slc16a-28

Overview
Nameslc16a-28 (AKN21523.1)
Smed IDSMED30032143
Length (bp)1435
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc16a-28 (SMED30032143) t-SNE clustered cells

Violin plots show distribution of expression levels for slc16a-28 (SMED30032143) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc16a-28 (SMED30032143) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc16a-28 (SMED30032143) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032143

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30032143SMESG000081091.1 Contig3403GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
neuronSMED30032143SMESG000056616.1 dd_Smed_v4_12311_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30032143SMESG000056616.1 dd_Smed_v4_12311_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc16a-28 vs. Ensembl Human
Match: SLC16A12 (solute carrier family 16 member 12 [Source:HGNC Symbol;Acc:HGNC:23094])

HSP 1 Score: 75.8702 bits (185), Expect = 4.948e-14
Identity = 79/335 (23.58%), Postives = 143/335 (42.69%), Query Frame = 2
Query:   89 DSSKAWSVTIGCMIVNALMVGFIKIYSLIIIEYQDLLNAPMSLLMFGTSMLTSLTGLAAPLSAYLSERFTTMKTGIFASFLAVASIIMMAFSYNI-YVQVTSAAFLGKFSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGSSIGALIMPLGLSELINTYSIRGVMLIMAGVLFNFAVAAVLIPTHIIKINHGYKPVLIAIQDREKRSEGDIIKIGKWNVPIGNFAKKSKLKWPPRKLWRSVLL-------YSFGMTNSMNGFMLLCS-----LYGA---------FSRSLSITIQHSAYILIIQSSIDCATRIISGYLVDFKMISRWVLYC 1027
            D    W +  GC +V        +  S+  +E+Q       +   +  S++  +T L APL + +S   +     +    LA   +I+ +F+ ++ ++ +T    LG  + GL F++ Y P I++ GK   + + L+ GI  +GS IG  I+   +  LI  +S RG +LI+ G + N  V   L+    +K +H         Q+   R++ + IK           +  S L     K W    L       YSF +   M+ F++L        YG          ++ S+ ++ Q +A+++ I   ID    I  G+L D + +  +   C
Sbjct:   44 DGGWGWMIVAGCFLVTICTRAVTRCISIFFVEFQTYFTQDYAQTAWIHSIVDCVTMLCAPLGSVVSNHLSCQVGIMLGGLLASTGLILSSFATSLKHLYLT----LGVLT-GLGFALCYSPAIAMVGKYFSRRKALAYGIAMSGSGIGTFILAPVVQLLIEQFSWRGALLILGGFVLNLCVCGALMRPITLKEDHTTPE-----QNHVCRTQKEDIK---------RVSPYSSLT----KEWAQTCLCCCLQQEYSFLL---MSDFVVLAVSVLFMAYGCSPLFVYLVPYALSVGVSHQQAAFLMSILGVIDIIGNITFGWLTDRRCLKNYQYVC 352          
BLAST of slc16a-28 vs. Ensembl Human
Match: SLC16A5 (solute carrier family 16 member 5 [Source:HGNC Symbol;Acc:HGNC:10926])

HSP 1 Score: 62.003 bits (149), Expect = 2.865e-10
Identity = 48/185 (25.95%), Postives = 85/185 (45.95%), Query Frame = 2
Query:   89 DSSKAWSVTIGCMIVNALMVGFIKIYSLIIIEYQDLLNAPMSLLMFGTSMLTSLTGLAAPLSAYLSERFTTMKTGIFASFLAVASIIMMAFSYNIYVQVTSAAFLGKFSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGSSIGALIMPLGLSELINTYSIRGVMLIMAGVLFNFAVAAVLI 643
            D S AW V +  M+   L +GF     +   E Q    A  S   +  S+LT++  +A PL + L  RF    T +    LA   ++  +FS+N+     +A F+    LG+ FS  +  +I++ G   ++ + L+  + + G S+G  + PL    L+     RG  L+  G+  +  +   +I
Sbjct:    9 DGSWAWVVLLATMVTQGLTLGFPTCIGIFFTELQWEFQASNSETSWFPSILTAVLHMAGPLCSILVGRFGCRVTVMLGGVLASLGMVASSFSHNLSQLYFTAGFIT--GLGMCFS--FQSSITVLGFYFVRRRVLANALASMGVSLGITLWPLLSRYLLENLGWRGTFLVFGGIFLHCCICGAII 189          
BLAST of slc16a-28 vs. Ensembl Human
Match: SLC16A5 (solute carrier family 16 member 5 [Source:HGNC Symbol;Acc:HGNC:10926])

