVDRFSNDIQQMMGFRP---GLYWRLCWKFVSPAFLLFVVVVSIINFKPLTYDDYIF--PPWANWV--------------GWGIA----LSSMVLVPIYVIYKFLSTQGSLWERLA------------YGITPENEHHLVAQRDIRQFQMKTRQGRRRAT 621          
BLAST of slc6a-22 vs. Ensembl Human
Match: SLC6A2 (solute carrier family 6 member 2 [Source:HGNC Symbol;Acc:HGNC:11048])

HSP 1 Score: 171.014 bits (432), Expect = 6.611e-45
Identity = 154/592 (26.01%), Postives = 283/592 (47.80%), Query Frame = 2
Query:  188 NSNPQRI-SQRFDYXXXXXXXXXXXXXXXKTPYLVHKYTA-AFFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWGCSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPWSPEAMQTPDPNLSSQRFL---------EYQGFKTINA--------------TGTLKIGLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFLRIS--DLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYL-NLKKFNFQILKDTTNLGVGFIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSILELFSKNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLCTALLVTIMMLVLYKGTEISTDINFMLSNDPITLKIWKKIKWYFI----VLWYGPVQIVLMIFLVYKIYIFGEHPFTFYVNSQVYNYTSSELAGGWFIGSCVPLSVLITIGIYLM-KF---KGPLVKRLKGLLNQNENDKPWYPVSPNDKNDLLAFKKV 1855
            ++ P+    ++ D++L ++G+ V +  + + PYL +K    AF IPYT+F  I G+PLF +E+ +GQ    G    W   P  K +G  ++ + +     Y + + W+L Y F +F  NLPW+        PN +  + L         +Y  +K   A              +G   IGLP W+++LC + +  +L  +   G+    KVV+ T T+ Y  +F+L+VH ++L G+ +G+  +L I    L    +W DAA QI   L    G ++ F+S+ +   N   + L+ + ++  TS ++     +  GY+ +  K N + +  T   G+ FI  P+ IST+  + F+A V++++L+ +G D+++G +  V   + + F      ++ + T G+   +F++++     GG+Y+  L DTF+   + L   L+  I +   Y     S DI  M+   P    ++ ++ W F+    +L+   V I+    L Y  YIF   P+  +V              GW I     LS ++ + IY++ KF   +G L +RL             Y ++P +++ L+A + +
Sbjct:   52 DAQPRETWGKKIDFLLSVVGFAVDLANVWRFPYLCYKNGGGAFLIPYTLFLIIAGMPLFYMELALGQYNREGAATVWKICPFFKGVGYAVILIALYVGFYYNVIIAWSLYYLFSSFTLNLPWTDCGHTWNSPNCTDPKLLNGSVLGNHTKYSKYKFTPAAEFYERGVLHLHESSGIHDIGLPQWQLLLCLMVVVIVLYFSLWKGVKTSGKVVWITATLPYFVLFVLLVHGVTLPGASNGINAYLHIDFYRLKEATVWIDAATQIFFSLGAGFGVLIAFASYNKFDNNCYRDALLTSSINCITSFVSGFAIFSILGYMAHEHKVNIEDVA-TEGAGLVFILYPEAISTLSGSTFWAVVFFVMLLALGLDSSMGGMEAVITGLADDFQVLKRHRKLF-TFGVTFSTFLLALFCITKGGIYVLTLLDTFAAGTSILFAVLMEAIGVSWFYGVDRFSNDIQQMMGFRP---GLYWRLCWKFVSPAFLLFVVVVSIINFKPLTYDDYIF--PPWANWV--------------GWGIA----LSSMVLVPIYVIYKFLSTQGSLWERLA------------YGITPENEHHLVAQRDI 606          
BLAST of slc6a-22 vs. Ensembl Human
Match: SLC6A2 (solute carrier family 6 member 2 [Source:HGNC Symbol;Acc:HGNC:11048])

HSP 1 Score: 171.014 bits (432), Expect = 6.611e-45
Identity = 154/592 (26.01%), Postives = 283/592 (47.80%), Query Frame = 2
Query:  188 NSNPQRI-SQRFDYXXXXXXXXXXXXXXXKTPYLVHKYTA-AFFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWGCSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPWSPEAMQTPDPNLSSQRFL---------EYQGFKTINA--------------TGTLKIGLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFLRIS--DLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYL-NLKKFNFQILKDTTNLGVGFIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSILELFSKNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLCTALLVTIMMLVLYKGTEISTDINFMLSNDPITLKIWKKIKWYFI----VLWYGPVQIVLMIFLVYKIYIFGEHPFTFYVNSQVYNYTSSELAGGWFIGSCVPLSVLITIGIYLM-KF---KGPLVKRLKGLLNQNENDKPWYPVSPNDKNDLLAFKKV 1855
            ++ P+    ++ D++L ++G+ V +  + + PYL +K    AF IPYT+F  I G+PLF +E+ +GQ    G    W   P  K +G  ++ + +     Y + + W+L Y F +F  NLPW+        PN +  + L         +Y  +K   A              +G   IGLP W+++LC + +  +L  +   G+    KVV+ T T+ Y  +F+L+VH ++L G+ +G+  +L I    L    +W DAA QI   L    G ++ F+S+ +   N   + L+ + ++  TS ++     +  GY+ +  K N + +  T   G+ FI  P+ IST+  + F+A V++++L+ +G D+++G +  V   + + F      ++ + T G+   +F++++     GG+Y+  L DTF+   + L   L+  I +   Y     S DI  M+   P    ++ ++ W F+    +L+   V I+    L Y  YIF   P+  +V              GW I     LS ++ + IY++ KF   +G L +RL             Y ++P +++ L+A + +
Sbjct:   52 DAQPRETWGKKIDFLLSVVGFAVDLANVWRFPYLCYKNGGGAFLIPYTLFLIIAGMPLFYMELALGQYNREGAATVWKICPFFKGVGYAVILIALYVGFYYNVIIAWSLYYLFSSFTLNLPWTDCGHTWNSPNCTDPKLLNGSVLGNHTKYSKYKFTPAAEFYERGVLHLHESSGIHDIGLPQWQLLLCLMVVVIVLYFSLWKGVKTSGKVVWITATLPYFVLFVLLVHGVTLPGASNGINAYLHIDFYRLKEATVWIDAATQIFFSLGAGFGVLIAFASYNKFDNNCYRDALLTSSINCITSFVSGFAIFSILGYMAHEHKVNIEDVA-TEGAGLVFILYPEAISTLSGSTFWAVVFFVMLLALGLDSSMGGMEAVITGLADDFQVLKRHRKLF-TFGVTFSTFLLALFCITKGGIYVLTLLDTFAAGTSILFAVLMEAIGVSWFYGVDRFSNDIQQMMGFRP---GLYWRLCWKFVSPAFLLFVVVVSIINFKPLTYDDYIF--PPWANWV--------------GWGIA----LSSMVLVPIYVIYKFLSTQGSLWERLA------------YGITPENEHHLVAQRDI 606          
BLAST of slc6a-22 vs. Ensembl Human
Match: SLC6A2 (solute carrier family 6 member 2 [Source:HGNC Symbol;Acc:HGNC:11048])

HSP 1 Score: 168.318 bits (425), Expect = 2.923e-44
Identity = 133/503 (26.44%), Postives = 243/503 (48.31%), Query Frame = 2
Query:  188 NSNPQRI-SQRFDYXXXXXXXXXXXXXXXKTPYLVHKYTA-AFFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWGCSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPWSPEAMQTPDPNLSSQRFL---------EYQGFKTINA--------------TGTLKIGLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFLRIS--DLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYL-NLKKFNFQILKDTTNLGVGFIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSILELFSKNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLCTALLVTIMMLVLYKGTEISTDINFMLSNDPITLKIWKKIKWYFIVLWYGPVQIVLMIFLVYKIYIFGEH 1612
            ++ P+    ++ D++L ++G+ V +  + + PYL +K    AF IPYT+F  I G+PLF +E+ +GQ    G    W   P  K +G  ++ + +     Y + + W+L Y F +F  NLPW+        PN +  + L         +Y  +K   A              +G   IGLP W+++LC + +  +L  +   G+    KVV+ T T+ Y  +F+L+VH ++L G+ +G+  +L I    L    +W DAA QI   L    G ++ F+S+ +   N   + L+ + ++  TS ++     +  GY+ +  K N + +  T   G+ FI  P+ IST+  + F+A V++++L+ +G D+++G +  V   + + F      ++ + T G+   +F++++     GG+Y+  L DTF+   + L   L+  I +   Y     S DI  M+   P    ++ ++ W F       V    ++ L Y I    EH
Sbjct:   52 DAQPRETWGKKIDFLLSVVGFAVDLANVWRFPYLCYKNGGGAFLIPYTLFLIIAGMPLFYMELALGQYNREGAATVWKICPFFKGVGYAVILIALYVGFYYNVIIAWSLYYLFSSFTLNLPWTDCGHTWNSPNCTDPKLLNGSVLGNHTKYSKYKFTPAAEFYERGVLHLHESSGIHDIGLPQWQLLLCLMVVVIVLYFSLWKGVKTSGKVVWITATLPYFVLFVLLVHGVTLPGASNGINAYLHIDFYRLKEATVWIDAATQIFFSLGAGFGVLIAFASYNKFDNNCYRDALLTSSINCITSFVSGFAIFSILGYMAHEHKVNIEDVA-TEGAGLVFILYPEAISTLSGSTFWAVVFFVMLLALGLDSSMGGMEAVITGLADDFQVLKRHRKLF-TFGVTFSTFLLALFCITKGGIYVLTLLDTFAAGTSILFAVLMEAIGVSWFYGVDRFSNDIQQMMGFRP---GLYWRLCWKF-------VSPAFLLRLAYGITPENEH 542          
BLAST of slc6a-22 vs. Ensembl Celegans
Match: dat-1 (Sodium-dependent dopamine transporter [Source:UniProtKB/Swiss-Prot;Acc:Q03614])

HSP 1 Score: 144.436 bits (363), Expect = 3.703e-36
Identity = 128/480 (26.67%), Postives = 232/480 (48.33%), Query Frame = 2
Query:  185 ENSNPQR--ISQRFDYXXXXXXXXXXXXXXXKTPYLVHKYTAA-FFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWG-CSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPW--------SPE-----------AM-QTPDPNLSSQRFLE-----YQGF---KTINATGT------LKIGLPVWEIVLCSLAIWFLLCLAAIY-GIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFLR--ISDLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYLNLKKFNFQILKDTTNLGVGFIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSILELFSKNNYDKEAYVTIGICAISF--IVSIPLCASGGLYLFPLFDTFSNSWTKLCTALLVTIMMLVLYKGTEISTDINFMLSNDP 1495
            E  +P R   S + D++L ++G+ V +G I + PYL  K     F IPY+I   + G+PLF +E+ +GQ   +G I  WG   PL K +G  ++         Y + + W L Y + +F+ NLPW        SP            AM ++ + ++S+++        Y+GF      NA  +        +G   W+I L SL + +L+C  +++ GIH   KVV+FT    YV + IL +  ++L G  +G++Y+LR     L   ++W DAA Q+   L    G +M +SS+     N+ V+ L  +F++ +TS L+     +  GY++ K             G+ F+  P+ +ST+P A F++ +++++L+T+G D++ G    +   + + F     ++E +V    C  +F  ++ I +C  GG+ +      +  +W  L       +++  +Y   +   D+  M+   P
Sbjct:   34 EPKDPAREQWSGKLDFLLSVVGFAVDLGNIWRFPYLCFKNGGGVFLIPYSIMVLLTGVPLFYMELCLGQYYRKGAITTWGRICPLFKGIGYCVILTAFYVDFFYNVILAWGLHYLYTSFSFNLPWASCNNSYNSPACYEPHWSEDGTAMCRSANQSVSAEKISAAEEYFYKGFLGLHEANAPNSHVIRSVTDLGNVRWDIAL-SLFVVYLICYFSMWKGIHTSGKVVWFTALFPYVVLGILFIRGVTLPGWQNGIEYYLRPNFEMLKRPSVWQDAATQVFFSLGPGFGVLMAYSSYNDFHNNVYVDALFTSFINCATSFLSGFVIFSVLGYMSCKSGKPIEAVAQEGPGLVFVVYPEALSTMPYAPFWSVLFFLMLMTLGLDSSFGGSEAIITGLSDEFPILKKNREVFVG---CLFAFYMVIGIAMCTEGGILIMEWLIIYGTTWGLLIAVFCEAMVIAYIYGLRQFVHDVKEMMGFRP 509          
BLAST of slc6a-22 vs. Ensembl Celegans
Match: snf-3 (Sodium- and chloride-dependent betaine transporter [Source:UniProtKB/Swiss-Prot;Acc:G5EBN9])

HSP 1 Score: 137.502 bits (345), Expect = 5.594e-34
Identity = 145/598 (24.25%), Postives = 274/598 (45.82%), Query Frame = 2
Query:  143 NSNCENLDTNEDHLENSNPQRISQRFDYXXXXXXXXXXXXXXXKTPYLVHKYTA-AFFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWGCSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPWSP-----------------------EAMQTPDPNLSSQRFLEYQGFKTINATGTL-KIGLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFLR--ISDLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYLN--LKKFNFQILKDTTNLGVGFIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSILELFS-KNNYDKEAYVTIGI-CAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLCTALLVTIMMLVLYKGTE-ISTDINFMLSNDPITLKIWKKIKWYFIVLWYGPVQIVLMIFLVYKIYIFGEHPFTFYVNSQVYNYTSSELAGGWFIGSCVPLSVLITIGIYLMKFKGP---LVKRLKGLLNQNENDKPWYPVSPNDKN 1831
             +  + L+ ++ H E  +  + + +FD+++ M+ Y VG+G + + PYL +K    +F + Y IF+ +  +P+FL+EV VGQ   +G +E W   PL + +G+G V +    +  + + V WA+ Y   +     PW                         +A+       +     ++   + ++ TG + + G   WE+     A W ++  A   GI    K VYF     YV IFIL++  ++LEG+  G+ ++L+   + L + A+W DA  Q+     +  G ++   S  +   N   + + + F++  TSI A     +  GY++   +K   +I+K    +G+ F+A P+V S +P    FA ++++++  +G D+ +  +  +  ++ + F     Y K+   ++GI C   F + IP+    G +   LFD +  S   L   +   ++ L    G   I   ++ M+    +TL    +  W F         +VL +F V  +Y    HP   Y + + + + ++  A GWF+ SC  + V+    IY + F      L +R++  LN + + +     SP  KN
Sbjct:   13 EAKAKELEQSQ-HSEEPDRGQWTGKFDFLMSMVAYAVGLGNVWRFPYLCYKNGGGSFLVVYMIFFCLAAVPIFLMEVTVGQYLQKGAMEMWLMCPLFRGVGIGNVVIAFMCIAYFCVIVAWAMFYMISSIAWVFPWETCNNYWNDATCVTGKENFTELARIKALVASAGGHTQTSVEQFWEKRVLHDTGDISEFGGIQWELFFIMAAAWLIVYFALWKGITQARKFVYFCALFPYVLIFILLIRGLTLEGAGTGIYFYLKPNATRLLDTAVWKDAGTQVFYSYGVGFGALIALGSHNKFNHNCFKDAITMCFINGCTSITAGFAVFSILGYMSHVAQKDISEIVKP--GVGLAFLAYPEVASNLPMKQVFAVLFFLMITILGLDSQVCMMEGLFTALEDAFPILRKYKKQ---SLGIFCLFFFCIGIPMVTHSGSHWLTLFDAYGASGYALLFVVFFEVVGLAYGFGAHNIRKALHEMIG---VTLPKGIEYVWKFCA---PATSLVLFVFCV--VYY---HPVK-YPDGKDFPFWAN--AFGWFLSSC-SMVVIPGYAIYYLFFTNKHLTLKERVRKGLNLDGSFE-----SPAKKN 584          
BLAST of slc6a-22 vs. Ensembl Celegans
Match: snf-11 (Transporter [Source:UniProtKB/TrEMBL;Acc:G5EF43])

HSP 1 Score: 124.405 bits (311), Expect = 1.263e-29
Identity = 106/434 (24.42%), Postives = 193/434 (44.47%), Query Frame = 2
Query:  272 KTPYLVHKYTA-AFFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWGCSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFN-SNLPWS--PEAMQTPD--------PNLSSQRFLEYQGFK----------------------TINATGTLKIGLPV----------------------WEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFLR--ISDLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYLNLKKFNFQILKDTTNLGVGFIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSILELF---SKNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNS 1390
            + PYL ++    AF IPY I     G PLF+LE   GQL S G +  +   P+ K +G+    +     I Y++ + WA  Y + +F  S++PW     A  TP+        P  S++   E+   K                      T+ +   L +  PV                      W++ L  L +W +  L    G+ +  KVVY T +  Y+ +F L++  ++LEG+  GL+++L+   S L    +W DA  Q+     L  G ++   S+ +   N+    L + FV+  TS+ A     ++ G++  ++            G+ F+A P  I  +P   F++ +++++++ +G D+    +     +I++ F    +  Y +E +V + IC IS+++ +     GG Y+F LFD ++ S
Sbjct:   35 RFPYLCYQNGGGAFLIPYCISLVFCGAPLFILETSWGQLMSVGGLGMFKICPIFKGVGIAAAVMAFWLNIYYIVVLSWAATYLYNSFTMSDVPWKNCDHAWNTPNCRSEYVKIPCDSNRTIAEFFNVKVLTHDHIHEYKKQFFVGEKMNWTVCSAADLSVVSPVKEFWNHRVLGISSGLENPGGIRWDLALFLLLVWIICYLCIFKGVKWTGKVVYITASFPYMMLFCLLIRGLTLEGAGVGLEFYLKPDFSKLLESKVWVDAVTQVFFSYGLGLGALVALGSYNKFNNNVYKQALTVCFVNSGTSVFAGFVIFSFIGFMATQQEKSVAEVAQAGPGLLFLAYPSGILQLPYTQFWSCLFFLMVLFLGVDSQFCTMEGFFTAIIDEFPQIRRKKYGREIFVGV-ICVISYLIGLTTVTEGGFYVFQLFDFYAAS 467          
BLAST of slc6a-22 vs. Ensembl Celegans
Match: mod-5 (Transporter [Source:UniProtKB/TrEMBL;Acc:Q9N3C7])

HSP 1 Score: 118.627 bits (296), Expect = 1.269e-27
Identity = 124/537 (23.09%), Postives = 237/537 (44.13%), Query Frame = 2
Query:  272 KTPYLVHKYTA-AFFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECW-GCSPLLKALGVGM------VALTVNGLITYVMYVIWALRYFFLTFNSNLPWSPEAMQTPDPNLS-----------------SQRFLEYQGFKTINATGTLKIGLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFL--RISDLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYLNL---KKFNFQILKDTTNLGVGFIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSILELFSKNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLCTALLVTIMMLVLYKGTEISTDINFMLSNDPITLKIWKKIKWYFIVLWYGPVQIVLMIFLVYKIYIFGEHPFTFYVNSQVYNYTSSELAGGWFIGSCVPLSVLITIGIYLMKFKGPLVKRLKGLLNQNEN 1792
            + P + +K+   AF IPY I   I GLP+F +E+ +GQ    GC+  W    PL + +G G+      +A+  N +I   +Y  +A+      ++S +PW+        P  S                 S+ +  Y+  +   +TG   +G     + +C LA++ ++  A   G     K+V+ T T  Y+ + IL++  + L G+ +GL Y++      L + A+W+ AA QI   L    G ++  SS+     N   + +  + ++ +TS  +     +  GY++L   K  N  + +   +L   FI  PQ ++T+  + F++F+++++L+T+G D+    +        +     + +++ +V + IC I + +S P  + GG ++ P  D +  S + L       I +   Y   + S DI  ML   P           Y+ V W      + +IF++  +Y     P    +    Y +    +  GWF+     L++ +   IYL+   G L +R +  +   + 
Sbjct:  125 RFPSVCYKHGGGAFLIPYFIMLMIGGLPMFYMELVLGQFHRSGCVSIWRKVCPLFRGIGYGICCICTFIAIFYNAIIAQAVY--FAIVSLSKIWDSEVPWASCGNPWNTPRCSDDLNVTISRNGTPLTTPSEEYYLYKVLEVQKSTGFDDLGGVKTSMAVCLLAVFIMVYFALWKGPQSSGKIVWVTATAPYIILSILLIRGLLLPGAKNGLYYYVTPDFEKLKDPAVWSAAATQIFFSLGPGFGVLLALSSYNDFNNNCYRDAVTTSIINCATSFFSGCVVFSTLGYMSLLTNKPINEVVGEHDASL--IFIVYPQALATMDYSCFWSFIFFVMLITLGIDSTFAGIEAFITGFCDESRFLSKNRKWFVLV-ICIIYYFLSFPAISYGGQFVIPFLDEYGVSLSVLFIVTCEMIAVCWFYGVDQFSKDIRAMLGFYPGI---------YWRVCWTCSPVFISVIFIM-TVYNSSFKP----IQMASYTFPWWSVILGWFLRLLSVLAIPVFAIIYLLSGTGTLYERFRWAITPQQR 642          
BLAST of slc6a-22 vs. Ensembl Celegans
Match: snf-6 (Sodium-dependent acetylcholine transporter [Source:UniProtKB/Swiss-Prot;Acc:O76689])

HSP 1 Score: 116.316 bits (290), Expect = 8.626e-27
Identity = 120/495 (24.24%), Postives = 223/495 (45.05%), Query Frame = 2
Query:  185 ENSNPQRISQRFDYXXXXXXXXXXXXXXXKTPYLVHKYT-AAFFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWGCSPLLKALGVGMVALTVNGLITYVMYVI--WALRYFFLTFNSNLPWSP---------------------------------------EAMQTPDPNLSSQRFLEY-QGFKTINATGTLKIGLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFL--RISDLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGY------LNLKKFNFQILKDTTNLGVGFIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSILELFSKNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLCTALLVTIMMLVLYKGTEISTDINFMLSNDPITLKIWK 1516
            EN      S + DY+L +IG+  G+G   K P+LV ++  AAF +PY     +  LP+F +E+ +GQ +S   I  W   PL K  G+G   +T++G       +I  W L Y   +F+ ++PWS                                        E    P  +L S   L+Y Q    + + G    G   W + LC LA W  + L    G+    KVVY  + + ++ + +L+   ++L+GSL  + YFL  +   L ++ +W +AA+Q    +S   GG+   +S+ +   N+  +  ++  VD   S++ C+ + +  G+      ++L KF+   ++D  +L   F+A  + ++ +  A  +A +++I+++ +   T +  V  +  SI + + +       +V   +CA+  ++SIP C S GL+   L   F  +W  +  A L  + +  +Y    +  +  +++   P     WK
Sbjct:   60 ENRIRGNWSNKSDYLLAVIGFTAGVGSFWKFPFLVFQHGGAAFLVPYLCMLCLASLPMFFMEMVLGQFSSSAAISVWKVVPLFK--GIGFAQVTISGFFAVFFNIISAWTLFYLINSFSFSIPWSNCANSWSGENCTLGTRIQCKEMNGTLLVNGSCIVEHASSNETTVIPLHDLGSIPSLKYFQNDVLMLSKGVDDFGTLNWYLGLCVLACWIAVFLCLFQGVKSSGKVVYVAVIVPFIILTVLLTRLLTLDGSLAAVFYFLTPKWEILMDLHVWGEAAVQAFYSVSCCSGGLFTIASYSRFHNNIYKDIWLVLIVDVIVSLVGCLLTFSAIGFTCYEFAISLDKFH---IRDGFHLVFVFLA--EALAGVSVAPLYAGLFFIMILLVVHATQMFVVETIVSSICDEYPERLRRNRRHVLTTVCALFILLSIPFCLSSGLFWMELLTQFVLTWPLVVIAFLECMAINWVYGVDNMLDNAKWIVGYWPPCYIFWK 547          
BLAST of slc6a-22 vs. Ensembl Fly
Match: ine (gene:FBgn0011603 transcript:FBtr0077447)

HSP 1 Score: 170.244 bits (430), Expect = 1.178e-44
Identity = 145/538 (26.95%), Postives = 253/538 (47.03%), Query Frame = 2
Query:  272 KTPYLVHKYTAA-FFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWG-CSPLLKALGVGMVALTVNGLIT--YVMYVIWALRYFFLTFNSNLPW--SPEAMQTPD-------------PNLSSQRFLEYQGFKTINATGTLKI-GLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFLRI--SDLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYLNLKKFNFQILKDTTNLGVG--FIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSILELFS---KNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLCTALLVTIMMLVLYKGTEISTDINFMLSNDPITLKIWKKIKWYFIVLW--YGPVQIVLMIFLVYKIYIFGEHPFTFYVNSQVYNYTSSELAGGWFIGS----CVPLSVLITIGIYLMKFKGPLVKRLKGLLNQN 1786
            + PY+ +K     F +PY I  FI  +PL  +E+ VGQ T RG I   G   PL K  G G+ ++ V+ L++  Y + + +++ YFF +F + +PW        TPD             P+ S     E+   K +  +G L+  G+  WE+  C +  W ++  A    I    KV YFT T  +V I IL+V +++L+G+ +GL++F R   S+L N  +W +AA Q    L +  G ++ F+S+ +   N++ +T+ ++ V+  TS+L  IF+ +  G L L++ N  + +D    G G  F+  PQ ++ +P A  +A +++ +L+ +G ++    V +V  SI + F    K +      V + +C IS +  +P    GG+Y F L D ++ S T +  A    I +   Y    +S ++  M    P          +Y    W   GP     ++F ++ + +   H  T++  +  Y Y       GW   S    C+P   +I    +L        +R++  L  N
Sbjct:   77 RFPYMCYKSGGGVFLVPYCIILFICSIPLLFMELSVGQYTGRGPIGALGQLCPLFK--GAGLASVVVSFLMSTYYSVIIGYSIYYFFTSFKTEMPWIDCNNRWNTPDCWVPQRKGINASAPDTSRTPSEEFFENKVLQISGGLEYPGMMRWELFACLICAWLMVYFATWKSIKSSAKVRYFTATFPFVLIIILMVRAVTLDGAAEGLRFFFRPKWSELKNANVWINAASQNFNSLGITFGSMISFASYNKYNNNILRDTVAVSAVNMITSLLVGIFAFSTLGNLALEQ-NTNV-RDVIGDGPGMIFVVYPQAMAKMPYAQLWAVMFFFMLLCLGLNSQFAIVEVVVTSIQDGFPRWIKRHLGYHEIVVLFVCVISCLFGMPNIIQGGIYYFQLMDHYAASVTIMFLAFCQMIAIAWFYGTGRLSKNVKQMTGKAP---------SFYLRSCWLVLGPC----LLFAIWVLSLINYHEPTYH--NGRYTYPDWAYGIGWMFASFSLICIPGYAVIN---FLRSSGDTFWERIRNTLRPN 592          
BLAST of slc6a-22 vs. Ensembl Fly
Match: DAT (gene:FBgn0034136 transcript:FBtr0087125)

HSP 1 Score: 167.162 bits (422), Expect = 9.756e-44
Identity = 155/601 (25.79%), Postives = 275/601 (45.76%), Query Frame = 2
Query:  143 NSNCENLDTNEDHLENSNPQRISQRFDYXXXXXXXXXXXXXXXKTPYLVHKYTA-AFFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWG-CSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPW----------------SPEAMQTP------------------------DPNLSSQRFLEYQGFKTI-------------NATGTLKIGLPVWEIVLCSLAIWFLLCLAAIY-GIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFL--RISDLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYLNLKKFNFQILKDTTNLGVG--FIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSILELFSKNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLCTALLVTIMMLVLYKGTEISTDINFMLSNDPITLKIWKKIKWYFIVLWYGPVQIVLMIFLVYKIYIFGEHPFTFYVNSQVYNYTSSELAGGWFI-GSCVPLSVLITIGIYLMKFKGPLVKR 1762
             S       N+++  +   +  S + D++L +IG+ V +  + + PYL +K    AF +PY I   + G+PLF +E+ +GQ   +G I CWG   PL K +G  +V +       Y + + W+LR+FF +F ++LPW                S  A + P                          +L +      +GF++               + G   +G   W++ LC L I +L+C  +++ GI    KVV+FT    Y  + IL++  ++L GS  G++Y+L    S +    +W DAA Q+   L    G ++ ++S+ +   N+  + L+ +F++ +TS +A     +  GY+       +I +D    G G  F+  P  I+T+P + F+A +++++L+T+G D++ G    +  ++ + F K   ++E +V  G+ ++ F+V +  C  GG Y F L D ++  ++ L       I +  +Y     S DI  M+   P   + W ++ W F+        I L+   VY   + G  P T+      Y Y S   A GW I GS V +   + I   L+   G L +R
Sbjct:    9 KSKTPTPHDNDNNSISDERETWSGKVDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYGIMLVVGGIPLFYMELALGQHNRKGAITCWGRLVPLFKGIGYAVVLIAFYVDFYYNVIIAWSLRFFFASFTNSLPWTSCNNIWNTPNCRPFESQNASRVPVIGNYSDLYAMGNQSLLYNETYMNGSSLDTSAVGHVEGFQSAASEYFNRYILELNRSEGIHDLGAIKWDMALC-LLIVYLICYFSLWKGISTSGKVVWFTALFPYAVLLILLIRGLTLPGSFLGIQYYLTPNFSAIYKAEVWVDAATQVFFSLGPGFGVLLAYASYNKYHNNVYKDALLTSFINSATSFIAGFVIFSVLGYM-AHTLGVRI-EDVATEGPGLVFVVYPAAIATMPASTFWALIFFMMLLTLGLDSSFGGSEAIITALSDEFPKIKRNRELFVA-GLFSLYFVVGLASCTQGGFYFFHLLDRYAAGYSILVAVFFEAIAVSWIYGTNRFSEDIRDMIGFPP--GRYW-QVCWRFV------APIFLLFITVYG--LIGYEPLTY----ADYVYPSWANALGWCIAGSSVVMIPAVAI-FKLLSTPGSLRQR 589          
BLAST of slc6a-22 vs. Ensembl Fly
Match: DAT (gene:FBgn0034136 transcript:FBtr0330002)

HSP 1 Score: 166.777 bits (421), Expect = 1.590e-43
Identity = 155/601 (25.79%), Postives = 275/601 (45.76%), Query Frame = 2
Query:  143 NSNCENLDTNEDHLENSNPQRISQRFDYXXXXXXXXXXXXXXXKTPYLVHKYTA-AFFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWG-CSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPW----------------SPEAMQTP------------------------DPNLSSQRFLEYQGFKTI-------------NATGTLKIGLPVWEIVLCSLAIWFLLCLAAIY-GIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFL--RISDLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYLNLKKFNFQILKDTTNLGVG--FIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSILELFSKNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLCTALLVTIMMLVLYKGTEISTDINFMLSNDPITLKIWKKIKWYFIVLWYGPVQIVLMIFLVYKIYIFGEHPFTFYVNSQVYNYTSSELAGGWFI-GSCVPLSVLITIGIYLMKFKGPLVKR 1762
             S       N+++  +   +  S + D++L +IG+ V +  + + PYL +K    AF +PY I   + G+PLF +E+ +GQ   +G I CWG   PL K +G  +V +       Y + + W+LR+FF +F ++LPW                S  A + P                          +L +      +GF++               + G   +G   W++ LC L I +L+C  +++ GI    KVV+FT    Y  + IL++  ++L GS  G++Y+L    S +    +W DAA Q+   L    G ++ ++S+ +   N+  + L+ +F++ +TS +A     +  GY+       +I +D    G G  F+  P  I+T+P + F+A +++++L+T+G D++ G    +  ++ + F K   ++E +V  G+ ++ F+V +  C  GG Y F L D ++  ++ L       I +  +Y     S DI  M+   P   + W ++ W F+        I L+   VY   + G  P T+      Y Y S   A GW I GS V +   + I   L+   G L +R
Sbjct:    9 KSKTPTPHDNDNNSISDERETWSGKVDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYGIMLVVGGIPLFYMELALGQHNRKGAITCWGRLVPLFKGIGYAVVLIAFYVDFYYNVIIAWSLRFFFASFTNSLPWTSCNNIWNTPNCRPFESQNASRVPVIGNYSDLYAMGNQSLLYNETYMNGSSLDTSAVGHVEGFQSAASEYFNRYILELNRSEGIHDLGAIKWDMALC-LLIVYLICYFSLWKGISTSGKVVWFTALFPYAVLLILLIRGLTLPGSFLGIQYYLTPNFSAIYKAEVWVDAATQVFFSLGPGFGVLLAYASYNKYHNNVYKDALLTSFINSATSFIAGFVIFSVLGYM-AHTLGVRI-EDVATEGPGLVFVVYPAAIATMPASTFWALIFFMMLLTLGLDSSFGGSEAIITALSDEFPKIKRNRELFVA-GLFSLYFVVGLASCTQGGFYFFHLLDRYAAGYSILVAVFFEAIAVSWIYGTNRFSEDIRDMIGFPP--GRYW-QVCWRFV------APIFLLFITVYG--LIGYEPLTY----ADYVYPSWANALGWCIAGSSVVMIPAVAI-FKLLSTPGSLRQR 589          
BLAST of slc6a-22 vs. Ensembl Fly
Match: ine (gene:FBgn0011603 transcript:FBtr0077448)

HSP 1 Score: 167.548 bits (423), Expect = 3.889e-43
Identity = 145/536 (27.05%), Postives = 252/536 (47.01%), Query Frame = 2
Query:  278 PYLVHKYTAA-FFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWG-CSPLLKALGVGMVALTVNGLIT--YVMYVIWALRYFFLTFNSNLPW--SPEAMQTPD-------------PNLSSQRFLEYQGFKTINATGTLK-IGLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFLRI--SDLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYLNLKKFNFQILKDTTNLGVG--FIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSILELFS---KNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLCTALLVTIMMLVLYKGTEISTDINFMLSNDPITLKIWKKIKWYFIVLW--YGPVQIVLMIFLVYKIYIFGEHPFTFYVNSQVYNYTSSELAGGWFIGS----CVPLSVLITIGIYLMKFKGPLVKRLKGLLNQN 1786
            PY+ +K     F +PY I  FI  +PL  +E+ VGQ T RG I   G   PL K  G G+ ++ V+ L++  Y + + +++ YFF +F + +PW        TPD             P+ S     E+   K +  +G L+  G+  WE+  C +  W ++  A    I    KV YFT T  +V I IL+V +++L+G+ +GL++F R   S+L N  +W +AA Q    L +  G ++ F+S+ +   N++ +T+ ++ V+  TS+L  IF+ +  G L L++ N  + +D    G G  F+  PQ ++ +P A  +A +++ +L+ +G ++    V +V  SI + F    K +      V + +C IS +  +P    GG+Y F L D ++ S T +  A    I +   Y    +S ++  M    P          +Y    W   GP     ++F ++ + +   H  T++  +  Y Y       GW   S    C+P   +I    +L        +R++  L  N
Sbjct:  364 PYMCYKSGGGVFLVPYCIILFICSIPLLFMELSVGQYTGRGPIGALGQLCPLFK--GAGLASVVVSFLMSTYYSVIIGYSIYYFFTSFKTEMPWIDCNNRWNTPDCWVPQRKGINASAPDTSRTPSEEFFENKVLQISGGLEYPGMMRWELFACLICAWLMVYFATWKSIKSSAKVRYFTATFPFVLIIILMVRAVTLDGAAEGLRFFFRPKWSELKNANVWINAASQNFNSLGITFGSMISFASYNKYNNNILRDTVAVSAVNMITSLLVGIFAFSTLGNLALEQ-NTNV-RDVIGDGPGMIFVVYPQAMAKMPYAQLWAVMFFFMLLCLGLNSQFAIVEVVVTSIQDGFPRWIKRHLGYHEIVVLFVCVISCLFGMPNIIQGGIYYFQLMDHYAASVTIMFLAFCQMIAIAWFYGTGRLSKNVKQMTGKAP---------SFYLRSCWLVLGPC----LLFAIWVLSLINYHEPTYH--NGRYTYPDWAYGIGWMFASFSLICIPGYAVIN---FLRSSGDTFWERIRNTLRPN 877          
BLAST of slc6a-22 vs. Ensembl Fly
Match: ine (gene:FBgn0011603 transcript:FBtr0301408)

HSP 1 Score: 167.548 bits (423), Expect = 3.889e-43
Identity = 145/536 (27.05%), Postives = 252/536 (47.01%), Query Frame = 2
Query:  278 PYLVHKYTAA-FFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWG-CSPLLKALGVGMVALTVNGLIT--YVMYVIWALRYFFLTFNSNLPW--SPEAMQTPD-------------PNLSSQRFLEYQGFKTINATGTLK-IGLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFLRI--SDLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYLNLKKFNFQILKDTTNLGVG--FIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSILELFS---KNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLCTALLVTIMMLVLYKGTEISTDINFMLSNDPITLKIWKKIKWYFIVLW--YGPVQIVLMIFLVYKIYIFGEHPFTFYVNSQVYNYTSSELAGGWFIGS----CVPLSVLITIGIYLMKFKGPLVKRLKGLLNQN 1786
            PY+ +K     F +PY I  FI  +PL  +E+ VGQ T RG I   G   PL K  G G+ ++ V+ L++  Y + + +++ YFF +F + +PW        TPD             P+ S     E+   K +  +G L+  G+  WE+  C +  W ++  A    I    KV YFT T  +V I IL+V +++L+G+ +GL++F R   S+L N  +W +AA Q    L +  G ++ F+S+ +   N++ +T+ ++ V+  TS+L  IF+ +  G L L++ N  + +D    G G  F+  PQ ++ +P A  +A +++ +L+ +G ++    V +V  SI + F    K +      V + +C IS +  +P    GG+Y F L D ++ S T +  A    I +   Y    +S ++  M    P          +Y    W   GP     ++F ++ + +   H  T++  +  Y Y       GW   S    C+P   +I    +L        +R++  L  N
Sbjct:  364 PYMCYKSGGGVFLVPYCIILFICSIPLLFMELSVGQYTGRGPIGALGQLCPLFK--GAGLASVVVSFLMSTYYSVIIGYSIYYFFTSFKTEMPWIDCNNRWNTPDCWVPQRKGINASAPDTSRTPSEEFFENKVLQISGGLEYPGMMRWELFACLICAWLMVYFATWKSIKSSAKVRYFTATFPFVLIIILMVRAVTLDGAAEGLRFFFRPKWSELKNANVWINAASQNFNSLGITFGSMISFASYNKYNNNILRDTVAVSAVNMITSLLVGIFAFSTLGNLALEQ-NTNV-RDVIGDGPGMIFVVYPQAMAKMPYAQLWAVMFFFMLLCLGLNSQFAIVEVVVTSIQDGFPRWIKRHLGYHEIVVLFVCVISCLFGMPNIIQGGIYYFQLMDHYAASVTIMFLAFCQMIAIAWFYGTGRLSKNVKQMTGKAP---------SFYLRSCWLVLGPC----LLFAIWVLSLINYHEPTYH--NGRYTYPDWAYGIGWMFASFSLICIPGYAVIN---FLRSSGDTFWERIRNTLRPN 877          
BLAST of slc6a-22 vs. Ensembl Zebrafish
Match: slc6a14 (solute carrier family 6 member 14 [Source:ZFIN;Acc:ZDB-GENE-130411-2])

HSP 1 Score: 213.772 bits (543), Expect = 1.902e-60
Identity = 164/586 (27.99%), Postives = 285/586 (48.63%), Query Frame = 2
Query:  143 NSNCENLDTNEDHLENSNPQRISQRFDYXXXXXXXXXXXXXXXKTPYLVHKYTA-AFFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWGCSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPWSPEAMQTPDPNLS----------------SQRFLEYQGFKTINATGTLKIGLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFL----RISDLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYLNLKKFNFQI-LKDTTNLG--VGFIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSILELFSKNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLCTALLVTIMMLVLYKGTEISTDINFMLSNDPITLKIWKKIKWYFIVLWYGPVQIVLMIFLVYKIYIFGEHPFTFYVNSQVYNYTSSELAGGWFIGSCVPLSVLITIGIYLMKFKGPLVKRLKGLLNQNENDKPWYPVSPNDK 1828
            +   E++  N+   ENS+    S + +Y+L MIGY VG+G + + PYL +K+   AF IPYTI   + GLPLF +E   GQ  S+G I  W   P+L+ +G+ M+ ++    I Y + + +++ Y F +F   LPWS +   T   N+S                S+++ +    +   ++   + G  VW + LC L  W L+  A   GI    KVVYFT T  Y+ + IL++   +LEG+ DG+++++     ++ L    +W DAA QI   LS+A GG+M  SS+ +   N   +++++   +  TSI A     A F  L      +Q  + +  + G  + FIA P  +S +P +  ++ +++ +L+T+G D+    + ++S  +L+ + +    K   VT  +C I F++ +P     G+Y   L DTFS  W  L   LL  + + +LY G     DI  M+        +W +  W+FI        +VL I L++ +Y F    ++         Y    ++ GW I +   + + I     + K +G L +R+K   +  E+  P+      ++
Sbjct:   27 SDKAEHVVQND---ENSDRGNWSSKREYMLSMIGYAVGLGNVWRFPYLAYKHGGGAFLIPYTIMLAVSGLPLFFMESSFGQFCSQGPINVWKAVPILQGVGITMMLVSTFVAIYYNVIIAYSIYYLFASFQDPLPWSIKNCNTTASNISTAAVNVSCGQISGQSLSEKYWDEVALQ--RSSSMDETGPVVWHLALCLLLSWILVGAALFKGIKSSGKVVYFTATFPYIVLLILLIRGATLEGAKDGIEFYIGSQSNLTKLAEAEVWKDAATQIFFSLSIAWGGLMALSSYNKFYNNCYQDSIVVCVTNCGTSIFAGF---AIFSVLGHMAHVYQRPVSEVADAGFALAFIAYPDALSKLPISPLWSILFFFMLITLGLDSQFAGIEVISTCLLDAYPEVLKSKRGLVTTAVCIILFLLGLPCVTRAGIYWVNLIDTFSAGWILLVAGLLEVLGLCILYGGNRFIKDIEMMIGTKSSLFWLWWRACWFFI------TPVVLSIILIWSLYTFTSPTYSSVA------YPDWGISLGWCITAFSLMWIPIVAVWKVCKARGGLWQRIKSACSPTEDWGPYLECHRGER 592          
BLAST of slc6a-22 vs. Ensembl Zebrafish
Match: slc6a7 (solute carrier family 6 member 7 [Source:ZFIN;Acc:ZDB-GENE-070112-1492])

HSP 1 Score: 197.978 bits (502), Expect = 2.194e-54
Identity = 154/516 (29.84%), Postives = 253/516 (49.03%), Query Frame = 2
Query:  272 KTPYLVHKYTAA-FFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWGCSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPWSPEAMQ--------TPDPNLSSQRFLEYQGFKTINATGTLKIGLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFL--RISDLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYLNLKKFNFQILKDTTNLGVGFIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSILELFS--KNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLCTALLVTIMMLVLYKGTEISTDINFMLSNDPITLKIW-KKIKWYFIVLWYGPVQIVLMIFLVYKI--YIFGE-HPFTFYVNSQVYNYTSSELAGGWFIGSCVPLSVLITIGIYLMKFKGPLVKRLK 1768
            + PYL ++     F IPY I  F  G+PLFL+E+ +GQ  + G I  W C PLLK +G+GM+ ++    + Y + + W   Y   +F S LPWS +A+Q        T      S+ F   +    +++TG    G   W + LC LA W ++ L  + GIH   KVVY T T  Y  + +LI+   +LEGSLDG+ ++L  +   L +  +W DAA QI   L +  GG++  +S+ +   N++ +T+IIT  + STS  A     +  G++  KK         +  G+ F+A P+ ++ +P + F++ +++++L  +G DT  G +  +  ++L+ F   ++N   +      +C   +++ + L   GG+Y F L D+FS S+  +   L + I +   Y   +   DI  M+   P     W  K+  YF   W     +V   FL+  I  YIF E +  +    S VY      L  G  +G+   L +LI   + + K  G L  R K
Sbjct:   96 RFPYLCYRNGGGVFLIPYFIMLFFTGMPLFLMELSLGQYGAAGPITVWKCCPLLKGIGIGMLCVSTLVCLYYNVIIAWTFYYLGSSFQSPLPWSCDALQNIALCANKTNSTQSPSEVFWNEKVLGVVHSTGLSDPGPVRWPLALCLLAAWIIIFLCMLKGIHSSGKVVYVTATFPYFVLLVLIIRGATLEGSLDGVAFYLTPKWDQLADAQVWNDAASQIFYSLGIGVGGLLSMASYNKFDNNVIRDTIIITIGNCSTSFFAGFAIFSILGHMAFKKGVPVDKVADSGPGLAFVAYPEALALLPGSVFWSILFFLMLFMLGVDTLFGNMEGICTAVLDEFPQLRSNLKHKTLFLAVLCFSFYLMGLLLITDGGIYWFTLIDSFSTSFGLIIITLFMCIGISFFYGVNQFCQDIVDMICRCP----PWCTKMLLYFKACW-----VVFTPFLLTFILTYIFIEMYRTSLRYGSYVYPIWGKAL--GVCMGALCCLQILIWAIVAISKESGTLKDRFK 600          
BLAST of slc6a-22 vs. Ensembl Zebrafish
Match: slc6a2 (solute carrier family 6 member 2 [Source:ZFIN;Acc:ZDB-GENE-110408-4])

HSP 1 Score: 180.259 bits (456), Expect = 2.490e-48
Identity = 139/522 (26.63%), Postives = 249/522 (47.70%), Query Frame = 2
Query:   74 FNANPKET-----RQENNIHYEVNTAYMNSNCENLDTNEDHLENSNPQRISQRFDYXXXXXXXXXXXXXXXKTPYLVHKYTA-AFFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWGCSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPW--------SPEAMQTPD---------------PNLSSQRFLEYQGFKTINATGTLKIGLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFLRIS--DLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYL-NLKKFNFQILKDTTNLGVG--FIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSILELFSKNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLCTALLVTIMMLVLYKGTEISTDINFMLSNDPITLKIWKKIKWYFI 1537
            FN   KE      +++N + Y  N++ + S      T+    E    +   ++ D++L +IG+ V +  + + PYL +K    AF IPY +F FI G+PLF +E+ +GQ    G    W   P+ K +G  ++ + +     Y + + W+L Y + +  S LPW        SP   +  D                N  +  F E     +  + G   +GLP WE+ +C + + F+L  +   G+    KVVY T T+ Y+ + +L++  I+L G+++G++ +L I    L N  +W DAA QI   L    G ++ FSS+ +   N   + ++ + ++  TS  +     +  GY+    K N   +KD    G G  F+  P+ IST+P A FFA V++I+L+T+G D+++G +  V   + + F     +++ + T      +F++++    +GG+Y+  L D ++   + L   L   I +   Y     S DI  M+   P    I+ ++ W F+
Sbjct:   20 FNVEKKEVELILVKEQNGVQY-TNSSVVASPSSRACTSASG-EEIERETWGKKMDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLIPYVLFLFIAGMPLFYMELALGQYNREGAATLWKICPVFKGVGYTVIVIALYVGFYYNVIIAWSLYYLYASLTSELPWLHCNNPWNSPNCTEPKDINGTVLGNGTSYAKYKNTPAAEFYERGVLHSHESKGIGDLGLPRWELTICLVVVAFILYFSLWKGVKSSGKVVYITATMPYIVLLVLLIRGITLPGAMNGIRAYLHIDLKKLNNPQVWIDAATQIFFSLGAGFGVLIAFSSYNKFNNNCYRDAILTSTINCVTSFFSGFAIFSVLGYMAEQHKVN---IKDVATEGAGLVFVIYPEAISTLPGATFFAIVFFIMLLTLGIDSSMGGMEAVLTGLSDDFKILKRNRKLF-TFATVVGTFLMALLCVTNGGIYVLTLLDKYAAGTSILFGVLFEAIGVSWFYGVDRFSEDIERMMGFKP---GIYWRLCWKFV 532          
BLAST of slc6a-22 vs. Ensembl Zebrafish
Match: slc6a2 (solute carrier family 6 member 2 [Source:ZFIN;Acc:ZDB-GENE-110408-4])