HSP 1 Score: 62.3882 bits (150), Expect = 9.763e-10
Identity = 48/185 (25.95%), Postives = 85/185 (45.95%), Query Frame = 2
Query:   89 DSSKAWSVTIGCMIVNALMVGFIKIYSLIIIEYQDLLNAPMSLLMFGTSMLTSLTGLAAPLSAYLSERFTTMKTGIFASFLAVASIIMMAFSYNIYVQVTSAAFLGKFSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGSSIGALIMPLGLSELINTYSIRGVMLIMAGVLFNFAVAAVLI 643
            D S AW V +  M+   L +GF     +   E Q    A  S   +  S+LT++  +A PL + L  RF    T +    LA   ++  +FS+N+     +A F+    LG+ FS  +  +I++ G   ++ + L+  + + G S+G  + PL    L+     RG  L+  G+  +  +   +I
Sbjct:    9 DGSWAWVVLLATMVTQGLTLGFPTCIGIFFTELQWEFQASNSETSWFPSILTAVLHMAGPLCSILVGRFGCRVTVMLGGVLASLGMVASSFSHNLSQLYFTAGFIT--GLGMCFS--FQSSITVLGFYFVRRRVLANALASMGVSLGITLWPLLSRYLLENLGWRGTFLVFGGIFLHCCICGAII 189          
BLAST of slc16a-28 vs. Ensembl Human
Match: SLC16A5 (solute carrier family 16 member 5 [Source:HGNC Symbol;Acc:HGNC:10926])

HSP 1 Score: 62.3882 bits (150), Expect = 9.763e-10
Identity = 48/185 (25.95%), Postives = 85/185 (45.95%), Query Frame = 2
Query:   89 DSSKAWSVTIGCMIVNALMVGFIKIYSLIIIEYQDLLNAPMSLLMFGTSMLTSLTGLAAPLSAYLSERFTTMKTGIFASFLAVASIIMMAFSYNIYVQVTSAAFLGKFSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGSSIGALIMPLGLSELINTYSIRGVMLIMAGVLFNFAVAAVLI 643
            D S AW V +  M+   L +GF     +   E Q    A  S   +  S+LT++  +A PL + L  RF    T +    LA   ++  +FS+N+     +A F+    LG+ FS  +  +I++ G   ++ + L+  + + G S+G  + PL    L+     RG  L+  G+  +  +   +I
Sbjct:    9 DGSWAWVVLLATMVTQGLTLGFPTCIGIFFTELQWEFQASNSETSWFPSILTAVLHMAGPLCSILVGRFGCRVTVMLGGVLASLGMVASSFSHNLSQLYFTAGFIT--GLGMCFS--FQSSITVLGFYFVRRRVLANALASMGVSLGITLWPLLSRYLLENLGWRGTFLVFGGIFLHCCICGAII 189          
BLAST of slc16a-28 vs. Ensembl Human
Match: SLC16A5 (solute carrier family 16 member 5 [Source:HGNC Symbol;Acc:HGNC:10926])

HSP 1 Score: 62.3882 bits (150), Expect = 9.763e-10
Identity = 48/185 (25.95%), Postives = 85/185 (45.95%), Query Frame = 2
Query:   89 DSSKAWSVTIGCMIVNALMVGFIKIYSLIIIEYQDLLNAPMSLLMFGTSMLTSLTGLAAPLSAYLSERFTTMKTGIFASFLAVASIIMMAFSYNIYVQVTSAAFLGKFSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGSSIGALIMPLGLSELINTYSIRGVMLIMAGVLFNFAVAAVLI 643
            D S AW V +  M+   L +GF     +   E Q    A  S   +  S+LT++  +A PL + L  RF    T +    LA   ++  +FS+N+     +A F+    LG+ FS  +  +I++ G   ++ + L+  + + G S+G  + PL    L+     RG  L+  G+  +  +   +I
Sbjct:    9 DGSWAWVVLLATMVTQGLTLGFPTCIGIFFTELQWEFQASNSETSWFPSILTAVLHMAGPLCSILVGRFGCRVTVMLGGVLASLGMVASSFSHNLSQLYFTAGFIT--GLGMCFS--FQSSITVLGFYFVRRRVLANALASMGVSLGITLWPLLSRYLLENLGWRGTFLVFGGIFLHCCICGAII 189          
BLAST of slc16a-28 vs. Ensembl Fly
Match: hrm (gene:FBgn0033028 transcript:FBtr0086072)