HSP 1 Score: 180.259 bits (456), Expect = 2.490e-48
Identity = 139/522 (26.63%), Postives = 249/522 (47.70%), Query Frame = 2
Query:   74 FNANPKET-----RQENNIHYEVNTAYMNSNCENLDTNEDHLENSNPQRISQRFDYXXXXXXXXXXXXXXXKTPYLVHKYTA-AFFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWGCSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPW--------SPEAMQTPD---------------PNLSSQRFLEYQGFKTINATGTLKIGLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFLRIS--DLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYL-NLKKFNFQILKDTTNLGVG--FIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSILELFSKNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLCTALLVTIMMLVLYKGTEISTDINFMLSNDPITLKIWKKIKWYFI 1537
            FN   KE      +++N + Y  N++ + S      T+    E    +   ++ D++L +IG+ V +  + + PYL +K    AF IPY +F FI G+PLF +E+ +GQ    G    W   P+ K +G  ++ + +     Y + + W+L Y + +  S LPW        SP   +  D                N  +  F E     +  + G   +GLP WE+ +C + + F+L  +   G+    KVVY T T+ Y+ + +L++  I+L G+++G++ +L I    L N  +W DAA QI   L    G ++ FSS+ +   N   + ++ + ++  TS  +     +  GY+    K N   +KD    G G  F+  P+ IST+P A FFA V++I+L+T+G D+++G +  V   + + F     +++ + T      +F++++    +GG+Y+  L D ++   + L   L   I +   Y     S DI  M+   P    I+ ++ W F+
Sbjct:   20 FNVEKKEVELILVKEQNGVQY-TNSSVVASPSSRACTSASG-EEIERETWGKKMDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLIPYVLFLFIAGMPLFYMELALGQYNREGAATLWKICPVFKGVGYTVIVIALYVGFYYNVIIAWSLYYLYASLTSELPWLHCNNPWNSPNCTEPKDINGTVLGNGTSYAKYKNTPAAEFYERGVLHSHESKGIGDLGLPRWELTICLVVVAFILYFSLWKGVKSSGKVVYITATMPYIVLLVLLIRGITLPGAMNGIRAYLHIDLKKLNNPQVWIDAATQIFFSLGAGFGVLIAFSSYNKFNNNCYRDAILTSTINCVTSFFSGFAIFSVLGYMAEQHKVN---IKDVATEGAGLVFVIYPEAISTLPGATFFAIVFFIMLLTLGIDSSMGGMEAVLTGLSDDFKILKRNRKLF-TFATVVGTFLMALLCVTNGGIYVLTLLDKYAAGTSILFGVLFEAIGVSWFYGVDRFSEDIERMMGFKP---GIYWRLCWKFV 532          
BLAST of slc6a-22 vs. Ensembl Zebrafish
Match: slc6a8 (solute carrier family 6 member 8 [Source:ZFIN;Acc:ZDB-GENE-071024-2])

HSP 1 Score: 177.948 bits (450), Expect = 2.449e-47
Identity = 169/613 (27.57%), Postives = 282/613 (46.00%), Query Frame = 2
Query:   68 PCFNANPKETRQENNIHYEVNTAYMNSNCENLDTNEDHLENSNPQR--ISQRFDYXXXXXXXXXXXXXXXKTPYLVHKYTAA-FFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWGCSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPWSP-----------EAMQTPD-----------PNLSSQRF-------LEYQGFKTIN-ATGTLKIGLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFLRI--SDLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYLNLKKFNFQILK-DTTNLGVGFIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSILELFSKN---NYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNS-WTKLCTALLVTIMMLVLYKGTEISTDINFMLSNDPITLKIWKKIKWYFIVLWYGPVQIVLMIFLVYKIYIFGEHPFTFYVNSQVYNYTSSELAGGWFIGSCVPLSVLITIGIYLM----KFKGPLVKRLKGL 1774
            P  NA+P       +++  +N   M++    +   E   E   P+R   +++ D+I+  +G+ VG+G + + PYL +K     F IPY +F F+ G+P+F LE+ +GQ    G I  W  +PL K LG   + +       Y+M + W   YF  +FN+ LPWS            E  +  D            NL+ +         +E+   K +N + G  + G   WE++LC LA+W ++      G+    K+VYFT T  YV + IL+V  ++L G+ DG+ Y+++   S LG   +W DA  QI    ++  G +    S+ +   +   +  ++  ++  TS  A     +  G++  ++    I K   +  G+ FIA P+ +S +P A  +A +++I+L+ +G D+    V      IL+LF       Y +E  V I  C + FI+ + +   GG+Y+F LFD +S S  T L  A    +++  +Y       DI  M+   P     W K  W  I     P  + + IFL    ++    P T Y N  VY +       G  IG C+ LS ++ I + L+      KG   +R + L
Sbjct:    9 PNGNAHP-------SVNGTLNGGPMSAATGAISAVEKKREGY-PERETWTRQMDFIMSCVGFAVGLGNVWRFPYLCYKNGGGVFLIPYVLFIFLGGIPIFFLEIALGQFMKAGSINVWNIAPLFKGLGYASMVIVFFCNTYYIMVLAWGFYYFIKSFNATLPWSTCDNPWNTENCIEIFRQGDCKNGTIGNSTFGNLTCEELANGRSPIIEFWENKVLNISDGLDEPGAVNWELMLCLLAVWVMVYFCVWKGVKSTGKIVYFTATFPYVVLIILLVRGVTLPGAYDGILYYVKPDWSKLGEAQVWIDAGTQIFFSYAIGLGALTALGSYNRFNNDCYKDAFVLALINSGTSFFAGFVVFSILGFMASEQ-GVDISKVAESGPGLAFIAYPKAVSMMPVAPVWAALFFIMLLLLGLDSQFVGVEGFVTGILDLFPGKYYMRYQREIAVAI-CCLLCFIIDLSMVTQGGMYVFQLFDYYSASGMTLLWQAFWECVVVAWVYGADRFMDDIARMIGYRPFP---WMKWCWSIIT----PC-VCMGIFL---FHLLNYKPLT-YNNVYVYPWW------GEVIGWCLALSSMLCIPVSLVYKLSGAKGTFKERWENL 593          
BLAST of slc6a-22 vs. Ensembl Xenopus
Match: rmnd5a (required for meiotic nuclear division 5 homolog A [Source:Xenbase;Acc:XB-GENE-5741891])

HSP 1 Score: 199.904 bits (507), Expect = 2.040e-55
Identity = 133/439 (30.30%), Postives = 230/439 (52.39%), Query Frame = 2
Query:  272 KTPYLVHKYTA-AFFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWGCSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPWSPEAM------QTPDPNLS----SQRFLEYQGFKTINATGTLKIGLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFLRIS--DLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYLNLKKFNFQILKDTTNLGVGFIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSIL-ELFSKNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLCTALLVTIMMLVLYKGTEISTDINFMLSNDPITLKIWKKIKWYFIVLW 1546
            + PYL ++    AF IPY+I  F  GLPLFL+E+ +GQ  + G I  W C P+LK +G+GM+ ++    + Y + + W   Y   +F S LPWS ++       Q    N S    ++ F   +     +++G    G   WE+ LC LA WF++ L  + GIH   K+VYFT T  Y  + +LI+   +LEGS+DG++++L      L +  +W DAA QI   L +  GG++  +S+ +   N++ +TL+I   + STS  A     +  G++  KK         +  G+ F+A P+ ++ +P + F++ +++++L T+G DT  G +  ++ +IL E+ S  ++ ++      +C   +++ + L   GG+Y F L D++S S+  +  AL + + +   Y   +   DI  M+S  P       K+ WYF   W
Sbjct:   35 RFPYLCYRNGGGAFLIPYSIMLFFTGLPLFLMELSLGQYGAAGPITVWKCCPILKGIGIGMLLVSALVSLYYNVIIAWTFYYLGQSFQSPLPWSCDSALYSQLCQNGTSNGSQFSATEAFWNEKVLGVTHSSGLGDPGPVGWELALCLLAAWFIIFLCMLKGIHSSGKIVYFTATFPYFVMVVLIIRGATLEGSIDGVRFYLTADWKRLQSAQVWNDAASQIFYSLGIGFGGLLSMASYNKFNNNVIRDTLVIAIGNCSTSFFAGFAIFSVLGHMAWKKGVPVGQVADSGPGLAFVAYPEALALLPGSVFWSILFFLMLFTLGVDTLFGNMEGITTAILDEIPSLRDWKRKTIFLGCLCFAFYLLGLLLITQGGIYWFTLIDSYSTSFGLIIIALFMCLGIAFFYGVNQFCQDILDMVSQCPPWC---TKVLWYFKACW 470          
BLAST of slc6a-22 vs. Ensembl Xenopus
Match: rmnd5a (required for meiotic nuclear division 5 homolog A [Source:Xenbase;Acc:XB-GENE-5741891])

HSP 1 Score: 200.29 bits (508), Expect = 3.893e-55
Identity = 133/439 (30.30%), Postives = 230/439 (52.39%), Query Frame = 2
Query:  272 KTPYLVHKYTA-AFFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWGCSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPWSPEAM------QTPDPNLS----SQRFLEYQGFKTINATGTLKIGLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFLRIS--DLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYLNLKKFNFQILKDTTNLGVGFIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSIL-ELFSKNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLCTALLVTIMMLVLYKGTEISTDINFMLSNDPITLKIWKKIKWYFIVLW 1546
            + PYL ++    AF IPY+I  F  GLPLFL+E+ +GQ  + G I  W C P+LK +G+GM+ ++    + Y + + W   Y   +F S LPWS ++       Q    N S    ++ F   +     +++G    G   WE+ LC LA WF++ L  + GIH   K+VYFT T  Y  + +LI+   +LEGS+DG++++L      L +  +W DAA QI   L +  GG++  +S+ +   N++ +TL+I   + STS  A     +  G++  KK         +  G+ F+A P+ ++ +P + F++ +++++L T+G DT  G +  ++ +IL E+ S  ++ ++      +C   +++ + L   GG+Y F L D++S S+  +  AL + + +   Y   +   DI  M+S  P       K+ WYF   W
Sbjct:   95 RFPYLCYRNGGGAFLIPYSIMLFFTGLPLFLMELSLGQYGAAGPITVWKCCPILKGIGIGMLLVSALVSLYYNVIIAWTFYYLGQSFQSPLPWSCDSALYSQLCQNGTSNGSQFSATEAFWNEKVLGVTHSSGLGDPGPVGWELALCLLAAWFIIFLCMLKGIHSSGKIVYFTATFPYFVMVVLIIRGATLEGSIDGVRFYLTADWKRLQSAQVWNDAASQIFYSLGIGFGGLLSMASYNKFNNNVIRDTLVIAIGNCSTSFFAGFAIFSVLGHMAWKKGVPVGQVADSGPGLAFVAYPEALALLPGSVFWSILFFLMLFTLGVDTLFGNMEGITTAILDEIPSLRDWKRKTIFLGCLCFAFYLLGLLLITQGGIYWFTLIDSYSTSFGLIIIALFMCLGIAFFYGVNQFCQDILDMVSQCPPWC---TKVLWYFKACW 530          
BLAST of slc6a-22 vs. Ensembl Xenopus
Match: rmnd5a (required for meiotic nuclear division 5 homolog A [Source:Xenbase;Acc:XB-GENE-5741891])

HSP 1 Score: 197.978 bits (502), Expect = 1.317e-54
Identity = 136/449 (30.29%), Postives = 233/449 (51.89%), Query Frame = 2
Query:  272 KTPYLVHKYTA-AFFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWGCSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPWSPEA-----MQTPDPN----------LSSQRFLEYQ--GFKTINATGTLKIGLP---VWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFLRIS--DLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYLNLKKFNFQILKDTTNLGVGFIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSIL-ELFSKNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLCTALLVTIMMLVLYKGTEISTDINFMLSNDPITLKIWKKIKWYFIVLW 1546
            + PYL ++    AF IPY+I  F  GLPLFL+E+ +GQ  + G I  W C P+LK +G+GM+ ++    + Y + + W   Y   +F S LPWS ++     +    PN             +R  + Q  G K +  T +  +G P    WE+ LC LA WF++ L  + GIH   K+VYFT T  Y  + +LI+   +LEGS+DG++++L      L +  +W DAA QI   L +  GG++  +S+ +   N++ +TL+I   + STS  A     +  G++  KK         +  G+ F+A P+ ++ +P + F++ +++++L T+G DT  G +  ++ +IL E+ S  ++ ++      +C   +++ + L   GG+Y F L D++S S+  +  AL + + +   Y   +   DI  M+S  P       K+ WYF   W
Sbjct:   74 RFPYLCYRNGGGAFLIPYSIMLFFTGLPLFLMELSLGQYGAAGPITVWKCCPILKGIGIGMLLVSALVSLYYNVIIAWTFYYLGQSFQSPLPWSCDSALYSQLCQVRPNCPGGGGGYYPTGRERGSDSQCIGEKVLGVTHSSGLGDPGPVGWELALCLLAAWFIIFLCMLKGIHSSGKIVYFTATFPYFVMVVLIIRGATLEGSIDGVRFYLTADWKRLQSAQVWNDAASQIFYSLGIGFGGLLSMASYNKFNNNVIRDTLVIAIGNCSTSFFAGFAIFSVLGHMAWKKGVPVGQVADSGPGLAFVAYPEALALLPGSVFWSILFFLMLFTLGVDTLFGNMEGITTAILDEIPSLRDWKRKTIFLGCLCFAFYLLGLLLITQGGIYWFTLIDSYSTSFGLIIIALFMCLGIAFFYGVNQFCQDILDMVSQCPPWC---TKVLWYFKACW 519          
BLAST of slc6a-22 vs. Ensembl Xenopus
Match: rmnd5a (required for meiotic nuclear division 5 homolog A [Source:Xenbase;Acc:XB-GENE-5741891])

HSP 1 Score: 192.586 bits (488), Expect = 1.388e-52
Identity = 134/454 (29.52%), Postives = 230/454 (50.66%), Query Frame = 2
Query:  272 KTPYLVHKYTA-AFFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWGCSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPWSPEA-----MQTPDPNLS-----------------SQRFLEYQGFKTINATGTLKIGLPV---WEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFLRIS--DLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYLNLKKFNFQILKDTTNLGVGFIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSIL-ELFSKNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLCTALLVTIMMLVLYKGTEISTDINFMLSNDPITLKIWKKIKWYFIVLW 1546
            + PYL ++    AF IPY+I  F  GLPLFL+E+ +GQ  + G I  W C P+LK +G+GM+ ++    + Y + + W   Y   +F S LPWS ++     +    PN                    Q     +  K +  T +  +G P    WE+ LC LA WF++ L  + GIH   K+VYFT T  Y  + +LI+   +LEGS+DG++++L      L +  +W DAA QI   L +  GG++  +S+ +   N++ +TL+I   + STS  A     +  G++  KK         +  G+ F+A P+ ++ +P + F++ +++++L T+G DT  G +  ++ +IL E+ S  ++ ++      +C   +++ + L   GG+Y F L D++S S+  +  AL + + +   Y   +   DI  M+S  P       K+ WYF   W
Sbjct:   59 RFPYLCYRNGGGAFLIPYSIMLFFTGLPLFLMELSLGQYGAAGPITVWKCCPILKGIGIGMLLVSALVSLYYNVIIAWTFYYLGQSFQSPLPWSCDSALYSQLCQVRPNCPGGGGGYYPTVLYKTSQMPQAVSLCRSEKVLGVTHSSGLGDPGPVGWELALCLLAAWFIIFLCMLKGIHSSGKIVYFTATFPYFVMVVLIIRGATLEGSIDGVRFYLTADWKRLQSAQVWNDAASQIFYSLGIGFGGLLSMASYNKFNNNVIRDTLVIAIGNCSTSFFAGFAIFSVLGHMAWKKGVPVGQVADSGPGLAFVAYPEALALLPGSVFWSILFFLMLFTLGVDTLFGNMEGITTAILDEIPSLRDWKRKTIFLGCLCFAFYLLGLLLITQGGIYWFTLIDSYSTSFGLIIIALFMCLGIAFFYGVNQFCQDILDMVSQCPPWC---TKVLWYFKACW 509          
BLAST of slc6a-22 vs. Ensembl Xenopus
Match: rmnd5a (required for meiotic nuclear division 5 homolog A [Source:Xenbase;Acc:XB-GENE-5741891])

HSP 1 Score: 190.66 bits (483), Expect = 9.064e-52
Identity = 136/460 (29.57%), Postives = 234/460 (50.87%), Query Frame = 2
Query:  272 KTPYLVHKYTA-AFFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWGCSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPWSPEA-----MQTPDPNLS----------SQRFLEYQ--GF-----------KTINATGTLKIGLPV---WEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFLRIS--DLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYLNLKKFNFQILKDTTNLGVGFIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSIL-ELFSKNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLCTALLVTIMMLVLYKGTEISTDINFMLSNDPITLKIWKKIKWYFIVLW 1546
            + PYL ++    AF IPY+I  F  GLPLFL+E+ +GQ  + G I  W C P+LK +G+GM+ ++    + Y + + W   Y   +F S LPWS ++     +    PN             +R  + Q  G+           K +  T +  +G P    WE+ LC LA WF++ L  + GIH   K+VYFT T  Y  + +LI+   +LEGS+DG++++L      L +  +W DAA QI   L +  GG++  +S+ +   N++ +TL+I   + STS  A     +  G++  KK         +  G+ F+A P+ ++ +P + F++ +++++L T+G DT  G +  ++ +IL E+ S  ++ ++      +C   +++ + L   GG+Y F L D++S S+  +  AL + + +   Y   +   DI  M+S  P       K+ WYF   W
Sbjct:   83 RFPYLCYRNGGGAFLIPYSIMLFFTGLPLFLMELSLGQYGAAGPITVWKCCPILKGIGIGMLLVSALVSLYYNVIIAWTFYYLGQSFQSPLPWSCDSALYSQLCQVRPNCPGGGGGYYPTGRERGSDSQCIGYIYCPCKLPSDEKVLGVTHSSGLGDPGPVGWELALCLLAAWFIIFLCMLKGIHSSGKIVYFTATFPYFVMVVLIIRGATLEGSIDGVRFYLTADWKRLQSAQVWNDAASQIFYSLGIGFGGLLSMASYNKFNNNVIRDTLVIAIGNCSTSFFAGFAIFSVLGHMAWKKGVPVGQVADSGPGLAFVAYPEALALLPGSVFWSILFFLMLFTLGVDTLFGNMEGITTAILDEIPSLRDWKRKTIFLGCLCFAFYLLGLLLITQGGIYWFTLIDSYSTSFGLIIIALFMCLGIAFFYGVNQFCQDILDMVSQCPPWC---TKVLWYFKACW 539          
BLAST of slc6a-22 vs. Ensembl Mouse
Match: Slc6a5 (solute carrier family 6 (neurotransmitter transporter, glycine), member 5 [Source:MGI Symbol;Acc:MGI:105090])

HSP 1 Score: 180.644 bits (457), Expect = 1.147e-47
Identity = 164/600 (27.33%), Postives = 274/600 (45.67%), Query Frame = 2
Query:  161 LDTNEDHLENSNPQRISQRFDYXXXXXXXXXXXXXXXKTPYLV-HKYTAAFFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWGCSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPW--------SPEAMQ--------------------------TPDPNLS---------------SQRFLEYQGFKTINATGTLKIGLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFL--RISDLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYL-NLKKFNFQILKDTTNLGVGFIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSILELFSKNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLCTALLVTIMMLVLYKGTEISTDINFMLSNDPITLKIWKKIKWYFIVLWYGPVQIVLMIFLVYKIYIFGEHPFTFYVNSQVYNYTSSELAGGWFIGSCVPLSVLITIGIYLMKFKGPLVKRLKGLLNQNENDKP 1801
            +  +E   EN      S + D+IL M+GY VG+G + + PYL       AF IPY +   + GLP+F LEV +GQ  S+G +  W   P L+  G+ M+ ++V   I Y + + + L Y F +F S LPW        +PE                             T  PNL+               S+ + +Y   K   + G    G   W +  C    W ++  +   GI    KVVYFT T  YV + IL++  ++L G+  G+ YF+  +   L +  +W DAA QI   LS A GG++  SS+ +   N   +TLI+T  + +TSI A     +  G++ N +K N + + D    G+ F+  P+ ++ +P + F+A +++++L+T+G DT    +  +  SI + F K     +   T+G C   FI+  P+   GG+Y+F L DT++ S+  +  A+   + +  +Y       DI  M+   P    I+ K+ W F+         +L   L +  Y +   P T+      Y Y +  +  GW + +C  + + I   I +    G  ++RLK + +   +  P
Sbjct:  173 IPEDEQGDENKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVIGDHPKIQIKNSTFCMTAYPNLTMVNFTSQTNKTFVSGSEEYFKYFVLKI--SAGIEYPGEIRWPLAFCLFLAWVIVYASLAKGIKSSGKVVYFTATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQ-GPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPKYLRTHKPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGLQRFCEDIEMMIGFKP---NIFWKVCWAFV------TPTILTFILCFSFYQW--EPMTY----GSYRYPNWSMVLGWLMLACSVIWIPIMFVIKMYLAPGRFIERLKLVCSPQPDWGP 754          
BLAST of slc6a-22 vs. Ensembl Mouse
Match: Slc6a5 (solute carrier family 6 (neurotransmitter transporter, glycine), member 5 [Source:MGI Symbol;Acc:MGI:105090])

HSP 1 Score: 180.644 bits (457), Expect = 1.147e-47
Identity = 164/600 (27.33%), Postives = 274/600 (45.67%), Query Frame = 2
Query:  161 LDTNEDHLENSNPQRISQRFDYXXXXXXXXXXXXXXXKTPYLV-HKYTAAFFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWGCSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPW--------SPEAMQ--------------------------TPDPNLS---------------SQRFLEYQGFKTINATGTLKIGLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFL--RISDLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYL-NLKKFNFQILKDTTNLGVGFIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSILELFSKNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLCTALLVTIMMLVLYKGTEISTDINFMLSNDPITLKIWKKIKWYFIVLWYGPVQIVLMIFLVYKIYIFGEHPFTFYVNSQVYNYTSSELAGGWFIGSCVPLSVLITIGIYLMKFKGPLVKRLKGLLNQNENDKP 1801
            +  +E   EN      S + D+IL M+GY VG+G + + PYL       AF IPY +   + GLP+F LEV +GQ  S+G +  W   P L+  G+ M+ ++V   I Y + + + L Y F +F S LPW        +PE                             T  PNL+               S+ + +Y   K   + G    G   W +  C    W ++  +   GI    KVVYFT T  YV + IL++  ++L G+  G+ YF+  +   L +  +W DAA QI   LS A GG++  SS+ +   N   +TLI+T  + +TSI A     +  G++ N +K N + + D    G+ F+  P+ ++ +P + F+A +++++L+T+G DT    +  +  SI + F K     +   T+G C   FI+  P+   GG+Y+F L DT++ S+  +  A+   + +  +Y       DI  M+   P    I+ K+ W F+         +L   L +  Y +   P T+      Y Y +  +  GW + +C  + + I   I +    G  ++RLK + +   +  P
Sbjct:  173 IPEDEQGDENKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVIGDHPKIQIKNSTFCMTAYPNLTMVNFTSQTNKTFVSGSEEYFKYFVLKI--SAGIEYPGEIRWPLAFCLFLAWVIVYASLAKGIKSSGKVVYFTATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQ-GPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPKYLRTHKPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGLQRFCEDIEMMIGFKP---NIFWKVCWAFV------TPTILTFILCFSFYQW--EPMTY----GSYRYPNWSMVLGWLMLACSVIWIPIMFVIKMYLAPGRFIERLKLVCSPQPDWGP 754          
BLAST of slc6a-22 vs. Ensembl Mouse
Match: Slc6a5 (solute carrier family 6 (neurotransmitter transporter, glycine), member 5 [Source:MGI Symbol;Acc:MGI:105090])