HSP 1 Score: 67.3958 bits (163), Expect = 1.380e-11
Identity = 66/256 (25.78%), Postives = 117/256 (45.70%), Query Frame = 2
Query:   68 EMKLVIVDSSKAWSVTIGCMIVNALMVGFIKIYSLIIIEYQDLLNAPMSLLMFGTSMLTSLTGLAAPLSAYLSERFTTMKTGIFASFLAVASIIMMAFSYNIYVQVTSAAFLGKFSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGSSIGALIMPLGLSELINTYSIRGVMLIMAGVLFNFAVAAVL---IPTHIIKINHGYKPVLIAIQD-REKRSEGDIIKIGKWN--VPIGNFAKKSKLKW--PPRKLW 811
            E  LV  D    W V +G  + N L+ G IK + ++  E+ D  N+  +   +  ++   L     P+S+ LS +++     +     A   +I+  ++ +I     S   L     GLSF     PT+ I      K + L+ G+  +GS++G++I+P  L  L+ TY   G  LIM G+  N  VAA+    +  H++++    +    A+++  E+   G ++K    +  VP    A K  L +  PP  L+
Sbjct:   44 EYDLVPPDGGWGWLVLLGSCLTNILIPGTIKSFGVLFSEFTDAFNSSPTKAAWIPALCYFLYSSLGPVSSILSVKYSYRTVTLLGGASASLGMILSFWASSIEFLYISYGVLVGIGAGLSFP----PTVYIVTSYFAKLRGLANGLCISGSALGSIILPPLLRWLLETYGYHGSCLIMGGITLNVFVAALFYEPVEQHMVRVPRARQ----ALENIPEEEDIGIVMKFENVDEPVPKNEPADKPLLPYNSPPSPLY 291          
BLAST of slc16a-28 vs. Ensembl Fly
Match: hrm (gene:FBgn0033028 transcript:FBtr0345359)

HSP 1 Score: 67.3958 bits (163), Expect = 1.380e-11
Identity = 66/256 (25.78%), Postives = 117/256 (45.70%), Query Frame = 2
Query:   68 EMKLVIVDSSKAWSVTIGCMIVNALMVGFIKIYSLIIIEYQDLLNAPMSLLMFGTSMLTSLTGLAAPLSAYLSERFTTMKTGIFASFLAVASIIMMAFSYNIYVQVTSAAFLGKFSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGSSIGALIMPLGLSELINTYSIRGVMLIMAGVLFNFAVAAVL---IPTHIIKINHGYKPVLIAIQD-REKRSEGDIIKIGKWN--VPIGNFAKKSKLKW--PPRKLW 811
            E  LV  D    W V +G  + N L+ G IK + ++  E+ D  N+  +   +  ++   L     P+S+ LS +++     +     A   +I+  ++ +I     S   L     GLSF     PT+ I      K + L+ G+  +GS++G++I+P  L  L+ TY   G  LIM G+  N  VAA+    +  H++++    +    A+++  E+   G ++K    +  VP    A K  L +  PP  L+
Sbjct:   44 EYDLVPPDGGWGWLVLLGSCLTNILIPGTIKSFGVLFSEFTDAFNSSPTKAAWIPALCYFLYSSLGPVSSILSVKYSYRTVTLLGGASASLGMILSFWASSIEFLYISYGVLVGIGAGLSFP----PTVYIVTSYFAKLRGLANGLCISGSALGSIILPPLLRWLLETYGYHGSCLIMGGITLNVFVAALFYEPVEQHMVRVPRARQ----ALENIPEEEDIGIVMKFENVDEPVPKNEPADKPLLPYNSPPSPLY 291          
BLAST of slc16a-28 vs. Ensembl Fly
Match: Sln (gene:FBgn0033657 transcript:FBtr0088032)

HSP 1 Score: 53.9138 bits (128), Expect = 2.745e-7
Identity = 45/187 (24.06%), Postives = 84/187 (44.92%), Query Frame = 2
Query:   89 DSSKAWSVTIGCMIVNALMVGFIKIYSLIIIEYQDLLNAPMSLLMFGT---SMLTSLTGLAAPLSAYLSERFTTMKTGIFASFLAVASIIMMAFSYNIYVQVTSAAFLGKFSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGSSIGALIMPLGLSELINTYSIRGVMLIMAGVLFNFAVAAVL 640
            D    W +  G   V   + G +K Y ++ +E  +    P S     +   ++L++L  + APLS+ L +RF+               +I+  F+ ++   + +   L     GLS +    P I I  +   KH+ L+ GI  +G++ G+ I+P+ +  L       G +LI+ G + +  V+A L
Sbjct:  227 DGGYGWFIVFGAFSVQFWVAGLVKSYGVLYVEIMETF--PSSTATVASWIPAILSALCLVLAPLSSALCQRFSCRTVVFVGGIFCAMGMILSYFATSLLHLLLTFGVLTGIGGGLSTT----PGIVIVSQYFDKHRALANGICVSGTAAGSFILPVLIKHLAENCGFHGTILILGGCMLHVCVSATL 407          
BLAST of slc16a-28 vs. Ensembl Fly
Match: kar (gene:FBgn0001296 transcript:FBtr0082666)

HSP 1 Score: 52.7582 bits (125), Expect = 4.932e-7
Identity = 47/182 (25.82%), Postives = 83/182 (45.60%), Query Frame = 2
Query:   92 SSKAWSVTIGCMIVNALMVGFIKIYSLIIIEYQDLLN-----------APMSLLMFGTSMLTSLTGLAAPLSAYLSERFTTMKTGIFASFLAVASIIMMAFSYNIYVQVTSAAFLGKFSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGSSIGALIMPLGLSELINTYSIRGVMLIMA 604
             ++AW V +   + N ++ GFI  Y +I     D L            A +  L  GT+ L S   +A  L+  +  R TT   G+    L+   +++ +F       + +  F      GL  ++ Y PT++I G    ++     G +TAGSS+  +I+P  L +L+ +Y + G + IM+
Sbjct:   77 GARAWLVMVSAFLCNGIIFGFINTYGVIHSLLTDRLTKLGDPEASSKAALIGALAIGTTFLFST--MAGCLTDKIGLRLTTFAGGV----LSAGGLLLSSFCTE---NIGALYFTYGIMFGLGAALAYTPTLAILGHYFKRYLGKVSGFVTAGSSVFTVILPPCLDKLLGSYGLEGTLRIMS 249          
BLAST of slc16a-28 vs. Ensembl Fly
Match: kar (gene:FBgn0001296 transcript:FBtr0302563)

HSP 1 Score: 52.7582 bits (125), Expect = 5.611e-7
Identity = 49/187 (26.20%), Postives = 82/187 (43.85%), Query Frame = 2
Query:   95 SKAWSVTIGCMIVNALMVGFIKIYSLIIIEYQDLLN-----------APMSLLMFGTSMLTSLTGLAAPLSAYLSERFTTMKTGIFA------SFLAVASIIMMAFSYNIYVQVTSAAFLGKFSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGSSIGALIMPLGLSELINTYSIRGVMLIMA 604
            ++AW V +   + N ++ GFI  Y +I     D L            A +  L  GT+ L S   +A  L+  +  R TT   G+ +      S     +I  + F+Y I               GL  ++ Y PT++I G    ++     G +TAGSS+  +I+P  L +L+ +Y + G + IM+
Sbjct:   78 ARAWLVMVSAFLCNGIIFGFINTYGVIHSLLTDRLTKLGDPEASSKAALIGALAIGTTFLFST--MAGCLTDKIGLRLTTFAGGVLSAGGLLLSSFCTENIGALYFTYGIM-------------FGLGAALAYTPTLAILGHYFKRYLGKVSGFVTAGSSVFTVILPPCLDKLLGSYGLEGTLRIMS 249          
BLAST of slc16a-28 vs. Ensembl Zebrafish
Match: slc16a12b (solute carrier family 16 member 12b [Source:NCBI gene;Acc:449947])