HSP 1 Score: 180.644 bits (457), Expect = 1.147e-47
Identity = 164/600 (27.33%), Postives = 274/600 (45.67%), Query Frame = 2
Query:  161 LDTNEDHLENSNPQRISQRFDYXXXXXXXXXXXXXXXKTPYLV-HKYTAAFFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWGCSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPW--------SPEAMQ--------------------------TPDPNLS---------------SQRFLEYQGFKTINATGTLKIGLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFL--RISDLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYL-NLKKFNFQILKDTTNLGVGFIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSILELFSKNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLCTALLVTIMMLVLYKGTEISTDINFMLSNDPITLKIWKKIKWYFIVLWYGPVQIVLMIFLVYKIYIFGEHPFTFYVNSQVYNYTSSELAGGWFIGSCVPLSVLITIGIYLMKFKGPLVKRLKGLLNQNENDKP 1801
            +  +E   EN      S + D+IL M+GY VG+G + + PYL       AF IPY +   + GLP+F LEV +GQ  S+G +  W   P L+  G+ M+ ++V   I Y + + + L Y F +F S LPW        +PE                             T  PNL+               S+ + +Y   K   + G    G   W +  C    W ++  +   GI    KVVYFT T  YV + IL++  ++L G+  G+ YF+  +   L +  +W DAA QI   LS A GG++  SS+ +   N   +TLI+T  + +TSI A     +  G++ N +K N + + D    G+ F+  P+ ++ +P + F+A +++++L+T+G DT    +  +  SI + F K     +   T+G C   FI+  P+   GG+Y+F L DT++ S+  +  A+   + +  +Y       DI  M+   P    I+ K+ W F+         +L   L +  Y +   P T+      Y Y +  +  GW + +C  + + I   I +    G  ++RLK + +   +  P
Sbjct:  173 IPEDEQGDENKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVIGDHPKIQIKNSTFCMTAYPNLTMVNFTSQTNKTFVSGSEEYFKYFVLKI--SAGIEYPGEIRWPLAFCLFLAWVIVYASLAKGIKSSGKVVYFTATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQ-GPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPKYLRTHKPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGLQRFCEDIEMMIGFKP---NIFWKVCWAFV------TPTILTFILCFSFYQW--EPMTY----GSYRYPNWSMVLGWLMLACSVIWIPIMFVIKMYLAPGRFIERLKLVCSPQPDWGP 754          
BLAST of slc6a-22 vs. Ensembl Mouse
Match: Slc6a3 (solute carrier family 6 (neurotransmitter transporter, dopamine), member 3 [Source:MGI Symbol;Acc:MGI:94862])

HSP 1 Score: 174.481 bits (441), Expect = 3.045e-46
Identity = 137/518 (26.45%), Postives = 250/518 (48.26%), Query Frame = 2
Query:   35 MNELDCDI-----VINPCFNANPKETRQENNIHYEVNTAYMNSNCENLDTNEDHLENSNPQRISQRFDYXXXXXXXXXXXXXXXKTPYLVHKYTA-AFFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWGCSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPW--------SPEAMQTPDPNLS-------------SQRFLEYQGFKTINATGTLKIGLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFLRIS--DLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYLNLKKFNFQILKDTTNLGVG--FIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSILELFSKNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLCTALLVTIMMLVLYKGTEISTDINFMLSNDP 1495
            M++  C +     V+ P    N    R+   I  +       +N   ++  +  +E    +  S++ D++L +IG+ V +  + + PYL +K    AF +PY +F  I G+PLF +E+ +GQ    G    W   P+LK +G  ++ ++      Y + + WAL YFF +F  +LPW        SP        N S             +  + E        + G   +G P W++  C + +  LL  +   G+    KVV+ T T+ YV +  L++  ++L G++DG++ +L +    L   ++W DAA Q+   L +  G ++ FSS+ +   N   + +I T ++  TS  +     ++ GY+  +K N  I +D    G G  FI  P+ I+T+P ++ +A V++++L+T+G D+A+G +  V   +++ F   +  +E + T+GI   +F++S+    +GG+Y+F L D F+   + L   L+  I +   Y   + S DI  M    P
Sbjct:    1 MSKSKCSVGPMSSVVAPAKEPNAVGPREVELILVKEQNGVQLTNSTLINPPQTPVEVQERETWSKKIDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYLLFMVIAGMPLFYMELALGQFNREGAAGVWKICPVLKGVGFTVILISFYVGFFYNVIIAWALHYFFSSFTMDLPWIHCNNTWNSPNCSDAHSSNSSDGLGLNDTFGTTPAAEYFERGVLHLHQSRGIDDLGPPRWQLTACLVLVIVLLYFSLWKGVKTSGKVVWITATMPYVVLTALLLRGVTLPGAMDGIRAYLSVDFYRLCEASVWIDAATQVCFSLGVGFGVLIAFSSYNKFTNNCYRDAIITTSINSLTSFSSGFVVFSFLGYMA-QKHNVPI-RDVATDGPGLIFIIYPEAIATLPLSSAWAAVFFLMLLTLGIDSAMGGMESVITGLVDEFQLLHRHRELF-TLGIVLATFLLSLFCVTNGGIYVFTLLDHFAAGTSILFGVLIEAIGVAWFYGVQQFSDDIKQMTGQRP 515          
BLAST of slc6a-22 vs. Ensembl Mouse
Match: Slc6a2 (solute carrier family 6 (neurotransmitter transporter, noradrenalin), member 2 [Source:MGI Symbol;Acc:MGI:1270850])

HSP 1 Score: 168.703 bits (426), Expect = 2.851e-44
Identity = 152/630 (24.13%), Postives = 293/630 (46.51%), Query Frame = 2
Query:   62 INPCFNANPKETRQENNIHYEVNTAYMNSNCENLDTNEDHLENSNPQRI-SQRFDYXXXXXXXXXXXXXXXKTPYLVHKYTA-AFFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWGCSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPWSPEAMQTPDPNLSSQRFL---------EYQGFKTINA--------------TGTLKIGLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFLRIS--DLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYL-NLKKFNFQILKDTTNLGVGFIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSILELFSKNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLCTALLVTIMMLVLYKGTEISTDINFMLSNDPITLKIWKKIKWYFIVLWYGPVQIVLMIFLVYKIYIFGEHPFTFYVNSQVYNYTSSELAGGWFIGSCVPLSVLITIGIYL----MKFKGPLVKRLKGLLNQNENDKPWYPVSPNDKNDLLAFKKV 1855
            + PC  A+    ++ N +             + L  ++D   ++ P+    ++ D++L ++G+ V +  + + PYL +K    AF IPYT+F  I G+PLF +E+ +GQ    G    W   P  K +G  ++ + +     Y + + W+L Y F +F  NLPW+        PN +  + L         +Y  +K   A              +G   IGLP W+++LC + +  +L  +   G+    KVV+ T T+ Y  +F+L+VH ++L G+ +G+  +L I    L    +W DAA QI   L    G ++ F+S+ +   N   + L+ + ++  TS ++     +  GY+ +  K N + +  T   G+ FI  P+ IST+  + F+A +++++L+ +G D+++G +  V   + + F      ++ +  + +   +F++++     GG+Y+  L DTF+   + L   L+  I +   Y     S DI  M+   P    ++ ++ W F       V    ++F+V  + I    P T+       +YT    A   ++G  + LS +I +  Y+    +  +G L +R+             Y ++P +++ L+A + V
Sbjct:   25 LRPCKTADLLVVKERNGV-------------QCLLASQD--SDAQPRETWGKKIDFLLSVVGFAVDLANVWRFPYLCYKNGGGAFLIPYTLFLIIAGMPLFYMELALGQYNREGAATVWKICPFFKGVGYAVILIALYVGFYYNVIIAWSLYYLFASFTLNLPWTNCGHSWNSPNCTDPKLLNASVLGDHTKYSKYKFTPAAEFYERGVLHLHESSGIHDIGLPQWQLLLCLMVVIVVLYFSLWKGVKTSGKVVWITATLPYFVLFVLLVHGVTLPGASNGINAYLHIDFYRLKEATVWIDAATQIFFSLGAGFGVLIAFASYNKFDNNCYRDALLTSTINCVTSFISGFAIFSILGYMAHEHKVNIEDVA-TEGAGLVFILYPEAISTLSGSTFWAVLFFLMLLALGLDSSMGGMEAVITGLADDFQVLKRHRKLFTCV-VTISTFLLALFCITKGGIYVLTLLDTFAAGTSILFAVLMEAIGVSWFYGVDRFSNDIQQMMGFKP---GLYWRLCWKF-------VSPAFLLFVVV-VSIINFKPLTY------DDYTYPPWAN--WVGWGIALSSMILVPAYVIYKFLSIRGSLWERVA------------YGITPENEHHLVAQRDV 606          
BLAST of slc6a-22 vs. UniProt/SwissProt
Match: sp|Q9Y345|SC6A5_HUMAN (Sodium- and chloride-dependent glycine transporter 2 OS=Homo sapiens OX=9606 GN=SLC6A5 PE=1 SV=3)

HSP 1 Score: 184.882 bits (468), Expect = 2.827e-48
Identity = 169/611 (27.66%), Postives = 281/611 (45.99%), Query Frame = 2
Query:  131 TAYMNSNCENLDTNEDHLENSNPQR--ISQRFDYXXXXXXXXXXXXXXXKTPYLV-HKYTAAFFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWGCSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPW--------SPEAMQ--------------------------TPDPNLSSQRFLEYQGFKTINATGT-------LKIGLPV-------WEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFL--RISDLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYL-NLKKFNFQILKDTTNLGVGFIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSILELFSKNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLCTALLVTIMMLVLYKGTEISTDINFMLSNDPITLKIWKKIKWYFIVLWYGPVQIVLMIFLVYKIYIFGEHPFTFYVNSQVYNYTSSELAGGWFIGSCVPLSVLITIGIYLMKFKGPLVKRLKGLLNQNENDKP 1801
            T+ +  +   + T ED   + N  R   S + D+IL M+GY VG+G + + PYL       AF IPY +   + GLP+F LEV +GQ  S+G +  W   P L+  G+ M+ ++V   I Y + + + L Y F +F S LPW        +PE                             T  PN++   F   Q  KT  +          LKI   +       W + LC    W ++  +   GI    KVVYFT T  YV + IL++  ++L G+  G+ YF+  +   L +  +W DAA QI   LS A GG++  SS+ +   N   +TLI+T  + +TSI A     +  G++ N +K N + + D    G+ F+  P+ ++ +P + F+A +++++L+T+G DT    +  +  SI + F K     +   T+G C   FI+  P+   GG+Y+F L DT++ S+  +  A+   + +  +Y       DI  M+   P    I+ K+ W F+         +L   L +  Y +   P T+      Y Y +  +  GW + +C  + + I   I +    G  ++RLK + +   +  P
Sbjct:  167 TSVLPGSVATVATQEDEQGDENKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVISDHPKIQIKNSTFCMTAYPNVTMVNFTS-QANKTFVSGSEEYFKYFVLKISAGIEYPGEIRWPLALCLFLAWVIVYASLAKGIKTSGKVVYFTATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQ-GPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPKYLRTHKPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGLQRFCEDIEMMIGFQP---NIFWKVCWAFV------TPTILTFILCFSFYQW--EPMTY----GSYRYPNWSMVLGWLMLACSVIWIPIMFVIKMHLAPGRFIERLKLVCSPQPDWGP 760          
BLAST of slc6a-22 vs. UniProt/SwissProt
Match: sp|P58295|SC6A5_RAT (Sodium- and chloride-dependent glycine transporter 2 OS=Rattus norvegicus OX=10116 GN=Slc6a5 PE=1 SV=2)

HSP 1 Score: 181.03 bits (458), Expect = 6.031e-47
Identity = 164/601 (27.29%), Postives = 274/601 (45.59%), Query Frame = 2
Query:  158 NLDTNEDHLENSNPQRISQRFDYXXXXXXXXXXXXXXXKTPYLV-HKYTAAFFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWGCSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPW--------SPEAMQ--------------------------TPDPNLS---------------SQRFLEYQGFKTINATGTLKIGLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFL--RISDLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYL-NLKKFNFQILKDTTNLGVGFIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSILELFSKNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLCTALLVTIMMLVLYKGTEISTDINFMLSNDPITLKIWKKIKWYFIVLWYGPVQIVLMIFLVYKIYIFGEHPFTFYVNSQVYNYTSSELAGGWFIGSCVPLSVLITIGIYLMKFKGPLVKRLKGLLNQNENDKP 1801
             +  +E   EN      S + D+IL M+GY VG+G + + PYL       AF IPY +   + GLP+F LEV +GQ  S+G +  W   P L+  G+ M+ ++V   I Y + + + L Y F +F S LPW        +PE                             T  PNL+               S+ + +Y   K   + G    G   W +  C    W ++  +   GI    KVVYFT T  YV + IL++  ++L G+  G+ YF+  +   L +  +W DAA QI   LS A GG++  SS+ +   N   +TLI+T  + +TSI A     +  G++ N +K N + + D    G+ F+  P+ ++ +P + F+A +++++L+T+G DT    +  +  SI + F K     +   T+G C   FI+  P+   GG+Y+F L DT++ S+  +  A+   + +  +Y       DI  M+   P    I+ K+ W F+         +L   L +  Y +   P T+      Y Y +  +  GW + +C  + + I   I +    G  ++RLK + +   +  P
Sbjct:  180 TIPEDEQGDENKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVIGDHPKIQIKNSTFCMTAYPNLTMVNFTSQANKTFVSGSEEYFKYFVLKI--SAGIEYPGEIRWPLAFCLFLAWVIVYASLAKGIKTSGKVVYFTATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQ-GPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPKYLRTHKPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGLQRFCEDIEMMIGFQP---NIFWKVCWAFV------TPTILTFILCFSFYQW--EPMTY----GSYRYPNWSMVLGWLMLACSVIWIPIMFVIKMYLAPGRFIERLKLVCSPQPDWGP 762          
BLAST of slc6a-22 vs. UniProt/SwissProt
Match: sp|Q761V0|SC6A5_MOUSE (Sodium- and chloride-dependent glycine transporter 2 OS=Mus musculus OX=10090 GN=Slc6a5 PE=1 SV=1)

HSP 1 Score: 180.644 bits (457), Expect = 1.036e-46
Identity = 164/600 (27.33%), Postives = 274/600 (45.67%), Query Frame = 2
Query:  161 LDTNEDHLENSNPQRISQRFDYXXXXXXXXXXXXXXXKTPYLV-HKYTAAFFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWGCSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPW--------SPEAMQ--------------------------TPDPNLS---------------SQRFLEYQGFKTINATGTLKIGLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFL--RISDLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYL-NLKKFNFQILKDTTNLGVGFIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSILELFSKNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLCTALLVTIMMLVLYKGTEISTDINFMLSNDPITLKIWKKIKWYFIVLWYGPVQIVLMIFLVYKIYIFGEHPFTFYVNSQVYNYTSSELAGGWFIGSCVPLSVLITIGIYLMKFKGPLVKRLKGLLNQNENDKP 1801
            +  +E   EN      S + D+IL M+GY VG+G + + PYL       AF IPY +   + GLP+F LEV +GQ  S+G +  W   P L+  G+ M+ ++V   I Y + + + L Y F +F S LPW        +PE                             T  PNL+               S+ + +Y   K   + G    G   W +  C    W ++  +   GI    KVVYFT T  YV + IL++  ++L G+  G+ YF+  +   L +  +W DAA QI   LS A GG++  SS+ +   N   +TLI+T  + +TSI A     +  G++ N +K N + + D    G+ F+  P+ ++ +P + F+A +++++L+T+G DT    +  +  SI + F K     +   T+G C   FI+  P+   GG+Y+F L DT++ S+  +  A+   + +  +Y       DI  M+   P    I+ K+ W F+         +L   L +  Y +   P T+      Y Y +  +  GW + +C  + + I   I +    G  ++RLK + +   +  P
Sbjct:  181 IPEDEQGDENKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVIGDHPKIQIKNSTFCMTAYPNLTMVNFTSQTNKTFVSGSEEYFKYFVLKI--SAGIEYPGEIRWPLAFCLFLAWVIVYASLAKGIKSSGKVVYFTATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQ-GPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPKYLRTHKPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGLQRFCEDIEMMIGFKP---NIFWKVCWAFV------TPTILTFILCFSFYQW--EPMTY----GSYRYPNWSMVLGWLMLACSVIWIPIMFVIKMYLAPGRFIERLKLVCSPQPDWGP 762          
BLAST of slc6a-22 vs. UniProt/SwissProt
Match: sp|P23977|SC6A3_RAT (Sodium-dependent dopamine transporter OS=Rattus norvegicus OX=10116 GN=Slc6a3 PE=2 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 1.501e-45
Identity = 137/518 (26.45%), Postives = 251/518 (48.46%), Query Frame = 2
Query:   35 MNELDCDI-----VINPCFNANPKETRQENNIHYEVNTAYMNSNCENLDTNEDHLENSNPQRISQRFDYXXXXXXXXXXXXXXXKTPYLVHKYTA-AFFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWGCSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPW--------SPEAMQTPDPNLS-------------SQRFLEYQGFKTINATGTLKIGLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFLRIS--DLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYLNLKKFNFQILKDTTNLGVG--FIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSILELFSKNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLCTALLVTIMMLVLYKGTEISTDINFMLSNDP 1495
            M++  C +     V+ P   +N    R+   I  +       +N   ++  +  +E    +  S++ D++L +IG+ V +  + + PYL +K    AF +PY +F  I G+PLF +E+ +GQ    G    W   P+LK +G  ++ ++      Y + + WAL YFF +F  +LPW        SP        N S             +  + E        + G   +G P W++  C + +  LL  +   G+    KVV+ T T+ YV +  L++  ++L G++DG++ +L +    L   ++W DAA Q+   L +  G ++ FSS+ +   N   + +I T ++  TS  +     ++ GY+  +K N  I +D    G G  FI  P+ I+T+P ++ +A V++++L+T+G D+A+G +  V   +++ F   +  +E + T+GI   +F++S+    +GG+Y+F L D F+   + L   L+  I +   Y   + S DI  M    P
Sbjct:    1 MSKSKCSVGPMSSVVAPAKESNAVGPREVELILVKEQNGVQLTNSTLINPPQTPVEAQERETWSKKIDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYLLFMVIAGMPLFYMELALGQFNREGAAGVWKICPVLKGVGFTVILISFYVGFFYNVIIAWALHYFFSSFTMDLPWIHCNNTWNSPNCSDAHASNSSDGLGLNDTFGTTPAAEYFERGVLHLHQSRGIDDLGPPRWQLTACLVLVIVLLYFSLWKGVKTSGKVVWITATMPYVVLTALLLRGVTLPGAMDGIRAYLSVDFYRLCEASVWIDAATQVCFSLGVGFGVLIAFSSYNKFTNNCYRDAIITTSINSLTSFSSGFVVFSFLGYMA-QKHNVPI-RDVATDGPGLIFIIYPEAIATLPLSSAWAAVFFLMLLTLGIDSAMGGMESVITGLVDEFQLLHRHRELF-TLGIVLATFLLSLFCVTNGGIYVFTLLDHFAAGTSILFGVLIEAIGVAWFYGVQQFSDDIKQMTGQRP 515          
BLAST of slc6a-22 vs. UniProt/SwissProt
Match: sp|Q61327|SC6A3_MOUSE (Sodium-dependent dopamine transporter OS=Mus musculus OX=10090 GN=Slc6a3 PE=1 SV=2)

HSP 1 Score: 174.481 bits (441), Expect = 2.130e-45
Identity = 137/518 (26.45%), Postives = 250/518 (48.26%), Query Frame = 2
Query:   35 MNELDCDI-----VINPCFNANPKETRQENNIHYEVNTAYMNSNCENLDTNEDHLENSNPQRISQRFDYXXXXXXXXXXXXXXXKTPYLVHKYTA-AFFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWGCSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPW--------SPEAMQTPDPNLS-------------SQRFLEYQGFKTINATGTLKIGLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFLRIS--DLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYLNLKKFNFQILKDTTNLGVG--FIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSILELFSKNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLCTALLVTIMMLVLYKGTEISTDINFMLSNDP 1495
            M++  C +     V+ P    N    R+   I  +       +N   ++  +  +E    +  S++ D++L +IG+ V +  + + PYL +K    AF +PY +F  I G+PLF +E+ +GQ    G    W   P+LK +G  ++ ++      Y + + WAL YFF +F  +LPW        SP        N S             +  + E        + G   +G P W++  C + +  LL  +   G+    KVV+ T T+ YV +  L++  ++L G++DG++ +L +    L   ++W DAA Q+   L +  G ++ FSS+ +   N   + +I T ++  TS  +     ++ GY+  +K N  I +D    G G  FI  P+ I+T+P ++ +A V++++L+T+G D+A+G +  V   +++ F   +  +E + T+GI   +F++S+    +GG+Y+F L D F+   + L   L+  I +   Y   + S DI  M    P
Sbjct:    1 MSKSKCSVGPMSSVVAPAKEPNAVGPREVELILVKEQNGVQLTNSTLINPPQTPVEVQERETWSKKIDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYLLFMVIAGMPLFYMELALGQFNREGAAGVWKICPVLKGVGFTVILISFYVGFFYNVIIAWALHYFFSSFTMDLPWIHCNNTWNSPNCSDAHSSNSSDGLGLNDTFGTTPAAEYFERGVLHLHQSRGIDDLGPPRWQLTACLVLVIVLLYFSLWKGVKTSGKVVWITATMPYVVLTALLLRGVTLPGAMDGIRAYLSVDFYRLCEASVWIDAATQVCFSLGVGFGVLIAFSSYNKFTNNCYRDAIITTSINSLTSFSSGFVVFSFLGYMA-QKHNVPI-RDVATDGPGLIFIIYPEAIATLPLSSAWAAVFFLMLLTLGIDSAMGGMESVITGLVDEFQLLHRHRELF-TLGIVLATFLLSLFCVTNGGIYVFTLLDHFAAGTSILFGVLIEAIGVAWFYGVQQFSDDIKQMTGQRP 515          
BLAST of slc6a-22 vs. TrEMBL
Match: A0A0H3YF59 (Slc6a-22 OS=Schmidtea mediterranea OX=79327 GN=slc6a-22 PE=2 SV=1)

HSP 1 Score: 1174.46 bits (3037), Expect = 0.000e+0
Identity = 608/608 (100.00%), Postives = 608/608 (100.00%), Query Frame = 2
Query:   35 MNELDCDIVINPCFNANPKETRQENNIHYEVNTAYMNSNCENLDTNEDHLENSNPQRISQRFDYXXXXXXXXXXXXXXXKTPYLVHKYTAAFFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWGCSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPWSPEAMQTPDPNLSSQRFLEYQGFKTINATGTLKIGLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFLRISDLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYLNLKKFNFQILKDTTNLGVGFIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSILELFSKNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLCTALLVTIMMLVLYKGTEISTDINFMLSNDPITLKIWKKIKWYFIVLWYGPVQIVLMIFLVYKIYIFGEHPFTFYVNSQVYNYTSSELAGGWFIGSCVPLSVLITIGIYLMKFKGPLVKRLKGLLNQNENDKPWYPVSPNDKNDLLAFKKVT 1858
            MNELDCDIVINPCFNANPKETRQENNIHYEVNTAYMNSNCENLDTNEDHLENSNPQRISQRFDYILIMIGYIVGIGGIIKTPYLVHKYTAAFFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWGCSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPWSPEAMQTPDPNLSSQRFLEYQGFKTINATGTLKIGLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFLRISDLGNMAMWTDAAIQIILILSLAEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYLNLKKFNFQILKDTTNLGVGFIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSILELFSKNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLCTALLVTIMMLVLYKGTEISTDINFMLSNDPITLKIWKKIKWYFIVLWYGPVQIVLMIFLVYKIYIFGEHPFTFYVNSQVYNYTSSELAGGWFIGSCVPLSVLITIGIYLMKFKGPLVKRLKGLLNQNENDKPWYPVSPNDKNDLLAFKKVT
Sbjct:    1 MNELDCDIVINPCFNANPKETRQENNIHYEVNTAYMNSNCENLDTNEDHLENSNPQRISQRFDYILIMIGYIVGIGGIIKTPYLVHKYTAAFFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWGCSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPWSPEAMQTPDPNLSSQRFLEYQGFKTINATGTLKIGLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFLRISDLGNMAMWTDAAIQIILILSLAEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYLNLKKFNFQILKDTTNLGVGFIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSILELFSKNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLCTALLVTIMMLVLYKGTEISTDINFMLSNDPITLKIWKKIKWYFIVLWYGPVQIVLMIFLVYKIYIFGEHPFTFYVNSQVYNYTSSELAGGWFIGSCVPLSVLITIGIYLMKFKGPLVKRLKGLLNQNENDKPWYPVSPNDKNDLLAFKKVT 608          
BLAST of slc6a-22 vs. TrEMBL
Match: A0A4W6DP93 (Transporter OS=Lates calcarifer OX=8187 PE=3 SV=1)

HSP 1 Score: 223.787 bits (569), Expect = 1.713e-60
Identity = 180/593 (30.35%), Postives = 290/593 (48.90%), Query Frame = 2
Query:  173 EDHLENSNPQRISQRFDYXXXXXXXXXXXXXXXKTPYLVHKYTA-AFFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWGCSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPWSP--------------------EAMQTPDPNL-------SSQRFLEYQGFKTINATGTLKIGLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFL----RISDLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYLN--LKKFNFQILKDTTNLGVGFIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSILELFSKNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLCTALLVTIMMLVLYKGTEISTDINFMLSNDPITLKIWKKIKWYFIVLWYGPVQIVLMI---FLVYKIYIFGEHPFTFYVNSQVYNYTSSELAGGWFIGSCVPLSVLI---TIGIY-LMKFKGPLVKRLKGLLNQNENDKPWYPVSPNDK 1828
            +D  EN+     + + +YIL  IGY VG+G I + PYL +K    AF IPY +   + G+PLF LE   GQ  S+G I  W   PLL+ +GV MV +T+   I Y + + ++L Y F +F S LPWS                     E    P  ++        S+++ +    +   ++G  + G  VW + LC L    L+  A I GI    KVVYFT T  YV IFIL++  ++LEG+ DG+++++     ++ L    +W DAA Q    LS+  GG+M  +S+     N+  ++ ++T  +  TS+ A     +  G++    K    Q++K+    G+ FIA P  +S +P +  ++ +++ +L+T+G D+    + +++  +L+ F      K A +TI  CAI +++ +P  +  G+Y   L D F  SW  L  ALL  I +  +Y G     DI  ML N   T  +W +  W+FI     P  IV+++    + +K   +GE  F  +            LA GW    C+ + +L     I +Y LM+ KG   KRLK L + +E   P+  V   D+
Sbjct:   27 DDGDENTERGNWASKREYILSTIGYAVGLGNIWRFPYLAYKNGGGAFLIPYFVMLVVTGIPLFFLESAFGQFCSQGPINIWRAVPLLQGVGVAMVTVTLIVSIYYNVIIAYSLYYMFASFQSPLPWSSCFSWADSNCSTTPIVANWTQENSTCPSSDVITVPVQSPSEQYWDRVALQ--RSSGLDETGPIVWHLALCLLLSSILVAGALIRGIKSSGKVVYFTATFPYVVIFILLIRGVTLEGARDGIEFYIGSQSNLTKLSEAQVWKDAATQTFYSLSIGWGGVMTLASYNNFHNNVFKDSFVVTLTNAGTSVFAGFAIFSILGHMAHIYKMPVGQVVKE--GFGLAFIAYPDALSKLPISPLWSILFFFMLLTVGLDSQFAGIEVITTCLLDAFPNIFKSKRALLTITTCAILYLLGLPCVSQAGIYWVTLIDQFVASWVLLVLALLEIIGVCYIYGGNRFIKDIEMMLGNKTSTFWLWWRACWFFI----SPCIIVVILVWSLMTFKPPTYGEVQFPVW-----------GLALGW----CMVVFILFWIPAIAVYKLMRAKGSPWKRLKSLCSPSEKWHPYLDVHRGDR 596          
BLAST of slc6a-22 vs. TrEMBL
Match: A0A4W6DMP2 (Transporter OS=Lates calcarifer OX=8187 PE=3 SV=1)

HSP 1 Score: 218.779 bits (556), Expect = 5.937e-59
Identity = 167/568 (29.40%), Postives = 272/568 (47.89%), Query Frame = 2
Query:  272 KTPYLVHKYTA-AFFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWGCSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPWSP-----------------------------EAMQTPDPNL-------SSQRFLEYQGFKTINATGTLKIGLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFL----RISDLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYLN--LKKFNFQILKDTTNLGVGFIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSILELFSKNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLCTALLVTIMMLVLYKGTEISTDINFMLSNDPITLKIWKKIKWYFIVLWYGPVQIVLMIF--LVYKIYIFGEHPFTFYVNSQVYNYTSSELAGGWFIGSCVPLSVLI---TIGIY-LMKFKGPLVKRLKGLLNQNENDKPWYPVSPNDK 1828
            + PYL +K    AF IPY +   + G+PLF LE   GQ  S+G I  W   PLL+ +GV MV +T+   I Y + + ++L Y F +F S LPWS                              E    P  ++        S+++ +    +   ++G  + G  VW + LC L    L+  A I GI    KVVYFT T  YV IFIL++  ++LEG+ DG+++++     ++ L    +W DAA Q    LS+  GG+M  +S+     N+  ++ ++T  +  TS+ A     +  G++    K    Q++K+    G+ FIA P  +S +P +  ++ +++ +L+T+G D+    + +++  +L+ F      K A +TI  CAI +++ +P  +  G+Y   L D F  SW  L  ALL  I +  +Y G     DI  ML N   T  +W +  W+FI     P  IV++++  + +K   +GE  F  +            LA GW    C+ + +L     I +Y LM+ KG   KRLK L + +E   P+  V   D+
Sbjct:   28 RFPYLAYKNGGGAFLIPYFVMLVVTGIPLFFLESAFGQFCSQGPINIWRAVPLLQGVGVAMVTVTLIVSIYYNVIIAYSLYYMFASFQSPLPWSSCFSWADSNCSTTPIVSCNVSGVVVANWTQENSTCPSSDVITVPVQSPSEQYWDRVALQ--RSSGLDETGPIVWHLALCLLLSSILVAGALIRGIKSSGKVVYFTATFPYVVIFILLIRGVTLEGARDGIEFYIGSQSNLTKLSEAQVWKDAATQTFYSLSIGWGGVMTLASYNNFHNNVFKDSFVVTLTNAGTSVFAGFAIFSILGHMAHIYKMPVGQVVKE--GFGLAFIAYPDALSKLPISPLWSILFFFMLLTVGLDSQFAGIEVITTCLLDAFPNIFKSKRALLTITTCAILYLLGLPCVSQAGIYWVTLIDQFVASWVLLVLALLEIIGVCYIYGGNRFIKDIEMMLGNKTSTFWLWWRACWFFI----SPCIIVILVWSLMTFKPPTYGEVQFPVW-----------GLALGW----CMVVFILFWIPAIAVYKLMRAKGSPWKRLKSLCSPSEKWHPYLDVHRGDR 572          
BLAST of slc6a-22 vs. TrEMBL
Match: F6NN04 (Transporter OS=Danio rerio OX=7955 GN=slc6a14 PE=3 SV=1)

HSP 1 Score: 213.772 bits (543), Expect = 4.255e-57
Identity = 164/586 (27.99%), Postives = 285/586 (48.63%), Query Frame = 2
Query:  143 NSNCENLDTNEDHLENSNPQRISQRFDYXXXXXXXXXXXXXXXKTPYLVHKYTA-AFFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWGCSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPWSPEAMQTPDPNLS----------------SQRFLEYQGFKTINATGTLKIGLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFL----RISDLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYLNLKKFNFQI-LKDTTNLG--VGFIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSILELFSKNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLCTALLVTIMMLVLYKGTEISTDINFMLSNDPITLKIWKKIKWYFIVLWYGPVQIVLMIFLVYKIYIFGEHPFTFYVNSQVYNYTSSELAGGWFIGSCVPLSVLITIGIYLMKFKGPLVKRLKGLLNQNENDKPWYPVSPNDK 1828
            +   E++  N+   ENS+    S + +Y+L MIGY VG+G + + PYL +K+   AF IPYTI   + GLPLF +E   GQ  S+G I  W   P+L+ +G+ M+ ++    I Y + + +++ Y F +F   LPWS +   T   N+S                S+++ +    +   ++   + G  VW + LC L  W L+  A   GI    KVVYFT T  Y+ + IL++   +LEG+ DG+++++     ++ L    +W DAA QI   LS+A GG+M  SS+ +   N   +++++   +  TSI A     A F  L      +Q  + +  + G  + FIA P  +S +P +  ++ +++ +L+T+G D+    + ++S  +L+ + +    K   VT  +C I F++ +P     G+Y   L DTFS  W  L   LL  + + +LY G     DI  M+        +W +  W+FI        +VL I L++ +Y F    ++         Y    ++ GW I +   + + I     + K +G L +R+K   +  E+  P+      ++
Sbjct:   27 SDKAEHVVQND---ENSDRGNWSSKREYMLSMIGYAVGLGNVWRFPYLAYKHGGGAFLIPYTIMLAVSGLPLFFMESSFGQFCSQGPINVWKAVPILQGVGITMMLVSTFVAIYYNVIIAYSIYYLFASFQDPLPWSIKNCNTTASNISTAAVNVSCGQISGQSLSEKYWDEVALQ--RSSSMDETGPVVWHLALCLLLSWILVGAALFKGIKSSGKVVYFTATFPYIVLLILLIRGATLEGAKDGIEFYIGSQSNLTKLAEAEVWKDAATQIFFSLSIAWGGLMALSSYNKFYNNCYQDSIVVCVTNCGTSIFAGF---AIFSVLGHMAHVYQRPVSEVADAGFALAFIAYPDALSKLPISPLWSILFFFMLITLGLDSQFAGIEVISTCLLDAYPEVLKSKRGLVTTAVCIILFLLGLPCVTRAGIYWVNLIDTFSAGWILLVAGLLEVLGLCILYGGNRFIKDIEMMIGTKSSLFWLWWRACWFFI------TPVVLSIILIWSLYTFTSPTYSSVA------YPDWGISLGWCITAFSLMWIPIVAVWKVCKARGGLWQRIKSACSPTEDWGPYLECHRGER 592          
BLAST of slc6a-22 vs. TrEMBL
Match: Q1ECY9 (Transporter (Fragment) OS=Danio rerio OX=7955 GN=slc6a14 PE=2 SV=1)

HSP 1 Score: 214.157 bits (544), Expect = 4.413e-57
Identity = 164/586 (27.99%), Postives = 285/586 (48.63%), Query Frame = 2
Query:  143 NSNCENLDTNEDHLENSNPQRISQRFDYXXXXXXXXXXXXXXXKTPYLVHKYTA-AFFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWGCSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPWSPEAMQTPDPNLS----------------SQRFLEYQGFKTINATGTLKIGLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFL----RISDLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYLNLKKFNFQI-LKDTTNLG--VGFIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSILELFSKNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLCTALLVTIMMLVLYKGTEISTDINFMLSNDPITLKIWKKIKWYFIVLWYGPVQIVLMIFLVYKIYIFGEHPFTFYVNSQVYNYTSSELAGGWFIGSCVPLSVLITIGIYLMKFKGPLVKRLKGLLNQNENDKPWYPVSPNDK 1828
            +   E++  N+   ENS+    S + +Y+L MIGY VG+G + + PYL +K+   AF IPYTI   + GLPLF +E   GQ  S+G I  W   P+L+ +G+ M+ ++    I Y + + +++ Y F +F   LPWS +   T   N+S                S+++ +    +   ++   + G  VW + LC L  W L+  A   GI    KVVYFT T  Y+ + IL++   +LEG+ DG+++++     ++ L    +W DAA QI   LS+A GG+M  SS+ +   N   +++++   +  TSI A     A F  L      +Q  + +  + G  + FIA P  +S +P +  ++ +++ +L+T+G D+    + ++S  +L+ + +    K   VT  +C I F++ +P     G+Y   L DTFS  W  L   LL  + + +LY G     DI  M+        +W +  W+FI        +VL I L++ +Y F    ++         Y    ++ GW I +   + + I     + K +G L +R+K   +  E+  P+      ++
Sbjct:   38 SDKAEHVVQND---ENSDRGNWSSKREYMLSMIGYAVGLGNVWRFPYLAYKHGGGAFLIPYTIMLAVSGLPLFFMESSFGQFCSQGPINVWKAVPILQGVGITMMLVSTFVAIYYNVIIAYSIYYLFASFQDPLPWSIKNCNTTASNISTAAVNVSCGQISGQSLSEKYWDEVALQ--RSSSMDETGPVVWHLALCLLLSWILVGAALFKGIKSSGKVVYFTATFPYIVLLILLIRGATLEGAKDGIEFYIGSQSNLTKLAEAEVWKDAATQIFFSLSIAWGGLMALSSYNKFYNNCYQDSIVVCVTNCGTSIFAGF---AIFSVLGHMAHVYQRPVSEVADAGFALAFIAYPDALSKLPISPLWSILFFFMLITLGLDSQFAGIEVISTCLLDAYPEVLKSKRGLVTTAVCIILFLLGLPCVTRAGIYWVNLIDTFSAGWILLVAGLLEVLGLCILYGGNRFIKDIEMMIGTKSSLFWLWWRACWFFI------TPVVLSIILIWSLYTFTSPTYSSVA------YPDWGISLGWCITAFSLMWIPIVAVWKVCKARGGLWQRIKSACSPTEDWGPYLECHRGER 603          
BLAST of slc6a-22 vs. Ensembl Cavefish
Match: slc6a14 (solute carrier family 6 member 14 [Source:NCBI gene;Acc:103047067])

HSP 1 Score: 191.43 bits (485), Expect = 3.728e-52
Identity = 163/624 (26.12%), Postives = 277/624 (44.39%), Query Frame = 2
Query:   83 NPKETRQENNIHYEVNTAYMNSNCENLDTNEDHLENSNPQRISQRFDYXXXXXXXXXXXXXXXKTPYLVHKYTA-AFFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWGCSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPWS------------------------------------------PEAM--QTPDPNLSSQRF--LEYQGFKTINATGTLKIGLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFL----RISDLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYLNLKKFNFQILKDTTNLGVGFIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSILELFSKNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLCTALLVTIMMLVLYKGTEISTDINFMLSNDPITLKIWKKIKWYFIVLWYGPVQIVLMIFLVYKIYIFGEHPFTFYVNSQVYNYTSSELAGGWFIGSCVPLSVLITIGIYLMKFKGPLVKRLKGLLNQNENDKP 1801
            NP  + +  N         + S   ++ T +++ E  N    S + +Y+L MIGY VG+G + + PYL +K+   AF IPY I   I GLPLF LE   GQ  S+G I  W   P+L+ +G+ M+ ++    I Y + + +++ Y F +F   LPWS                                          PE +   TP   +S Q +  +  Q   +++ TG +     VW + LC L  W ++  A   GI    KVVYFT T  Y  + IL++  ++LEG+ +G++Y++     ++ L    +W DAA QI   LS+A GG+   +S+ +   N   +++I+   +  TSI A     +  G++                G+ FIA P  +S +P +  ++ +++ +L+T+G D+    + +++  + + + K    K   +T+ IC + F++ +P     G+Y   L DTF   W  L   LL    +  +Y G     DI  M+ N      IW +  W+FI         VL++ L + +Y F    +          Y    +A GW + +   + + I     + K  G L +R+K      E+  P
Sbjct:   16 NPTASDEAKNA--------VKSQDPHVGTEDENAERGN---WSSKREYMLSMIGYAVGLGNVWRFPYLAYKHGGGAFLIPYVIMLSIAGLPLFFLESSFGQFCSQGPINVWKAVPILQGVGITMMLVSTFVAIYYNVILAYSIYYLFASFQYPLPWSNCSGWSDMGCNINATEYCNTTSYNGSLVALNRSAGADGNQSCPEELIVSTPLQTISEQYWDVVALQRTSSMDETGPV-----VWHLALCLLLGWIMIGAALFKGIKSSGKVVYFTATFPYAVLLILLIRGVTLEGARNGIEYYIGSQSNLTKLSEAEVWKDAATQIFFSLSIAWGGLTALASYNKFHNNCYKDSIIVCVTNCGTSIFAGFAIFSILGHMAHVYGKPVSEVAQAGFGLAFIAYPDALSKLPISPLWSILFFFMLITLGLDSQFAGIEVITTCLQDAYPKFLKSKRGLITVIICVVLFLLGLPCVTGAGIYWVNLIDTFVAGWILLVAGLLEVFGLSCIYGGNRFIKDIEMMIGNKSAIFWIWWRSCWFFI------TPFVLLVILGWSVYTFTAPTY------GTVEYPEWGIALGWCMTAFCLMWIPIVAVWRIAKASGGLWQRIKSTCVPTEDWGP 611          
BLAST of slc6a-22 vs. Ensembl Cavefish
Match: slc6a7 (sodium-dependent proline transporter-like [Source:NCBI gene;Acc:103039122])

HSP 1 Score: 177.948 bits (450), Expect = 2.129e-47
Identity = 144/513 (28.07%), Postives = 247/513 (48.15%), Query Frame = 2
Query:  272 KTPYLVHKYTAA-FFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWGCSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPWSPEAMQTP-------DPNLS-SQRFLEYQGFKTINATGTLKIGLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFLRI--SDLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYLNLKKFNFQILKDTTNLGVGFIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSILELFS--KNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLCTALLVTIMMLVLYKGTEISTDINFMLSNDPITLKIW-KKIKWYFIVLWYGPVQIVLMIFLVYKIYIFGEHPFTFYVNSQVYNYTSSELAGGWFIGSCVPLSVLITIGIYLMKFKGPLVKRLK 1768
            + PYL ++     F IPY I  F  G+PLFL+E+ +GQ  + G I  W C PLLK +G+GM+ ++    + Y + + W   Y   +F S LPWS +A+          +  LS S+ F   +     ++TG    G   W++ LC LA W ++ L  + GI    KVVY T T  Y+ + +LI+   +LEGSL G+ ++L      L N  +W DAA QI   L +  GG++  +S+ +   N++ +TL+IT  + +TS  A     +  G++  +K         +  G+ F+A P+ ++ +P + F+A +++++L  +G DT  G +  ++ ++L+ F   ++N   +      +C   +++ + L  +GG+Y F L D+ S S+  +   L + + +   Y   +   DI  M+   P     W  K+  YF   W      +L+  L Y        P  +      Y Y     A G  +G+   L +LI   + + K  G L  R +
Sbjct:  104 RFPYLCYRNGGGVFLIPYFIMLFFTGMPLFLMELSLGQYGAAGPITVWKCCPLLKGIGIGMLCVSTLVCLYYNVIIAWTFYYLGSSFQSPLPWSCDAIANAKLCRNNTNGTLSPSEFFWNERVLGVSHSTGLSNPGPVRWQLALCLLAAWVIIFLCMLKGIRSSGKVVYVTATFPYLVLVVLIIRGATLEGSLQGVAFYLTPVWGRLANAQVWNDAASQIFYSLGIGVGGLLSMASYNKFDNNVIRDTLVITIGNCATSFFAGFAIFSILGHMAWRKGVPVEKVAISGPGLAFVAYPEALALLPGSVFWAILFFLMLFMLGVDTLFGNMEGITTAVLDEFPQLRSNMKYKTLFLGLLCFGFYLMGLLLVTNGGIYWFTLIDSSSTSFGLIIITLFMCLGISFFYGVNQFCQDIVDMICLCP----PWCTKVLLYFKACWVFFTPFLLLFILTYIFIEMYRTPLKY----GQYIYPLWGKALGVCMGAFCCLQILIWATVAVSKESGTLKDRFQ 608          
BLAST of slc6a-22 vs. Ensembl Cavefish
Match: slc6a3 (solute carrier family 6 member 3 [Source:NCBI gene;Acc:103026128])

HSP 1 Score: 174.481 bits (441), Expect = 2.421e-46
Identity = 143/577 (24.78%), Postives = 280/577 (48.53%), Query Frame = 2
Query:   65 NPCFNANPKETRQENNIHYEVNTAYMNSNCENLDTNEDHLENSNPQRISQRFDYXXXXXXXXXXXXXXXKTPYLVHKYTA-AFFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWGCSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPW-----SPEAMQTPDPNLS----------SQRFLEYQGFKTINATGTLKIGLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFLRIS--DLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYLNLKKFNFQILKDTTN-LGVGFIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSILELFSKNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLCTALLVTIMMLVLYKGTEISTDINFMLSNDPITLKIWKKIKWYFIVLWYGPVQIVLMIFLVYKIY---IFGEHPFTFYVNSQVYNYTSSELAGGWFIGSCVPLSVLITIGIY 1729
             P  +  PKE   E  +  E N     S+     T + H      +   ++ D++L +IG+ V +  + + PYL +K    AF +PY +F  I G+PLF +E+ +GQ    G    W   P+ K +G  ++ +++     Y + + WAL Y F +F+  LPW     +  +    D N +          +  + E       ++ G   +GLP W++  C   +  +L  +   G+    KVV+ T T+ YV + +L++  ++L G++DG+K +L +    L +  +W +AA QI   L +  G ++ FSS+ +   N   + +I + ++  TS  +     ++ GY++ +K N  + K  T+  G+ FI  P+ I+T+P ++ +A +++I+L+T+G D+A+G +  V   +++ F   +  +E + T+ I  ++F++S+    +GG+Y+F L D F+   + L   L+  I +   Y     S DI  M+ + P    ++ ++ W F+     P  ++ M+ + +  +    +G + F  + N                +G C+ +S +I + +Y
Sbjct:   19 KPSSSMGPKEV--ELILVKEQNGVQFTSSALVTSTGQTHPSGEQRETWGKKIDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYLLFMVIAGMPLFYMELALGQYNREGAAGVWKICPVFKGVGFTVILISLYVGFYYNVIIAWALFYLFSSFSGELPWVNCNNTWNSANCSDLNATLLNDSHKVTPALEYFERGVLHMQDSRGIDDLGLPRWQLTCCLAVVIVVLYFSLWKGVKTSGKVVWITATMPYVVLTVLLLRGVTLPGAIDGIKAYLSVDFLRLCDAQVWIEAATQICFSLGVGFGVLIAFSSYNKFSNNCYRDAIITSSINSLTSFFSGFVIFSFLGYMS-QKHNVALDKVATDGPGLVFIIYPEAIATLPGSSVWAVIFFIMLLTLGIDSAMGGMESVITGLIDEFKFLHRHRELF-TLFIVVLTFLISLFCVTNGGIYVFTLLDHFAAGTSILFGVLIEAIGIAWFYGVDRFSDDIQEMIGHRP---GLYWRLCWKFV----SPCFLLFMVVVSFATFNPPKYGSYYFPTWAN---------------MVGWCLSISSMIMVPLY 569          
BLAST of slc6a-22 vs. Ensembl Cavefish
Match: slc6a6b (solute carrier family 6 member 6 [Source:NCBI gene;Acc:103034481])