HSP 1 Score: 80.8777 bits (198), Expect = 6.500e-16
Identity = 80/326 (24.54%), Postives = 139/326 (42.64%), Query Frame = 2
Query:   89 DSSKAWSVTIGCMIVNALMVGFIKIYSLIIIEYQDLLNAPMSLLMFGTSMLTSLTGLAAPLSAYLSERFTTMKTGIFASFLAVASIIMMAFSYNIYVQVTSAAFLGKFSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGSSIGALIMPLGLSELINTYSIRGVMLIMAGVLFNFAVAAVLIPTHIIKINHGYK-PVLIAIQDREKRSEGDIIKIGKWN-VPIGNFAKKSKLKWPPRKLWRSVLLYSFGMTNSM----NGFMLL---CSL----YGAFSRSLSITIQHSAYILIIQSSIDCATRIISGYLVDFKMISRWVLYC 1027
            D    W +  GC +V        +  S+  +E+Q       S   +  S++   T L APL + +  + +     I   FLA   +++ +F+ ++     +   L     GL F++ Y P I++ G    + + L+ GI  +GS IG  I+   +  LI  YS RG +LI+ G + N  V   L+   I+K       PV     D E    G  +K    N  P  + A  +K     ++ ++S+  Y F +          F+LL   CSL       ++  + +  QH+A+++ I   ID    I  G+L D + + ++   C
Sbjct:   25 DGGWGWMIVAGCFVVTVCTRAVTRCISIFFVEFQMHFAKDYSGTAWIHSLVDCTTMLCAPLGSLIGNQLSCRIAVILGGFLASVGLVLSSFATSLEYLYATLGLL----TGLGFALCYTPAIAMVGIYFCERKALAYGIAMSGSGIGTFILAPVVQLLIEHYSWRGALLILGGFVLNLCVCGALLRPIILKEEEACPLPV-----DSEC---GYSVKPPTLNGGPTRSAASDAK-----QRCFQSMQEYHFLLMPDFLVLAGSFLLLASGCSLPFVYLVPYALDVGVGHQHAAFLMSILGVIDIVGNITFGWLTDRRCLKKYRNIC 333          
BLAST of slc16a-28 vs. Ensembl Zebrafish
Match: SLC16A7 (zgc:165507 [Source:ZFIN;Acc:ZDB-GENE-070620-11])

HSP 1 Score: 61.2326 bits (147), Expect = 1.139e-9
Identity = 68/290 (23.45%), Postives = 121/290 (41.72%), Query Frame = 2
Query:  152 FIKIYSLIIIEYQDLLNAPMSLLMFGTSMLTSLTGLAAPLSAYLSERFTTMKTGIFASFLAVASIIMMAFSYNIYVQVTSAAFLGKFSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGSSIG-ALIMPLGLSELINTYSIRGVMLIMAGVLFNFAVAAVLIPTHIIKINHGYKPVLIAIQDREKRSEGDIIKIGKWNVPIGNFAKKSKLKWPPRKLWRSVLLYSFGMTNSMNGFMLLCSLYGAFSRSLSITIQHSAYILIIQSSIDCATRIISGYLVDFKMISRWV 1018
            F K  ++   + Q + NA  S + + +S++ ++     P+S+ L   +      I   FL    +I  +F  N+         +G   LGL+F++   P +++ G+   K + ++ G   AGS +  + + PL    LIN Y  RG  LI+ G+L N  VA  L+   +        P ++ ++  EK       K+  W   +  +   S  K       R  L+Y  G      GF         +++   +    +A++L I + +D   R   G L +    SRWV
Sbjct:   35 FPKATTVFFKDIQRIFNASYSQVAWISSIMLAVMYAGGPISSILVNTYGCRPIMILGGFLCAIGMISASFCNNVLELYICIGVIG--GLGLAFNLQ--PALTMIGRYFYKKRPIANGFAMAGSPVFLSTLAPLN-QYLINEYGWRGSFLILGGLLLNCCVAGSLMRPLVAPAGSIAPPPVVEVKHAEKE------KLTAWQT-VNKYLDLSLFKH------RGFLIYLSGNVIMFLGFFAPIVFLSPYAKDNGVDEYQAAFLLSILAFVDMFARPSMGLLAN----SRWV 302          
BLAST of slc16a-28 vs. Ensembl Zebrafish
Match: BX511087.3 (solute carrier family 16 member 12a [Source:NCBI gene;Acc:557762])

HSP 1 Score: 60.077 bits (144), Expect = 2.786e-9
Identity = 52/234 (22.22%), Postives = 104/234 (44.44%), Query Frame = 2
Query:   89 DSSKAWSVTIGCMIVNALMVGFIKIYSLIIIEYQDLLNAPMSLLMFGTSMLTSLTGLAAPLSAYLSERFTTMKTGIFASFLAVASIIMMAFSYNIYVQVTSAAFLGKFSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGSSIGALIMPLGLSELINTYSIRGVMLIMAGVLFNFAVAAVLIPTHIIKINHGYKPVLIAIQDREKRSEGDIIKIGKWNVPIGNFAKKSKLK 790
            D    W +  GC +         +  S+  +E+Q   +   S   +  S+L   T L APL +Y+  R ++    +    L+   +++ + + ++     +   L     G+ F++ Y P I++ G    + + L+ GI  +GS IG  I+   +  LI  +S RG +LI+AG++ +      L+           +P+       +K SE ++++ GK  +   +  +K+ LK
Sbjct:   12 DGGWGWMIVAGCFLTTVCTRAVTRCVSIFFVEFQLYFSRDYSATAWIHSLLDCTTMLCAPLGSYIGNRLSSRIAIMIGGLLSSTGLLLSSLATSVEFLYLTLGVL----TGVGFALSYTPAIAMVGSYFRQRKALAYGIAMSGSGIGTFILAPAVQLLIEFFSWRGALLILAGLVSHLCFCGALM-----------RPL-------QKPSE-NMLRNGKGWIEADDMKQKTVLK 222          
BLAST of slc16a-28 vs. Ensembl Zebrafish
Match: BX511087.3 (solute carrier family 16 member 12a [Source:NCBI gene;Acc:557762])

HSP 1 Score: 57.7658 bits (138), Expect = 1.589e-8
Identity = 45/186 (24.19%), Postives = 89/186 (47.85%), Query Frame = 2
Query:   89 DSSKAWSVTIGCMIVNALMVGFIKIYSLIIIEYQDLLNAPMSLLMFGTSMLTSLTGLAAPLSAYLSERFTTMKTGIFASFLAVASIIMMAFSYNI-YVQVTSAAFLGKFSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGSSIGALIMPLGLSELINTYSIRGVMLIMAGVLFNFAVAAVLI 643
            D    W +  GC +         +  S+  +E+Q   +   S   +  S+L   T L APL +Y+  R ++    +    L+   +++ + + ++ ++ +T    LG  + G+ F++ Y P I++ G    + + L+ GI  +GS IG  I+   +  LI  +S RG +LI+AG++ +      L+
Sbjct:    7 DGGWGWMIVAGCFLTTVCTRAVTRCVSIFFVEFQLYFSRDYSATAWIHSLLDCTTMLCAPLGSYIGNRLSSRIAIMIGGLLSSTGLLLSSLATSVEFLYLT----LGVLT-GVGFALSYTPAIAMVGSYFRQRKALAYGIAMSGSGIGTFILAPAVQLLIEFFSWRGALLILAGLVSHLCFCGALM 187          
BLAST of slc16a-28 vs. Ensembl Zebrafish
Match: slc16a12a (solute carrier family 16 member 12a [Source:ZFIN;Acc:ZDB-GENE-080721-24])

HSP 1 Score: 57.7658 bits (138), Expect = 2.007e-8
Identity = 49/190 (25.79%), Postives = 86/190 (45.26%), Query Frame = 2
Query:   89 DSSKAWSVTIGCMIVNALMVGFIKIYSLIIIEYQDLLNAPMSLLMFGTSMLTSLTGLAAPLSAYLSERFTTMKTGIFASFLAVA-SIIMMAFSYNIYVQVTSAAF----LGKFSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGSSIGALIMPLGLSELINTYSIRGVMLIMAGVLFNFAVAAVLI 643
            D    W +  GC +         +  S+  +E+Q   +   S   +  S+L   T L APL +Y+  R +        S +A+    ++ +    +    TS  F    LG  + G+ F++ Y P I++ G    + + L+ GI  +GS IG  I+   +  LI  +S RG +LI+AG++ +  V   L+
Sbjct:   67 DGGWGWMIVAGCFLTTVCTRAVTRCVSIFFVEFQLYFSRDYSATAWIHSLLDCTTMLCAPLGSYIGNRLS--------SRIAIMIGGLLSSTGLLLSSLATSVEFLYLTLGVLT-GVGFALSYTPAIAMVGSYFRQRKALAYGIAMSGSGIGTFILAPAVQLLIEFFSWRGALLILAGLVSHLCVCGALM 247          
BLAST of slc16a-28 vs. Ensembl Xenopus
Match: slc16a12 (solute carrier family 16 member 12 [Source:NCBI gene;Acc:394932])