HSP 1 Score: 171.014 bits (432), Expect = 4.717e-45
Identity = 154/602 (25.58%), Postives = 274/602 (45.51%), Query Frame = 2
Query:  173 EDHLENSNPQRI--SQRFDYXXXXXXXXXXXXXXXKTPYLVHKYTA-AFFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECW-GCSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPWSPEAMQTPDPNLSSQRFLEYQGFKTINAT-------------------GTLKIGLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFL--RISDLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYLNLKKFNFQILKDTTNLGVGFIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSILEL---FSKNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLC-TALLVTIMMLVLYKGTEISTDINFMLSNDPITLKIWKKIKWYFIVLWYGPVQIVLMIFLVYKIYIFGEHPFTFYVNSQVYNYTSSELAGGWFIG----SCVPLSVLITIGIYLMKFKGPLVKRLKGLLN-------------QNENDKPWYPVSPNDKNDLL 1840
            ED  E  +PQR   + + D++L + G  VG+G + + PYL +K    AF IPY IF F  GLP+F LEV +GQ TS+G I CW    P+   +G   + +     I Y++ + W L Y F  F   LPW+         N            +  NAT                   G  K+G   W++ LC L +W +       G+    KVVY T T  +V + +L+V  ++L G+ +G+K++L   ++ L +  +W DA  QI    ++  G +    S+ + K N   + L++  ++ +TS ++     +  G++  ++         +  G+ FIA P+ ++ +P   F+A +++I+L+ +G D+    V     S+++L   F +  Y +E ++ I +C +S+++ + +   GG+Y+F LFD ++ S   L   A    I +  +Y        +  M+   P     W K  W            V+   L    +IF    +     +++Y Y    +  GW +      C+P+ V+I I    ++  GPL++R+K +               + +N +  +P+ PN  N L+
Sbjct:   31 EDEAEGKHPQREKWASKLDFLLSVAGGFVGLGNVWRFPYLCYKNGGGAFLIPYFIFLFGGGLPVFFLEVALGQFTSQGGITCWEKLCPIFTGIGYASIVIVSLLNIYYIVILAWGLYYLFQCFQPELPWASCNNPWNTENCVEDTLRRNMTLRGANATNFTSPVTEFWERNVLSISDGIEKVGPVKWDLALCLLGVWVICFFCIWKGVKSTGKVVYITATFPFVMLIVLLVRGVTLPGAAEGIKFYLYPNVTRLADPEVWIDAGTQIFFSYAICLGAMTSLGSYNKYKYNCYRDCLLLGGLNSATSFVSGFAIFSVLGFMAQEQGVDIADVAESGPGLAFIAYPKAVTMMPLPTFWAILFFIMLLLLGLDSQFVEVEGQITSLVDLYPSFLRKGYRREIFIAI-VCFVSYLLGLTMVTEGGMYVFQLFDYYAASGVCLLWVAFFECIAVAWVYGADNFYDAVEDMIGYRP---NPWMKWCW-----------TVITPLLCVGCFIFSLVKYKPLTYNKIYEYPDWSIGVGWTLALASMICIPMVVVIKI----IQSDGPLIERIKAVAAPVRGGASSCPPEYRPKNTELAHPLDPNGNNGLI 613          
BLAST of slc6a-22 vs. Ensembl Cavefish
Match: slc6a6b (solute carrier family 6 member 6 [Source:NCBI gene;Acc:103034481])

HSP 1 Score: 170.629 bits (431), Expect = 5.559e-45
Identity = 156/603 (25.87%), Postives = 278/603 (46.10%), Query Frame = 2
Query:  173 EDHLENSNPQRI--SQRFDYXXXXXXXXXXXXXXXKTPYLVHKYTA-AFFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECW-GCSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPWSPEAMQTPDPNLSSQRFLEYQGFKTINAT-------------------GTLKIGLPVWEIVLCSLAIWFLLCLAAIY-GIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFL--RISDLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYLNLKKFNFQILKDTTNLGVGFIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSILEL---FSKNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLC-TALLVTIMMLVLYKGTEISTDINFMLSNDPITLKIWKKIKWYFIVLWYGPVQIVLMIFLVYKIYIFGEHPFTFYVNSQVYNYTSSELAGGWFIG----SCVPLSVLITIGIYLMKFKGPLVKRLKGLLN-------------QNENDKPWYPVSPNDKNDLL 1840
            ED  E  +PQR   + + D++L + G  VG+G + + PYL +K    AF IPY IF F  GLP+F LEV +GQ TS+G I CW    P+   +G   + +     I Y++ + W L Y F  F   LPW+         N            +  NAT                   G  K+G   W++ LC L +W ++C   I+ G+    KVVY T T  +V + +L+V  ++L G+ +G+K++L   ++ L +  +W DA  QI    ++  G +    S+ + K N   + L++  ++ +TS ++     +  G++  ++         +  G+ FIA P+ ++ +P   F+A +++I+L+ +G D+    V     S+++L   F +  Y +E ++ I +C +S+++ + +   GG+Y+F LFD ++ S   L   A    I +  +Y        +  M+   P     W K  W            V+   L    +IF    +     +++Y Y    +  GW +      C+P+ V+I I    ++  GPL++R+K +               + +N +  +P+ PN  N L+
Sbjct:   35 EDEAEGKHPQREKWASKLDFLLSVAGGFVGLGNVWRFPYLCYKNGGGAFLIPYFIFLFGGGLPVFFLEVALGQFTSQGGITCWEKLCPIFTGIGYASIVIVSLLNIYYIVILAWGLYYLFQCFQPELPWASCNNPWNTENCVEDTLRRNMTLRGANATNFTSPVTEFWERNVLSISDGIEKVGPVKWDLALCLLGVW-VICFFCIWKGVKSTGKVVYITATFPFVMLIVLLVRGVTLPGAAEGIKFYLYPNVTRLADPEVWIDAGTQIFFSYAICLGAMTSLGSYNKYKYNCYRDCLLLGGLNSATSFVSGFAIFSVLGFMAQEQGVDIADVAESGPGLAFIAYPKAVTMMPLPTFWAILFFIMLLLLGLDSQFVEVEGQITSLVDLYPSFLRKGYRREIFIAI-VCFVSYLLGLTMVTEGGMYVFQLFDYYAASGVCLLWVAFFECIAVAWVYGADNFYDAVEDMIGYRP---NPWMKWCW-----------TVITPLLCVGCFIFSLVKYKPLTYNKIYEYPDWSIGVGWTLALASMICIPMVVVIKI----IQSDGPLIERIKAVAAPVRGGASSCPPEYRPKNTELAHPLDPNGNNGLI 617          
BLAST of slc6a-22 vs. Ensembl Sea Lamprey
Match: slc6a1a (solute carrier family 6 member 1a [Source:ZFIN;Acc:ZDB-GENE-060519-23])

HSP 1 Score: 136.346 bits (342), Expect = 2.420e-34
Identity = 132/469 (28.14%), Postives = 229/469 (48.83%), Query Frame = 2
Query:  215 RFDYXXXXXXXXXXXXXXXKTPYLVHKYTA-AFFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWGCSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPWSPEAMQTPDPNLSSQRFLEYQGFKTINATGT-----------LKIGLPVWEIVLCSLAI-----WFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFL--RISDLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLV-VNTLIITFVDFSTSILACIFSSAYFGYL-NLKKFNFQILKDTTNLGVGFIAIPQVISTIPNANFFAFVYYILLVTIGFD----TALGFVRIVSLSILELFSKNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLCTALLVTIMMLVLYKGTEISTDINFMLSNDPITLKIWKKIKWYFIVLW 1546
            RFD+++  +GY +G+G + + PYL  K    AF IPY +     G+PLFLLE  +GQ TS G +  W  +P+ K +G+  V ++    I Y++ + WA+ Y + +F S LPW        +P  + + F  Y    T N T T           L  GL     V   LAI     W ++      G+ +  KVVYF+ T  YV +F+L    I+L G+ +G+ +++      L + A+W DAA QI     L  G ++   S+     N+   +++I+  ++  TS+ A     +  G++ ++ K   + L   +  G+ F+A PQ ++ +P +  ++ +++ +L+ +G D    T  GFV  +S    +    +   KE ++ + IC IS+I+ +     GGLY+F +FD +S S         ++++ LV ++   IS        ND I   I  K+  ++ + W
Sbjct:   16 RFDFLMSCVGYAIGLGNVWRFPYLCGKNGGGAFLIPYFLTLVFAGIPLFLLETSLGQYTSVGGLGVWKLAPMFKGVGLASVVISFYLNIYYIVIISWAIYYLYNSFTSMLPWQ----DCNNPWNTDKCFSNYSILDTTNLTSTVVEFWERNMHQLSSGLDEPGQVRGPLAITLAISWVMVYFCIWKGVAWTGKVVYFSATFPYVMLFVLFFRGITLPGAKEGILFYITPDFRRLTDSAVWLDAATQIFFSYGLGLGSLVALGSYNPFHNNVYNRDSIIVCCINSVTSVFAGFVIFSIVGFMSHITKKPVKELA-ASGPGLAFLAYPQAVTQLPISPLWSILFFSMLLMLGLDSQFCTVEGFVTALSDEYPQYLRGH---KEIFIAV-ICVISYIIGLANITQGGLYVFKMFDYYSAS--------GMSLLFLVFFETIAISWCYGVDRFNDNICEMIGHKVHKWWNICW 467          
BLAST of slc6a-22 vs. Ensembl Sea Lamprey
Match: slc6a4b (solute carrier family 6 member 4b [Source:ZFIN;Acc:ZDB-GENE-060314-2])

HSP 1 Score: 129.798 bits (325), Expect = 3.570e-32
Identity = 101/425 (23.76%), Postives = 192/425 (45.18%), Query Frame = 2
Query:  302 AAFFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWG-CSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPWSP----------------------EAMQTPDPNLSSQRFLEYQGFKTINATGTLKIGLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFLRIS--DLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYLNLKKFNFQILKDTTNLGVG--FIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSILELFSKNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLCTALLVTIMMLVLYKGTEISTDINFMLSNDP 1495
             AF IPY +     G+PLF +E+ +GQ    G I  W    P+ K +G  +  +       Y   + WAL Y + +F S LPW+                       +  ++P     ++  LE Q  K +   G L+     W+++LC   I+ ++  +   G+    KVV+ T T  YV +FIL++   +L G+  G+ ++L+ +   L    +W DAA QI   L    G ++  +S+ +   N   + L+ + V+  TS ++        GY+   + N ++     ++G    FI  P+ I+ +  + F+A +++++++T+G D+  G +  +  ++++ +      +  Y  +G+  I F+ ++     GG Y+  L + F +  + +   LL  I +   Y       DI+ ML   P
Sbjct:    1 GAFLIPYCLMAVFGGIPLFYMELALGQFHRNGAISIWRRICPIFKGVGFAICIINFYVAFYYNTIIAWALYYLYSSFTSTLPWTKCDNPWNTVNCTSYFDTTGVAWGKHSRSPAEEFYTRNVLEIQYSKGLGGVGGLR-----WQLLLCLFLIFTIVYFSLWKGVKTSGKVVWVTATFPYVVLFILLIRGATLPGAWRGVLFYLKPNWKKLLTTEVWVDAAAQIFFSLGPGFGVLLALASYNKFNNNCYRDALVTSSVNCFTSFMSGFVIFTVLGYMAEMR-NVEVEDVAKDMGPSLLFITYPEAIANMMGSTFWAILFFMMMITLGLDSTFGGLEAIITAVMDEYPSLFSKRREYFVLGLVTICFMGALSTLTYGGAYIVKLLEEFGSGCSIIGIVLLEAIAVSWFYGVKRFCADIHSMLGFSP 419          
BLAST of slc6a-22 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008631.1 (pep scaffold:Pmarinus_7.0:GL483327:11244:21649:-1 gene:ENSPMAG00000007785.1 transcript:ENSPMAT00000008631.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 110.153 bits (274), Expect = 9.740e-26
Identity = 128/527 (24.29%), Postives = 232/527 (44.02%), Query Frame = 2
Query:  302 AAFFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWGCSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFN-SNLPW-------------------------SPEAMQTPDPNLSSQRFLEYQGFKTINATGTLKIGLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFLR--ISDLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYLNLKKFNFQILKDTTNLGVGFIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSILELFSKN---NYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLCTAL-LVTIMMLVLYKGTEISTDINFMLSNDPITLKIWKKIKWYFIVLWYGPVQIVLMIFLVYKIYIFGEHPFTFYVNSQVYNYTSSELAGGWFIG----SCVPLSVLITIGIYLMKFKGPLVKRLKGL 1774
             AF +PY +    +G+PLF LEV +GQLT +G I  W   PL   +GV  + +     + Y++ + W+L Y   +   + LPW                         S  A    D    +  F E    +   ++G   +G   WE++LC LA+W L+  +   GI +  KVVY T ++ YV + +L+V  + L G+LDG+ Y+L+   + L    +W +A+ Q+     +  G +    S+ +   N   +++I+T ++ +TS  +     ++ G++  ++         T  G+ F+  P+ IS +P    +A + +I+L+ +G D+    +      + +LF         +EA+  +  C +SF++S+ +   GG+Y+F LFD+++ S   +   +    I +  +Y       D+  ML   P     W    W  +        + L IF+ + ++      +   V +  Y Y     A GW +      C+P   L      L   KG L +R + L
Sbjct:    1 GAFLVPYGLTVVCVGIPLFFLEVALGQLTQQGTIGVWKIVPLFTGVGVASMVVVFLSDLYYIVVLAWSLYYLLHSLTTAQLPWTHCQGWWATAACSDTLGTSRAASNASEGASACQDTTSPAVEFWERNVLRV--SSGMHDLGSVNWEMLLCLLAVWLLVYFSVWKGIKFSGKVVYVTGSVPYVLLLVLLVQGVMLPGALDGITYYLQPDWAKLATPQVWVEASTQVFYCYGVGFGVLPALGSYNKFHNNCYRDSIILTIINSATSFFSGFVVFSFLGFMAQEQGVDISHVAETGPGLVFVVYPRAISLLPVPALWATLLFIMLLLLGVDSEFAGMEGFVTGLTDLFPSQLSGKRRREAFTGL-CCLVSFLLSVTMVTQGGIYVFQLFDSYAASGISMLWLMGWECIAVAWVYGANRFMQDLTAMLGFRP---HAWVWWCWSVV-----SPAVCLGIFVFHLVH------YERLVYNGRYEYPGWAEALGWLLALSSMLCIPAVALYK----LATAKGSLAQRWRHL 506          
BLAST of slc6a-22 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004857.1 (pep scaffold:Pmarinus_7.0:GL478393:33260:48162:-1 gene:ENSPMAG00000004412.1 transcript:ENSPMAT00000004857.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 104.76 bits (260), Expect = 1.690e-24
Identity = 102/357 (28.57%), Postives = 166/357 (46.50%), Query Frame = 2
Query:  740 KVVYFTITISYVAIFILIVHSISLEGSLDGLKYFLRI--SDLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYLNLKKFNFQILKDTTNLGVGFIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSILELFSK---NNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNS-WTKLCTALLVTIMMLVLYKGTEISTD-INFMLSNDPITLKIWKKIKWYFIVLWYGP---VQIVLMIFLVYKIYIFGEHPFTFYVNSQVYNYTSSELAGGWFIGSCVPLSVLITIGI----YLMKFKGPLVKRLK 1768
            +VVYFT T  Y+ + IL ++ ++L GS DG+ Y+L+   S LG   +W DA  QI    ++  G +    S+ +   N   +T I+  V+  TS  A     +  G++  ++         +  G+ FIA P+ +S +P A  +A +++ +L+ +G D+    V      I +LF       Y +E +V +  C  SF+++I +   GG+Y+F LFD +S S  T L  A    I++  +Y G +   D I  M+   P     W +  W F+     P     I L   L YK       P T Y    VY +    L  GW    C+ LS ++ I +     L + KG L++R +
Sbjct:    1 QVVYFTATFPYLVLIILFINGMTLPGSYDGIMYYLKPDWSKLGQPQVWIDAGTQIFFSYAIGLGALSALGSYNRFNNNCYRDTFILALVNSGTSFFAGFVVFSTLGFMAAEQGVDISQVAESGPGLAFIAYPKAVSLMPMAPLWAALFFFMLILLGLDSQFVGVEGFVTGISDLFPAALTGGYRREVFVGV-CCFTSFLIAISMVTEGGMYVFQLFDYYSASGMTLLWQAGWECIVVAWVYAGGDRFMDNIALMIGYRPFP---WMRWCWAFVT----PCVCTGIFLFNLLNYK-------PLT-YNKGYVYPWWGEAL--GW----CMALSSMLCIPVVAIYRLARTKGNLLERWR 335          
BLAST of slc6a-22 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001684.1 (pep scaffold:Pmarinus_7.0:GL482707:4904:15978:1 gene:ENSPMAG00000001516.1 transcript:ENSPMAT00000001684.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 99.3673 bits (246), Expect = 1.494e-23
Identity = 83/257 (32.30%), Postives = 119/257 (46.30%), Query Frame = 2
Query:  185 ENSNPQRISQRFDYXXXXXXXXXXXXXXXKTPYLVHKYTA-AFFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWGCSPLLKALGVGMV------ALTVNGLITYVMYVIWALRYFFLTFNSNLPWSP------------------------------EAMQTPDPNLSSQRFLEYQGFKTINATGTLKIGLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFL 844
            EN+     + + +Y+L MIG  VG+G + + PYL +K    AF IPY I    +GLPLF LE  +GQ  S G I  W   PLLK LG  MV      AL  N +I Y ++      Y F +F S LPWS                                + QTP     ++  L     ++++ TG +     VW + L  L  W + C A + GI    KVVYFT    YV + IL++   +L G++ G++Y++
Sbjct:    2 ENAERGNWASKSEYMLSMIGNAVGLGNLWRFPYLAYKNGGGAFLIPYIIMLAFVGLPLFFLECSIGQFASLGPITIWKVVPLLKGLGWMMVITSSLIALYYNSIIAYGLF------YLFASFTSELPWSSCKKWWGADENCFDRSVCNSSLAEGNCSSVNSSKQTPSEQYWNKYALRRS--ESMDETGDV-----VWHLALTLLLSWIVTCAALVKGIKSSGKVVYFTAIFPYVVLIILLIRGATLPGAILGIEYYI 245          
BLAST of slc6a-22 vs. Ensembl Nematostella
Match: EDO40151 (Transporter [Source:UniProtKB/TrEMBL;Acc:A7S7X6])

HSP 1 Score: 161.384 bits (407), Expect = 1.626e-42
Identity = 129/485 (26.60%), Postives = 240/485 (49.48%), Query Frame = 2
Query:  131 TAYMNSNCENLDTNEDHLENSNPQRISQRFDYXXXXXXXXXXXXXXXKTPYLVHKYTA-AFFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECW-GCSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPW--SPEAMQTPD----------PNLSSQRFLEYQGFKTINATGTLKIGLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFL--RISDLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYLNLKKFNFQILKDTTNLGVGFIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSILELFSKNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLCTALLVTIMMLVLYKGTEISTDINFMLSNDPITLKIWKKIKWYFI 1537
            TA  N   +N D  +D +   + +R  ++ +++   IG+ VG G   + PY+  K    AF IPY +F  + G+PLF +E+ +GQL   G I+ W    PL   +G   + ++    I Y + + W+L + + +F +++PW     +  TPD            +SS R    +    I  +     GL V  + LC L  W L+  +   GI    KVVY T T+ Y+ + I  +  ++L G++DG+ YF+  +   L +  +W DAA QI+  L++  G ++ F+S+   K N+  + L+I+ ++ +TS+ A     A  GY+   +        +   G+ FI  P  IS +P    +A +++++L+ +G D+  G V +V+ +++E + +  +     V + IC + F++ +   + GG+++F LFD+FS   + L       +++  +Y     + +I+ M+    +    W  I W +I
Sbjct:    2 TADSNKPLKN-DEKKDLVTVESRERWDRKIEFLFACIGFAVGYGNFWRFPYMCFKNGGGAFLIPYVLFLCLGGIPLFFMELSLGQLLQEGPIKAWQKICPLFSGIGFASIVISFIVSIYYNVILAWSLYFLYNSFFADIPWVGCHHSWNTPDCYVYNASANASGVSSSREFLVKNVLEITKSIEEPGGLSV-HLTLCLLVAWILVYFSIWRGIRTTGKVVYVTATLPYIILVIFFIKGVTLPGAIDGVLYFITPQWDRLQDPKVWIDAASQILYSLTIGFGVLIGFASYNPRKNNVFSDALLISVINCATSVFAGFVIFAIVGYMAHVQEKSVPEVASQGPGLVFIVYPAAISQLPFPQIWAVIFFLMLIALGLDSQFGQVEVVAAALIEQWPRQLHKHRELVVLVICFVMFLLGLSCVSKGGMFVFNLFDSFSCGLSLLFVVCFELLVIGWIYGARRYADNISQMIGRPVLQ---WWVICWKYI 481          
BLAST of slc6a-22 vs. Ensembl Nematostella
Match: EDO39707 (Transporter [Source:UniProtKB/TrEMBL;Acc:A7S977])

HSP 1 Score: 147.902 bits (372), Expect = 1.039e-37
Identity = 134/520 (25.77%), Postives = 237/520 (45.58%), Query Frame = 2
Query:   92 ETRQENNIHYEV-NTAYMNSNCENLDTNEDHLENSNPQRISQRFDYXXXXXXXXXXXXXXXKTPYLVHKYTAA-FFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECW-GCSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPWSP----------EAMQTPD-----------------PNLSSQRFLE---YQGFKTINATGTLKIGLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFLRI--SDLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYLNLKKFNFQILKDTTNLGVGFIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSILELF---SKNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLCTALLVTIMMLVLYKGTEISTDINFMLSNDPITLKIWKKIKWYFI 1537
            E  + N+    +  +   + +   +D  E+   +    + S + +++L  +GY VG G + + PYL +K   A F IPY I   + G+PLF LE+ +GQ  S G I  W    PLLK +G  +  ++    I Y++ + W   Y F++F + +PW             A ++ D                 P   S  F      +  + I+  G ++     W +    +  W ++      GI    KVVYFT T  ++ +FIL++   +LEGSLDG+ Y+L      L +  +W  AA QI   L +  G ++ F S+ +   N+  + L+I+  + STS  A     +  G++ L          T+  G+ F+A P+ IS +P +  +A +++ +L+T+G D+    +  V  +I++ +       + K  +V I +C    I+ +P    GG+++F L D      + L  ALL  I +  +Y     S D+ +M    P+    W +I W ++
Sbjct:    7 EIEESNDTKKPLFGSTSSSEDSPQIDVEEEQTRD----KWSSKAEFMLSSLGYCVGFGNVWRFPYLCYKNGGATFLIPYFIMLIVNGIPLFFLELAIGQWFSSGVIGVWKSICPLLKGIGYAICMISYLCCIYYIVILAWTFYYLFMSFQAVVPWKTCDNPWNTKFCRAKRSGDLLLNCTELDLPQNCTAKPTSPSGEFWSNNVLEMTEDISDFGDMR-----WPLFGTFILSWIVVYFCLFKGIKSSGKVVYFTATFPFIVLFILMIRGATLEGSLDGVIYYLNPDWERLADPQVWIYAATQIYWSLGVGFGALITFGSYNKFNNNVHKDALVISIANCSTSFFAGFVVFSVLGFMALTLDTTVAKVATSGPGLAFVAYPEAISQMPVSTLWAVLFFFMLITLGLDSQFATIEAVITAIVDEYPWVRGTKWRKPVFVLI-LCISLCILGLPCVFQGGMWIFNLMDYQVAGLSLLIVALLEIITIGWIYGVDRFSDDVEYMTGRRPMR---WFRICWKYV 513          
BLAST of slc6a-22 vs. Ensembl Nematostella
Match: EDO49707 (Transporter [Source:UniProtKB/TrEMBL;Acc:A7RFF4])

HSP 1 Score: 145.591 bits (366), Expect = 2.801e-37
Identity = 118/436 (27.06%), Postives = 202/436 (46.33%), Query Frame = 2
Query:  272 KTPYLVHKYTA-AFFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECW-GCSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPWSPEAMQTPD--PNL----SSQRFLEYQGFKTINATGTLKIGLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFLRISDLG---NMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYLNLK-----------------KFNFQILKDTTNLGVGFIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSILELFSKNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLCTALLVTIMMLVLYKGTEISTDINFMLSNDP 1495
            + PYL  K    AF +PY IF  I GLPLF LE+ +GQ   +  I CW    P L  +GV  + +++   + Y++ + W   +FF++F S+LPW        D  P+      S  +  +   +   +     +G+ V ++  C +  W L  L  + GI    KVVYFT T  Y+ + IL    ++LEG+ +G+K  L   D G   +  +W DAA Q+   LSL  G ++ F+S+  +   ++ +   +  V+  TS+ A I   +  GY   K                  +  + L+  +  G+ FI     +  +  +  +A +++++L+ +G D+  G +      I+EL       KE  VT+G+  I  ++ + + +  G Y+F +FD +S +   L  AL   I +  +Y     + DI FM    P
Sbjct:   28 RFPYLCQKNGGGAFLVPYIIFMLIEGLPLFFLELSIGQRMRKSAINCWRDIHPCLFGIGVACLMVSLMLCLYYIVIIAWCCYFFFISFTSDLPWKKGLKAKFDSFPDCCVRDPSAYYFYHHALEVSTSIEDTGVGINV-KLAGCLVFAWILTYLCVVKGIKSSGKVVYFTATFPYIILIILFFRGVTLEGAGNGIKT-LFTPDWGLLLDANIWKDAATQMFFTLSLGFGALIAFASYMPMHNQVMKDGYTVVLVNCGTSLFAGIVVFSILGYREAKTGIPVTEVWTIRRVSGFAYGGRGLRVGSGPGLAFITFSDAMLLMDVSPLWAILFFMMLILLGIDSEFGTLEAAIGPIMELNLFPKVRKE-LVTLGVAVILLLLGLCMTSGAGYYIFQMFDDYSVTIPLLVIALFQCIGVAWVYGNDRFADDIQFMTGKRP 460          
BLAST of slc6a-22 vs. Ensembl Nematostella
Match: EDO49218 (Transporter [Source:UniProtKB/TrEMBL;Acc:A7RHF4])

HSP 1 Score: 146.362 bits (368), Expect = 3.716e-37
Identity = 143/579 (24.70%), Postives = 265/579 (45.77%), Query Frame = 2
Query:  143 NSNCENLDTNED-----HLENSNPQRISQRFDYXXXXXXXXXXXXXXXKTPYLVHKYTA-AFFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWGC-SPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPWSP-----EAMQTPDPNLSSQRFLEYQG-FKTINATGTLKI-------GLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFLR--ISDLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILA--CIFSSAYFGYLNLKKFNFQILKDTTNLGVGFIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSILELFSKNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLCTALLVTIMMLVLYKGTEISTDINFMLSNDPITLKIWKKIKWYFIVLWYGPVQIVLMIFLVYKIYIFGEHPFTFYVNSQVYNYTSSELAGGWFIGSCVPLSVLITI---GIYLM-KFKGPLVKRLKGLLNQNEND 1795
            +++ E L ++E+      +     ++  ++ ++ L  +GY VG+G + + PYL  K    AF IPY     I G+PLF +E+ +GQ  S G +  W    P+ K +G  M+ ++    + Y + + W L Y F +F  ++PW               NL+     EY    K       L+I       G+  W++V+C +  W L+      GI    KVVYFT T  Y+ + IL++  ++L G++ GL ++L+   S LG+  +W DAA QI   L +  G ++   S+ +   N   + + ++ ++ STS+ A   IFS   F    L K   ++   T+  G+ F+  P+ I+ +P + F++  ++ +L+T+G DT       V+  + + + +   +++   T  +C   F++ +P+ +  G ++  L+   +   + +  A    I++   Y     + DI  M  N     K+W    W+ I   Y    ++  IF+   +   G       V+   Y Y         F+G  + LS ++ I    IY M + KG  ++R + L   ++  
Sbjct:   15 DADGEGLTSDENCKIDVEIIGEEREKWGRKVEFFLACVGYAVGLGNVWRFPYLCFKNGGGAFLIPYLCMLLICGMPLFFMELSLGQFVSLGPVTSWAAICPISKGVGFAMLVVSFLCCVYYNVIIAWCLYYLFESFAKDVPWKTCDNWWNTATNCTSNLTDTALKEYSSPSKEFYENYVLRITPDIDTFGVMRWQLVVCLILAWVLVYFCLWKGIKSSGKVVYFTATFPYLVLVILLIRGLTLPGAMKGLSFYLKPNFSKLGDAIVWVDAATQIFYSLGIGFGSLIAMGSYNKFHNNCFRDAMTVSVINCSTSVFAGLVIFSVLGFMAEVLGKEVSEV--ATSGPGLAFVVYPEGIAQMPISPFWSICFFFMLLTLGLDTQFAMFEAVTTGLGDEYVRLLRNRKELFTAFLCFCCFLLGLPIVSQSGAFIMNLYVWQAGGVSLVFLAFFEVIVVAWGYGADRFALDIETMTGN-----KVW---PWWPIAWKYITPAVITGIFIFSLVQWQG-------VSYDDYQYPPWAE----FVGWVMALSSMLWIPGVAIYKMSRAKGTFMERWRSLTRPDQEQ 572          
BLAST of slc6a-22 vs. Ensembl Nematostella
Match: EDO46589 (Transporter [Source:UniProtKB/TrEMBL;Acc:A7RPK8])

HSP 1 Score: 145.591 bits (366), Expect = 6.337e-37
Identity = 132/524 (25.19%), Postives = 234/524 (44.66%), Query Frame = 2
Query:  272 KTPYLVHKYTA-AFFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWG-CSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPWS--PEAMQT------PDPNLSSQ-RFLEYQGFKTINATGTLKIGLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFLR--ISDLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYLNLKKFNFQI---LKDTTNL------------------------GVGFIAIPQVISTIPN-ANFFAFVYYILLVTIGFDTALGFVRIVSLSILELFSKNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLCTALLVTIMMLVLYKGTEISTDINFMLSNDPITLKIWKKIKWYFIVLWYGPVQIVLMIFLVYKIYIFGEHPFTFYVNSQVYNYTSSELAGGWFIGSCVPLSVLITI 1720
            + PYL  K    AF IPY +   +LG+PLF +E+ +GQ   +G +  W    P L  +G+  V +     + Y M + W   Y F ++ S LP+S  P+ +        P+  L+ + ++  YQ    I  T     GL VW + L  L  W ++ L  + G+    K VYFT T  Y+ + I     ++LEG+  G+ +  +     L +  +W +AA QI   L +A GG++  SS+  V  N + + ++++ ++  TS+ A I   +  G+   + F   I    KD   L                        G+ FIA  + I  +P  +  +A +++ +L+T+G  +  G +  V   + +  +K    ++ +V+  IC +SF++ +  C + G Y   +FD+FS +   L   +L  I +  +Y       DI +M+S  P          WYF + W     +V+   +V  +      P T+   S   +        GW +G C+ + + ++I
Sbjct:   32 RFPYLCQKNGGGAFLIPYVLCLALLGIPLFFMELAIGQSVRQGSVGVWNYIHPYLGGVGISSVIVCFLVAVYYNMIIAWCFYYLFASWQSPLPYSYCPQVLTNSKYYDLPECGLAGRTQYYWYQNALKIAPTIDESGGL-VWPMCLSLLLAWIVVFLCMMKGVQSAGKAVYFTATFPYLVLIIFFGRGVTLEGAGPGVAHMFKPQFEKLADPRVWLEAATQIFYSLGVAFGGLIAMSSYNPVHNNCLRDAVMVSLINCGTSVFASIVIFSILGFKAHETFTECIELYTKDNVTLPGNQTVGEACKTLEYWLGQSAEGPGLTFIAFTEAIVKMPALSPLWATLFFCMLLTLGLGSMFGTLEGVITPVYD--AKLVSWRKEFVSGAICLVSFLLGLLFCQNSGEYWLQMFDSFSGTLPLLVIGMLEMIGVCWVYGSKRFEDDIEYMISKRP---------NWYFKITWRYEAPVVVAGIVVASLVGMISKPITYSAWSNSESKVIDTEYPGWGLG-CIAVIIAVSI 542          
BLAST of slc6a-22 vs. Ensembl Medaka
Match: slc6a7 (sodium-dependent proline transporter [Source:NCBI gene;Acc:101168229])

HSP 1 Score: 187.578 bits (475), Expect = 8.976e-51
Identity = 170/590 (28.81%), Postives = 284/590 (48.14%), Query Frame = 2
Query:   80 ANPKETRQENNIHYEVNTAYMNSNCENLDTNEDH--LENSNP-QRISQRFDYXXXXXXXXXXXXXXXKTPYLVHKYTAA-FFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWGCSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPWSPEAMQTP-------DPNLSSQR-------FLEYQGFKTINATGTLKIGLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFLRI--SDLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYLNLKKFNFQILKDTTNLGVGFIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSILELF---SKNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLCTALLVTIMMLVLYKGTEISTDINFMLSNDPITLKIW-KKIKWYFIVLWYGPVQIVLMIFLVYKIYIFGEHPFTFYVNSQVYNYTSSELAG---GWFIGSCVPLSVLITIGIYLMKFKGPLVKRLK 1768
            A  KE     N H   N A+  S+ +  D+      + N+ P ++   +++++L  IGY VG+G + + PYL ++     F IPY I  F+ G+PLFL+E+ +GQ  + G I  W C PLLK +G+GM+ ++    + Y + + W   Y   +F S LPWS +A+            N SS R       F        +N+ G    G   W + LC LA W ++ L  + GI    KVVY T T  Y  + +LI+   +LEGSL G+ ++L    + L +  +W+DAA QI   L +  GG++  +S+ +   N++ +T+IIT  +  TS  A     +  G++  +K         T  G+ F+A P+ ++ +P + F++ +++++L  +G DT  G +  ++ ++L+ F    +NN  K  ++   +C   +++ + L   GG+Y F L D+FS S+  +   L + I +   Y   +   DI  M+ + P     W  K+  YF   W      +LM  L    +IF E     Y  S  Y      L G   G  +G+   L +LI   + + K  G L  R +
Sbjct:   21 AAQKEHAITQNGH---NPAHTASHDQGFDSPGPGPIVANTTPREQWGGKYEFLLSCIGYCVGLGNVWRFPYLCYRNGGGVFLIPYFIMLFVAGVPLFLMELSLGQYGAAGPITVWKCCPLLKGIGIGMLCVSTLVCLYYNVIIAWTFYYLGSSFQSPLPWSCDAIANAAVCSNNTAGNSSSGRARTPTEIFWNENVLGLVNSEGLHDPGPVRWPLALCLLAAWIIIFLCMLKGIRSSGKVVYVTATFPYFVLIVLIIRGATLEGSLQGIAFYLTPDWARLASAQVWSDAASQIFYSLGIGVGGLLSMASYNKFDNNVIRDTIIITTGNCCTSFFAGFAIFSILGHMAWRKGVSVGEVADTGPGLAFVAYPEALALLPGSVFWSIMFFLMLFMLGVDTLFGNMEGITTAVLDEFPQLRQNNLHKSLFLGT-LCFGFYLMGLLLVTEGGIYWFTLIDSFSTSFGLIIITLFMCIGISFFYGVNQFCQDILDMIRHCP----PWCSKVLIYFKACWCFFTPFLLMFILA---FIFLE----MYSTSLKYGSYVFPLWGKALGVCMGATCCLQILIWAIVAICKETGTLKHRFQ 595          
BLAST of slc6a-22 vs. Ensembl Medaka
Match: slc6a14 (solute carrier family 6 member 14 [Source:NCBI gene;Acc:101166790])

HSP 1 Score: 185.267 bits (469), Expect = 3.344e-50
Identity = 171/602 (28.41%), Postives = 285/602 (47.34%), Query Frame = 2
Query:  167 TNED-HLE--NSNPQR--ISQRFDYXXXXXXXXXXXXXXXKTPYLVHKYTA-AFFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWGCSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPWSP---------EAMQTPDPNLSSQRFLE---YQGFKTI-----------------------NATGTLKIGLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFL----RISDLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYLNLKKFNFQILKDT---TNLGVGFIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSILELFSKNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLCTALLVTIMMLVLYKGTEISTDINFMLSNDPITLKIWKKIKWYFIVLWYGPVQIVLMIFLVYKIYIFGEHPFTFYVNSQVYNYTSSELAGGWFIGSCVPLSVLITIGIYLMKFKGPLVKRLKGLLNQNENDKPWYPVSPNDK 1828
            T +D H++  + NP+R   + + DYIL MIGY VG+G I + PYL +K    AF IPY     ++G+PLF LE  +GQ  S+G I  W   P+L+ +G+  V +T+   I Y + + ++L Y F +  S LPWS            +   D + ++  FLE   + G  T                         ++   + G  VW + LC L    L+  A I GI    KVVYFT T  YV I IL+V  ++LEG+ DG+++++     ++ L    +W DAA Q    LS+  GG++  SS+   + N+  +T  +T  +  TS+LA     A F  L      + I  +       G+ FIA P  +S +P +  ++ +++++L+T+G D+    + +++  +++ F +    K A VT+  C+I +++ +P     G+Y   L D F  +W  L   LL  I +  +Y G     DI  ML        +W +  W+ I         ++++ L + I  F   P T+    +V  Y    LA GW + + V + +       L K +G   +RLK L + +E   P+  +   ++
Sbjct:    3 TGQDAHVDPGDENPERGNWANKSDYILSMIGYAVGLGNIWRFPYLAYKNGGGAFLIPYFTMLVVVGIPLFFLESALGQFCSQGPINAWKAVPILQGVGIAAVVVTLVVSIYYNVIICYSLYYMFASMQSPLPWSDCFSWADSSCSNISAGDSSHTNILFLEKLMHSGNNTCASSNMSVLVQSPSEQYWDRVALQRSSSLDETGPVVWHLALCLLLSSLLVAAALIRGIKSSGKVVYFTATFPYVVILILLVRGLTLEGARDGIEFYIGSQSNLTKLTEAEVWKDAATQTFYSLSIGWGGLVTLSSYNNFQNNVFKDTFAVTLTNAGTSVLAGF---AIFSILGHMAHVYNIPVENVVKQGFGLAFIAYPDALSKLPISPLWSILFFVMLLTVGLDSQFAGIEVLTTCLVDAFPRYFKSKRAIVTVATCSILYLLGLPCVTRAGIYWVTLIDQFVATWVLLFLVLLEIIGVAFIYGGNRFIKDIEMMLGKKSFAFWLWWRACWFCI------SPCIILVILGWSIATF--SPPTY---GEV-QYPGWGLALGWAMVAFVVIWIPFVAVYNLTKARGSPWERLKSLCSPSEEWHPYLDIHRGER 589          
BLAST of slc6a-22 vs. Ensembl Medaka
Match: slc6a11b (solute carrier family 6 member 11 [Source:NCBI gene;Acc:101156159])

HSP 1 Score: 174.096 bits (440), Expect = 2.845e-46
Identity = 154/605 (25.45%), Postives = 284/605 (46.94%), Query Frame = 2
Query:  155 ENLDTNEDHLENSNPQRISQRFDYXXXXXXXXXXXXXXXKTPYLVHKYTA-AFFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECW-GCSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPWS----------------PEAMQTPDPNLSSQ--RFLEYQGFKTINATGTLKIGLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFL--RISDLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYLNLKKFNFQILK-DTTNLGVGFIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSILELFS---KNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLC---TALLVTIMMLVLYKGTEISTDINFMLSNDPITLKIWKKIKWYFIVLWYGPVQIVLMIFLV-YKIYIFGEHPFTFYVNSQVYNYTSSELAGGWFIGS----CVPLSVLITIGIYLMKFKGPLVKRLKGLLNQNENDK---PWYPVSPNDKNDLLAFKKVT 1858
            E   ++ D+ E +   + + + ++ L + G I+G+G + + PYL +K    AFF+PY IF+   G+P+F LE  +GQ T+ G I CW    PL + +G     +  +  + Y++ + WA+ Y F  F + LPW+                  A    +PN +S    F E +  K   + G   +G   WE+ +C    WF+       G     KVVY T T  Y  + IL++  ++L G+ DG+K++L   IS L +  +W DA  QI    ++  G +    S+     N   + +++  ++  TS +A     +  G++  ++ N  I     +  G+ FIA P+ ++ +P +  +A +++++L+ +G D+    V  +  ++++++    +  Y +E  + +G+  +SF + + +C  GG+Y+F LFD ++ S   +C    A+  +I +  +Y       +I  M+   PI       IKW +++L  G    + + FL+ YK       P  +   + VY Y       GWF+      C+P+ ++  I     K  G   +R+K L   + + K       +SP   ND  A  K++
Sbjct:   21 EGSSSSLDNREYNERGQWNNKIEFFLSVAGEIIGLGNVWRFPYLCYKNGGGAFFVPYVIFFVCCGIPVFFLETALGQFTTEGGITCWRKVCPLFEGIGYATQVIEAHLNVYYIVILAWAIFYLFNCFTTELPWAGCGHYWNTENCIDYYGENATNITNPNATSPVIEFWERRVLKI--SDGIEHMGGMRWELAMCLALAWFICYFCIWKGPKSTGKVVYVTATFPYFMLLILLIRGVTLPGAYDGIKFYLYPDISRLSDPQVWVDAGTQIFFSYAICLGCLTALGSYNSYNNNCYRDCIMLCCLNSGTSFVAGFAIFSVLGFMAYEQ-NVPIEAVAESGPGLAFIAYPKAVTMMPLSPLWACLFFMMLIFLGLDSQFVCVESLVTAVVDMYPETFRRGYRRELLI-LGMSVVSFFIGLIMCMEGGMYVFQLFDAYAAS--GMCLLFVAIFESICIGWVYGSDRFYLNIEDMIGYKPIFF-----IKWCWMILTPGICAAIFLFFLIKYK-------PLKY---NNVYTYPDWGYGIGWFMAMSSMVCIPVGMIWMI----WKTPGTFSERIKKLTTPSPDLKMRGKLAALSPYAANDAKADGKIS 600          
BLAST of slc6a-22 vs. Ensembl Medaka
Match: ENSORLT00000032790.1 (sodium- and chloride-dependent GABA transporter 2 [Source:NCBI gene;Acc:101175070])

HSP 1 Score: 171.785 bits (434), Expect = 2.054e-45
Identity = 146/552 (26.45%), Postives = 251/552 (45.47%), Query Frame = 2
Query:  272 KTPYLVHKYTA-AFFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWG-CSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPWS--------PEAMQTPDPNLSSQ---------RFLEYQGFKTIN-ATGTLKIGLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFL--RISDLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYLNLKKFNFQILKDTTNLGVGFIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSILELFS---KNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLCTALLVTIMMLV---LYKGTEISTDINFMLSNDPITLKIWKKIKWYFIVLWYGPVQIVLMIFLVYKIYIFGEHPFTFYVNSQVYNYTSSELAGGWFIGSCVPLSVLITIGIYLMKFKGPLVKRLKGLL------NQNENDKPWYPVSPND 1825
            + PYL  K    AF IPY +F    G+P+FLLE  +GQ TS+GCI CW    PL + +G     +     ++Y++   WA  Y F +F + +PW+           ++    N SS             E+   + +  + G  +IG   WE+ LC L  W L       G+    KVVYFT T  YV + +L+   +SL G++DGL ++L    S L +  +W DA  Q++    + +G +    S+ +   +   +T  +  V+  +S +A +   +  G+++ ++         +  G+ FIA P+ ++ +P    +A  ++I+++ +G DT    +  +  S+ ++F    +  Y +E  +   +C + F++ + L   GGLY   LFD +  S + L   LL T   L    +Y G  +  +I  M+   P  L    KI W F+      V +   IF V +       P  F   ++ Y Y S     GW +G    + V + I   + + +G L ++LK L       N   N    YP++P++
Sbjct:   54 RFPYLCFKNGGGAFLIPYILFLLACGIPMFLLETAMGQFTSQGCITCWRYFCPLFEGIGYATQVVIAYAAVSYIVIQAWAFFYLFSSFRAEVPWASCKNDWNTESCVEFDKANTSSNWSAAANATTPATEFWERRVLGISQGIEQIGSLRWELALCLLLAWILCYFCVWKGVRSTGKVVYFTATFPYVMLVVLLARGLSLPGAMDGLAFYLYPDPSRLVDPQVWMDAGAQVLFSFGICQGSLTALGSYNRFNNDCYKDTFGLCLVNGGSSFVAGLAIFSVLGFMSYEQGLPISQVAASGPGLAFIAYPRAVAMMPLPQLWAVCFFIMVILLGADTQFVSLECLMTSVTDMFPLVFRRTYRRELLLLF-LCTVCFLLDLLLVTEGGLYFLQLFDHYVCSGSNL--LLLSTCQSLAIGWIYGGDRLYDNIEDMIGYRPGPL---IKICWLFVT---PTVCLGTFIFSVVRY-----RPLKF---NKTYIYPSWAYILGWTLGLLCVIMVPLWIIFKMSQMEGTLKQKLKQLCVPEIPPNSKVNQPEEYPLNPDN 588          
BLAST of slc6a-22 vs. Ensembl Medaka
Match: slc6a2 (solute carrier family 6 member 2 [Source:NCBI gene;Acc:101172721])

HSP 1 Score: 168.318 bits (425), Expect = 4.004e-44
Identity = 138/520 (26.54%), Postives = 253/520 (48.65%), Query Frame = 2
Query:   77 NANPKET-----RQENNIHYEVNTAY-MNSNCENLDTNEDHLENSNPQRISQRFDYXXXXXXXXXXXXXXXKTPYLVHKYTA-AFFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWGCSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPW-----SPEAMQTPDPNLSSQRFLE----YQGFKTINAT--------------GTLKIGLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFLR--ISDLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYLNLKKFNFQILKDTTN-LGVGFIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSILELFSKNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLCTALLVTIMMLVLYKGTEISTDINFMLSNDPITLKIWKKIKWYFI 1537
            N   KE      + +N + Y  +T     + C         +E    +   ++ D++L +IG+ V +  + + PYL +K    AF IPY +F  I G+PLF +E+ +GQ    G    W   P+ K +G  ++ + +     Y + + W+L Y + +  + LPW     S  ++   DP   +  F +    Y   K   A+              G   +GLP  E+ LC + + F+L  +   G+    KVVY T T+ YV +F+L++  I+L G+L+G+K +L   +S+L N+ +W DAA QI   L    G ++ FSS+ +   N   + ++ + V+  TS ++     +  GY+  +K+N  I    T+  G+ FI  P+ IST+P + F+A V++I+L+T+G D+++G +  V   + + F     +++ + T      +F++++    +GG+Y+  L D ++   + L   L+  I +   Y     S DI  M+   P    ++ ++ W F+
Sbjct:   21 NVEKKEVELILVKDQNGVQYTNSTIIPTAARCAGPHGTSTDIER---ETWGKKIDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLIPYILFLVIAGMPLFYMELALGQYNREGAATVWKICPVFKGVGYAVIVIALYVGFYYNVIIAWSLYYLYSSMTAELPWLKCGHSWNSINCTDPQHINASFFDKNTSYANNKFTPASEYYERGVLHLHESKGIEDLGLPRLELTLCLVVVVFILYFSLWKGVKSSGKVVYITATMPYVVLFVLLIRGITLPGALNGIKAYLNFSLSELNNLQVWIDAATQIFYSLGAGFGVLIAFSSYNKFDNNCYRDAILTSAVNCITSFVSGFAIFSVLGYMA-QKYNMDIKAVATDGPGLVFIIYPEAISTLPGSTFWAIVFFIMLLTLGIDSSMGGMEAVITGLSDDFKFLKRNRKLF-TFATAFGTFLMALICVTNGGIYVLTLLDKYAAGTSILFAVLIEAIGVSWFYGVDRFSEDIEQMMGFKP---GLYWRLCWKFV 532          
BLAST of slc6a-22 vs. Planmine SMEST
Match: SMESG000005685.1 (SMESG000005685.1)

HSP 1 Score: 1026.54 bits (2653), Expect = 0.000e+0
Identity = 522/529 (98.68%), Postives = 523/529 (98.87%), Query Frame = 2
Query:  272 KTPYLVHKYTAAFFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWGCSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPWSPEAMQTPDPNLSSQRFLEYQGFKTINATGTLKIGLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFLRISDLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYLNLKKFNFQILKDTTNLGVGFIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSILELFSKNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLCTALLVTIMMLVLYKGTEISTDINFMLSNDPITLKIWKKIKWYFIVLWYGPVQIVLMIFLVYKIYIFGEHPFTFYVNSQVYNYTSSELAGGWFIGSCVPLSVLITIGIYLMKFKGPLVKRLKGLLNQNENDKPWYPVSPNDKNDLLAFKKVT 1858
            KTPYLVHKYTAAFFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWGCSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPWSPEAMQTPDPNLSSQRFLEYQGFKTINATGTLKIGLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFLRISDLGNMAMWTDAAIQIILILSLAEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYLNLKKFNFQ+LKDTTNLGVGFIAIPQVISTIPNANFFAFVYYILLVTIG DTALGFVRIVSLSILELFSKNNYDKEAYVTIGICAISFI SIPLC SGGLYLFPLFDTFSNSW KLCTALLVTIMMLVLYKGTEISTDINFMLSNDPITLKIWKKIKWYFIVLWYGPVQIVLMIFLVYKIYIFGEHPFTFYVNSQVYNYTSSELAGGWFIGSCVPLSVLITIGIYLMKFKGP VKRLK LLNQNENDKPWYPVSPNDKNDLLAFKKVT
Sbjct:   13 KTPYLVHKYTAAFFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWGCSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPWSPEAMQTPDPNLSSQRFLEYQGFKTINATGTLKIGLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFLRISDLGNMAMWTDAAIQIILILSLAEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYLNLKKFNFQVLKDTTNLGVGFIAIPQVISTIPNANFFAFVYYILLVTIGLDTALGFVRIVSLSILELFSKNNYDKEAYVTIGICAISFIASIPLCTSGGLYLFPLFDTFSNSWAKLCTALLVTIMMLVLYKGTEISTDINFMLSNDPITLKIWKKIKWYFIVLWYGPVQIVLMIFLVYKIYIFGEHPFTFYVNSQVYNYTSSELAGGWFIGSCVPLSVLITIGIYLMKFKGPFVKRLKWLLNQNENDKPWYPVSPNDKNDLLAFKKVT 541          
BLAST of slc6a-22 vs. Planmine SMEST
Match: SMESG000005685.1 (SMESG000005685.1)

HSP 1 Score: 798.505 bits (2061), Expect = 0.000e+0
Identity = 414/437 (94.74%), Postives = 419/437 (95.88%), Query Frame = 2
Query:  548 SPEAMQTPDPNLSSQRFLEYQGFKTINATGTLKIGLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFLRISDLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYLNLKKFNFQILKDTTNLGVGFIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSILELFSKNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLCTALLVTIMMLVLYKGTEISTDINFMLSNDPITLKIWKKIKWYFIVLWYGPVQIVLMIFLVYKIYIFGEHPFTFYVNSQVYNYTSSELAGGWFIGSCVPLSVLITIGIYLMKFKGPLVKRLKGLLNQNENDKPWYPVSPNDKNDLLAFKKVT 1858
             PE       +  + R+ +YQGFKTINATGTLKIGLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFLRISDLGNMAMWTDAAIQIILILSLAEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYLNLKKFNFQ+LKDTTNLGVGFIAIPQVISTIPNANFFAFVYYILLVTIG DTALGFVRIVSLSILELFSKNNYDKEAYVTIGICAISFI SIPLC SGGLYLFPLFDTFSNSW KLCTALLVTIMMLVLYKGTEISTDINFMLSNDPITLKIWKKIKWYFIVLWYGPVQIVLMIFLVYKIYIFGEHPFTFYVNSQVYNYTSSELAGGWFIGSCVPLSVLITIGIYLMKFKGP VKRLK LLNQNENDKPWYPVSPNDKNDLLAFKKVT
Sbjct:   41 EPEYPCGDGCHCCAARYRKYQGFKTINATGTLKIGLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFLRISDLGNMAMWTDAAIQIILILSLAEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYLNLKKFNFQVLKDTTNLGVGFIAIPQVISTIPNANFFAFVYYILLVTIGLDTALGFVRIVSLSILELFSKNNYDKEAYVTIGICAISFIASIPLCTSGGLYLFPLFDTFSNSWAKLCTALLVTIMMLVLYKGTEISTDINFMLSNDPITLKIWKKIKWYFIVLWYGPVQIVLMIFLVYKIYIFGEHPFTFYVNSQVYNYTSSELAGGWFIGSCVPLSVLITIGIYLMKFKGPFVKRLKWLLNQNENDKPWYPVSPNDKNDLLAFKKVT 477          
BLAST of slc6a-22 vs. Planmine SMEST
Match: SMESG000005685.1 (SMESG000005685.1)

HSP 1 Score: 443.736 bits (1140), Expect = 4.918e-153
Identity = 227/228 (99.56%), Postives = 227/228 (99.56%), Query Frame = 2
Query:  272 KTPYLVHKYTAAFFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWGCSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPWSPEAMQTPDPNLSSQRFLEYQGFKTINATGTLKIGLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFLRISDLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQ 955
            KTPYLVHKYTAAFFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWGCSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPWSPEAMQTPDPNLSSQRFLEYQGFKTINATGTLKIGLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFLRISDLGNMAMWTDAAIQIILILSLAEGGIMCFSSFC 
Sbjct:   13 KTPYLVHKYTAAFFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWGCSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPWSPEAMQTPDPNLSSQRFLEYQGFKTINATGTLKIGLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFLRISDLGNMAMWTDAAIQIILILSLAEGGIMCFSSFCH 240          
BLAST of slc6a-22 vs. Planmine SMEST
Match: SMESG000042051.1 (SMESG000042051.1)

HSP 1 Score: 172.17 bits (435), Expect = 8.313e-46
Identity = 135/498 (27.11%), Postives = 237/498 (47.59%), Query Frame = 2
Query:  158 NLDTNEDHLENSNPQRISQRFDYXXXXXXXXXXXXXXXKTPYLVHKYTA-AFFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWGCSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPWSPEAMQTPDP-------------------------NLSSQRFLEYQGFKTINATGTLK-----IGLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFL--RISDLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYLNLKKFNFQILKDTTNLGVGFIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIVSLSILELFS--KNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLCTALLVTIMMLVLYKGTEISTDINFMLSNDPITLKIWKKIKWYFIVLW 1546
            N +   +  EN+     S + D+ L  +GY VG+G + + P+L +K    AF IPY     I G+PLF  E+ +GQ +S G +  W   P+ K +G  M+ +++   I Y + + W+L Y F +F S LPWS    +  D                           ++++++ +      +N  G  +     +G   W + LC L  W +   + I G+    KVVYFT    Y  I I++++   LEGSL+G+KY+L  + S L    +W DAA QI   L +A GG+M  +S+ +   N   + L+++ ++ +TS +A     A  GY+++K         T+  G+ F+A  Q ++T+P +  ++ +++ +L+T+G D+  G +  +     + F   K  +  +    I    I F + +P  + GG+Y+F L D +  S++ +  A L   ++  +Y     S DI  ML   P          +Y+I+ W
Sbjct:   12 NKEVRFEGDENTYRGNWSSKMDFFLSCVGYAVGLGNLWRFPHLCYKNGGGAFLIPYFTMLIIAGIPLFYFELSLGQFSSSGFLTVWKIQPMFKGIGFAMLVISIICSIYYNVIIAWSLYYLFASFTSKLPWSDCNNEWNDELCLNDFKNVTNVVCSSFRTTNCTKYEVAAEQYWQRVVLGVVNYAGDQRPMEPYLGTVQWHLSLCLLLAWIICGASLIKGVKSSGKVVYFTAIFPYFVIVIMVINGCLLEGSLEGIKYYLIPKWSKLLEARVWGDAATQIFYSLGVAFGGLMTMASYNKFNNNCYRDALMVSIINCATSFVAGFAIFAVLGYMSVKTGRSVAETTTSGTGLAFVAYAQGVATMPYSPIWSILFFGMLLTLGIDSQFGGMEAIFTGFQDQFPILKKTHFHDFSFKIIFQIILFFLGLPCVSKGGIYMFTLMDEYCGSFSLIIIAFLELTIISFIYGVKNFSQDIEMMLKFKP---------GYYWIICW 500          
BLAST of slc6a-22 vs. Planmine SMEST
Match: SMESG000003011.1 (SMESG000003011.1)

HSP 1 Score: 166.777 bits (421), Expect = 2.286e-43
Identity = 134/466 (28.76%), Postives = 218/466 (46.78%), Query Frame = 2
Query:  272 KTPYLVHKYTA-AFFIPYTIFYFILGLPLFLLEVYVGQLTSRGCIECWGCSPLLKALGVGMVALTVNGLITYVMYVIWALRYFFLTFNSNLPWSPEAMQTPD-----------------PNLSSQRFLEYQGFKTINATGTLKIGLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIFILIVHSISLEGSLDGLKYFL--RISDLGNMAMWTDXXXXXXXXXXXXEGGIMCFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYL-NLKKFNFQILKDTTNLGVGFIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIV------SLSILELFSKNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFSNSWTKLCTALLVTIMMLVLYKGTEISTDINFMLSNDPITLKIWKKIKWYFIVLWYGPVQIVLMIFLVY 1588
            + PYLV+K    AF IPY +    +GLP+F LE  +GQ +S G I CW  SPL K +G GMV +T    + Y + V   + Y F +F S LPWS       D                  N  S     Y+ +    + G    GLP W+++LC L  W ++    + G+    K+ YFT    YV + IL++ S  L G+  G+KY+L  +   L +  +WTDAA QI   LS   GG++  +S+ + K N   + +I+  ++ +TS+ A     A  G++ N+K      +      G+ FI  P+ +S +P A  ++ +++ +++T+GF +    V  V       L    + S   + K   V   +C + F + IP+  +GG+YL  L D   + +  L   L+  +++   Y   +   DI+ M    P          WY+ + W     IV++  LV+
Sbjct:   91 RFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCWIISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWNDNTTCFDGSNNTIHLLAIENKISATEQYYEKYVLEVSKGIEDFGLPSWKLLLCLLLSWIIVTAVLLKGVSSLGKISYFTALFPYVLLTILLIRSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAK-GGPGLAFIVYPEALSNMPMAPLWSILFFFMMLTLGFGSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVM--VCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRP---------NWYWRITWLIITPIVMVFLLVF 544          
The following BLAST results are available for this feature:
BLAST of slc6a-22 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC6A55.887e-4927.66solute carrier family 6 member 5 [Source:HGNC Symb... [more]
SLC6A22.767e-4526.30solute carrier family 6 member 2 [Source:HGNC Symb... [more]
SLC6A26.611e-4526.01solute carrier family 6 member 2 [Source:HGNC Symb... [more]
SLC6A26.611e-4526.01solute carrier family 6 member 2 [Source:HGNC Symb... [more]
SLC6A22.923e-4426.44solute carrier family 6 member 2 [Source:HGNC Symb... [more]
back to top
BLAST of slc6a-22 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dat-13.703e-3626.67Sodium-dependent dopamine transporter [Source:Uni... [more]
snf-35.594e-3424.25Sodium- and chloride-dependent betaine transporter... [more]
snf-111.263e-2924.42Transporter [Source:UniProtKB/TrEMBL;Acc:G5EF43][more]
mod-51.269e-2723.09Transporter [Source:UniProtKB/TrEMBL;Acc:Q9N3C7][more]
snf-68.626e-2724.24Sodium-dependent acetylcholine transporter [Sourc... [more]
back to top
BLAST of slc6a-22 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ine1.178e-4426.95gene:FBgn0011603 transcript:FBtr0077447[more]
DAT9.756e-4425.79gene:FBgn0034136 transcript:FBtr0087125[more]
DAT1.590e-4325.79gene:FBgn0034136 transcript:FBtr0330002[more]
ine3.889e-4327.05gene:FBgn0011603 transcript:FBtr0077448[more]
ine3.889e-4327.05gene:FBgn0011603 transcript:FBtr0301408[more]
back to top
BLAST of slc6a-22 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc6a141.902e-6027.99solute carrier family 6 member 14 [Source:ZFIN;Acc... [more]
slc6a72.194e-5429.84solute carrier family 6 member 7 [Source:ZFIN;Acc:... [more]
slc6a22.490e-4826.63solute carrier family 6 member 2 [Source:ZFIN;Acc:... [more]
slc6a22.490e-4826.63solute carrier family 6 member 2 [Source:ZFIN;Acc:... [more]
slc6a82.449e-4727.57solute carrier family 6 member 8 [Source:ZFIN;Acc:... [more]
back to top
BLAST of slc6a-22 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rmnd5a2.040e-5530.30required for meiotic nuclear division 5 homolog A ... [more]
rmnd5a3.893e-5530.30required for meiotic nuclear division 5 homolog A ... [more]
rmnd5a1.317e-5430.29required for meiotic nuclear division 5 homolog A ... [more]
rmnd5a1.388e-5229.52required for meiotic nuclear division 5 homolog A ... [more]
rmnd5a9.064e-5229.57required for meiotic nuclear division 5 homolog A ... [more]
back to top
BLAST of slc6a-22 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc6a51.147e-4727.33solute carrier family 6 (neurotransmitter transpor... [more]
Slc6a51.147e-4727.33solute carrier family 6 (neurotransmitter transpor... [more]
Slc6a51.147e-4727.33solute carrier family 6 (neurotransmitter transpor... [more]
Slc6a33.045e-4626.45solute carrier family 6 (neurotransmitter transpor... [more]
Slc6a22.851e-4424.13solute carrier family 6 (neurotransmitter transpor... [more]
back to top
BLAST of slc6a-22 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9Y345|SC6A5_HUMAN2.827e-4827.66Sodium- and chloride-dependent glycine transporter... [more]
sp|P58295|SC6A5_RAT6.031e-4727.29Sodium- and chloride-dependent glycine transporter... [more]
sp|Q761V0|SC6A5_MOUSE1.036e-4627.33Sodium- and chloride-dependent glycine transporter... [more]
sp|P23977|SC6A3_RAT1.501e-4526.45Sodium-dependent dopamine transporter OS=Rattus no... [more]
sp|Q61327|SC6A3_MOUSE2.130e-4526.45Sodium-dependent dopamine transporter OS=Mus muscu... [more]
back to top
BLAST of slc6a-22 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YF590.000e+0100.00Slc6a-22 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A4W6DP931.713e-6030.35Transporter OS=Lates calcarifer OX=8187 PE=3 SV=1[more]
A0A4W6DMP25.937e-5929.40Transporter OS=Lates calcarifer OX=8187 PE=3 SV=1[more]
F6NN044.255e-5727.99Transporter OS=Danio rerio OX=7955 GN=slc6a14 PE=3... [more]
Q1ECY94.413e-5727.99Transporter (Fragment) OS=Danio rerio OX=7955 GN=s... [more]
back to top
BLAST of slc6a-22 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc6a143.728e-5226.12solute carrier family 6 member 14 [Source:NCBI gen... [more]
slc6a72.129e-4728.07sodium-dependent proline transporter-like [Source:... [more]
slc6a32.421e-4624.78solute carrier family 6 member 3 [Source:NCBI gene... [more]
slc6a6b4.717e-4525.58solute carrier family 6 member 6 [Source:NCBI gene... [more]
slc6a6b5.559e-4525.87solute carrier family 6 member 6 [Source:NCBI gene... [more]
back to top
BLAST of slc6a-22 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc6a1a2.420e-3428.14solute carrier family 6 member 1a [Source:ZFIN;Acc... [more]
slc6a4b3.570e-3223.76solute carrier family 6 member 4b [Source:ZFIN;Acc... [more]
ENSPMAT00000008631.19.740e-2624.29pep scaffold:Pmarinus_7.0:GL483327:11244:21649:-1 ... [more]
ENSPMAT00000004857.11.690e-2428.57pep scaffold:Pmarinus_7.0:GL478393:33260:48162:-1 ... [more]
ENSPMAT00000001684.11.494e-2332.30pep scaffold:Pmarinus_7.0:GL482707:4904:15978:1 ge... [more]
back to top
BLAST of slc6a-22 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc6a-22 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO401511.626e-4226.60Transporter [Source:UniProtKB/TrEMBL;Acc:A7S7X6][more]
EDO397071.039e-3725.77Transporter [Source:UniProtKB/TrEMBL;Acc:A7S977][more]
EDO497072.801e-3727.06Transporter [Source:UniProtKB/TrEMBL;Acc:A7RFF4][more]
EDO492183.716e-3724.70Transporter [Source:UniProtKB/TrEMBL;Acc:A7RHF4][more]
EDO465896.337e-3725.19Transporter [Source:UniProtKB/TrEMBL;Acc:A7RPK8][more]
back to top
BLAST of slc6a-22 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc6a78.976e-5128.81sodium-dependent proline transporter [Source:NCBI ... [more]
slc6a143.344e-5028.41solute carrier family 6 member 14 [Source:NCBI gen... [more]
slc6a11b2.845e-4625.45solute carrier family 6 member 11 [Source:NCBI gen... [more]
ENSORLT00000032790.12.054e-4526.45sodium- and chloride-dependent GABA transporter 2 ... [more]
slc6a24.004e-4426.54solute carrier family 6 member 2 [Source:NCBI gene... [more]
back to top
BLAST of slc6a-22 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000005685.10.000e+098.68SMESG000005685.1[more]
SMESG000005685.10.000e+094.74SMESG000005685.1[more]
SMESG000005685.14.918e-15399.56SMESG000005685.1[more]
SMESG000042051.18.313e-4627.11SMESG000042051.1[more]
SMESG000003011.12.286e-4328.76SMESG000003011.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30032156
GenBankAKN21442.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032156 ID=SMED30032156|Name=slc6a-22|organism=Schmidtea mediterranea sexual|type=transcript|length=1960bp
TTTTATTGAATTCATTATTTTTCAATTAAATTAAATGAATGAACTCGATT
GCGATATTGTGATAAATCCGTGTTTTAATGCAAATCCTAAAGAAACTCGG
CAAGAAAATAACATACATTATGAAGTCAACACTGCTTACATGAACTCAAA
TTGTGAAAATCTGGATACAAATGAAGATCATCTTGAAAACTCAAATCCTC
AGCGTATTTCACAAAGATTTGACTATATTTTAATCATGATTGGTTACATA
GTTGGAATAGGTGGAATAATCAAAACGCCATATTTAGTACACAAATATAC
TGCTGCGTTTTTTATTCCATATACAATATTTTATTTTATTTTGGGGCTAC
CATTGTTTTTATTAGAGGTTTATGTTGGGCAACTTACGAGTAGAGGATGC
ATCGAATGTTGGGGATGCAGCCCGCTATTAAAAGCTCTGGGTGTTGGTAT
GGTAGCTTTGACTGTTAATGGATTGATTACTTATGTCATGTACGTTATAT
GGGCCTTAAGATATTTCTTTTTGACATTCAACTCAAACTTGCCTTGGTCC
CCCGAAGCAATGCAAACACCAGATCCGAATTTAAGCAGTCAAAGGTTTTT
GGAATATCAGGGCTTTAAAACTATAAATGCTACGGGAACGTTGAAGATTG
GTCTTCCGGTCTGGGAGATTGTTTTATGTTCTTTAGCCATCTGGTTTCTT
CTATGTTTAGCTGCAATCTACGGAATTCATTATCGTGTCAAAGTGGTTTA
TTTTACAATAACAATTTCTTATGTGGCAATTTTCATATTAATTGTTCACT
CAATTTCTCTCGAAGGATCTCTAGACGGACTGAAATACTTTTTACGGATA
TCCGATTTGGGTAACATGGCAATGTGGACAGACGCCGCCATTCAAATCAT
CCTAATATTAAGCCTTGCCGAAGGTGGCATCATGTGTTTCTCAAGTTTTT
GTCAAGTTAAAGAAAATTTAGTTGTTAACACGTTGATTATAACATTCGTT
GACTTCTCGACTTCAATATTGGCTTGCATTTTTTCCAGTGCCTATTTTGG
TTACCTGAATCTAAAAAAGTTTAATTTTCAAATTTTAAAAGATACTACAA
ATTTAGGAGTGGGATTTATTGCTATTCCTCAAGTAATATCTACGATTCCG
AATGCAAATTTCTTTGCTTTTGTTTATTATATATTGTTGGTCACGATTGG
TTTCGACACGGCTCTTGGATTTGTAAGGATTGTGAGCCTATCAATATTGG
AATTGTTTAGTAAAAATAATTACGATAAAGAAGCATATGTAACAATTGGA
ATATGCGCAATTAGTTTTATAGTCAGCATTCCTTTATGTGCAAGTGGTGG
ATTATATTTGTTTCCACTATTTGATACATTTTCTAATTCATGGACAAAAT
TATGCACTGCATTATTGGTAACAATTATGATGCTCGTGTTGTATAAAGGA
ACCGAAATTTCGACAGATATAAATTTTATGCTTTCCAATGATCCTATTAC
CTTGAAAATATGGAAGAAAATAAAATGGTATTTCATTGTCTTATGGTATG
GACCTGTGCAGATTGTGCTCATGATATTTCTTGTGTATAAAATCTATATT
TTCGGAGAACATCCTTTTACATTTTACGTGAACAGTCAAGTGTACAATTA
TACAAGTTCAGAATTAGCCGGAGGTTGGTTTATAGGCTCATGTGTTCCAC
TTTCAGTTTTAATAACTATTGGAATTTATTTGATGAAATTTAAAGGACCA
TTAGTTAAAAGATTAAAGGGGCTTCTCAATCAAAACGAGAATGACAAGCC
GTGGTATCCAGTGTCACCAAATGATAAAAATGATCTTCTAGCTTTTAAAA
AAGTCACATAAATTAATATATAATCAATTCAGGAGACTAGAATTTTTACA
TTTGGAGAATTAAATTCCATATTATAAGAATAAAGAATTAACTATTATTT
TTAGTGTATA
back to top

protein sequence of SMED30032156-orf-1

>SMED30032156-orf-1 ID=SMED30032156-orf-1|Name=SMED30032156-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=609bp
MNELDCDIVINPCFNANPKETRQENNIHYEVNTAYMNSNCENLDTNEDHL
ENSNPQRISQRFDYILIMIGYIVGIGGIIKTPYLVHKYTAAFFIPYTIFY
FILGLPLFLLEVYVGQLTSRGCIECWGCSPLLKALGVGMVALTVNGLITY
VMYVIWALRYFFLTFNSNLPWSPEAMQTPDPNLSSQRFLEYQGFKTINAT
GTLKIGLPVWEIVLCSLAIWFLLCLAAIYGIHYRVKVVYFTITISYVAIF
ILIVHSISLEGSLDGLKYFLRISDLGNMAMWTDAAIQIILILSLAEGGIM
CFSSFCQVKENLVVNTLIITFVDFSTSILACIFSSAYFGYLNLKKFNFQI
LKDTTNLGVGFIAIPQVISTIPNANFFAFVYYILLVTIGFDTALGFVRIV
SLSILELFSKNNYDKEAYVTIGICAISFIVSIPLCASGGLYLFPLFDTFS
NSWTKLCTALLVTIMMLVLYKGTEISTDINFMLSNDPITLKIWKKIKWYF
IVLWYGPVQIVLMIFLVYKIYIFGEHPFTFYVNSQVYNYTSSELAGGWFI
GSCVPLSVLITIGIYLMKFKGPLVKRLKGLLNQNENDKPWYPVSPNDKND
LLAFKKVT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0015293symporter activity
GO:0005328neurotransmitter:sodium symporter activity
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
GO:0006836neurotransmitter transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
Vocabulary: INTERPRO
TermDefinition
IPR037272SNS_sf
IPR000175Na/ntran_symport
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000175Sodium:neurotransmitter symporterPRINTSPR00176NANEUSMPORTcoord: 237..254
score: 44.08
coord: 371..390
score: 26.72
coord: 63..84
score: 38.97
coord: 134..160
score: 21.74
coord: 317..337
score: 21.23
IPR000175Sodium:neurotransmitter symporterPFAMPF00209SNFcoord: 58..527
e-value: 5.0E-72
score: 243.3
IPR000175Sodium:neurotransmitter symporterPANTHERPTHR11616SODIUM/CHLORIDE DEPENDENT TRANSPORTERcoord: 44..572
IPR000175Sodium:neurotransmitter symporterPROSITEPS50267NA_NEUROTRAN_SYMP_3coord: 54..571
score: 50.304
IPR037272Sodium:neurotransmitter symporter superfamilySUPERFAMILYSSF161070SNF-likecoord: 59..562
NoneNo IPR availableTMHMMTMhelixcoord: 544..566
NoneNo IPR availableTMHMMTMhelixcoord: 134..156
NoneNo IPR availableTMHMMTMhelixcoord: 64..86
NoneNo IPR availableTMHMMTMhelixcoord: 378..400
NoneNo IPR availableTMHMMTMhelixcoord: 318..340
NoneNo IPR availableTMHMMTMhelixcoord: 91..113
NoneNo IPR availableTMHMMTMhelixcoord: 421..443
NoneNo IPR availableTMHMMTMhelixcoord: 208..230
NoneNo IPR availableTMHMMTMhelixcoord: 502..524
NoneNo IPR availableTMHMMTMhelixcoord: 448..470
NoneNo IPR availableTMHMMTMhelixcoord: 237..259
NoneNo IPR availableTMHMMTMhelixcoord: 284..306