HSP 1 Score: 82.4185 bits (202), Expect = 8.865e-17
Identity = 75/317 (23.66%), Postives = 147/317 (46.37%), Query Frame = 2
Query:   89 DSSKAWSVTIGCMIVNALMVGFIKIYSLIIIEYQDLLNAPMSLLMFGTSMLTSLTGLAAPLSAYLSERFTTMKTGIFASFLAVASIIMMAFSYNI-YVQVTSAAFLGKFSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGSSIGALIMPLGLSELINTYSIRGVMLIMAGVLFNFAVAAVLIPTHIIKINHGYKPVLIAIQDREKRSEGDIIKIGKWN---VPIGNFAKKSKLKWPPRKLWRSVLLYSFGMTNSMNGFMLLCSLYGA---------FSRSLSITIQHSAYILIIQSSIDCATRIISGYLVDFK 1000
            D    W + IGC  V        +  S+  +E+Q       +   +  S++   T L AP+ +Y+S  F+     I    LA   +++ +F+ ++ Y+ +T    LG  + GL F++ Y P I++ GK   K + L+ GI  +GS IG  I+   +  LI  +S RG +LI+ G + N  V   L+    +K +  + P+      ++++ E +  + G+ +    P+       +L +  +K +  +L   F M  +++ F+ L   YG          ++ ++ ++ Q +A+++ I   ID    I  G++ D +
Sbjct:   14 DGGWGWMIVIGCFFVTVCTRAVTRCISIFFVEFQSYFAQDYARTAWIHSIVDCSTMLCAPIGSYVSNHFSCQVGIILGGVLASTGLVLSSFATSLEYLYLT----LGVLT-GLGFALCYSPAIAMVGKYFEKRKALAYGIAMSGSGIGTFILAPVVQLLIEQFSWRGALLILGGFVSNLCVCGALMRPITLKEDSLHYPL------KQEQMENEPTQSGRLDSSCSPLCQDCSHKRLCYCTKKEYSFLLKPKF-MVLAVS-FLFL--AYGCSPPFVYLVPYALNVGVSNQEAAFLMSILGIIDIVGNITFGWVTDTR 315          
BLAST of slc16a-28 vs. Ensembl Xenopus
Match: SLC16A5 (solute carrier family 16 (monocarboxylate transporter), member 5 [Source:NCBI gene;Acc:100485544])

HSP 1 Score: 77.0258 bits (188), Expect = 1.512e-14
Identity = 79/329 (24.01%), Postives = 140/329 (42.55%), Query Frame = 2
Query:   89 DSSKAWSVTIGCMIVNALMVGFIKIYSLIIIEYQDLLNAPMSLLMFGTSMLTSLTGLAAPLSAYLSERFTTMKTGIFASFLAVASIIMMAFSYNIYVQVTSAAFLGKFSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGSSIGALIMPLGLSELINTYSIRGVMLIMAGVLFNFAV-AAVLIPTHIIKINHGYKPVLIAIQDREKRSEGDIIKIGKWNVPIGNFAKKSKLKWPPRKLWRSVLLYSFGMTNSMNGFMLLCSLYGAFSRSLSITIQHSAYILIIQSSIDCATRIISGYLVDFKMISRWVLYCSSGFLLSIITILTGI 1072
            D   AW V    M+   L +GF     +   + Q    A  +   +  S++ ++     PL   + ERF    T +    L    ++  AFS  I     SA F+G    GL F   +   I++ G   I+ + L+  + +AG+SIG  + PL    L+ T   RG  L+  GVL N  V  A++ P   ++  H  K VL   +    + +G+  + GK          +  + +      R   +Y+ G+T  + GF+L       ++ S +I  + +A +L +   ++   R ++G +   K+    ++Y     L S+  IL G+
Sbjct:    5 DGPWAWVVLAAVMLTQGLSLGFPSCIGIFYTDIQTSFQASNTETSWFPSIIMAVLHAGGPLCTIMVERFGCRVTVMVGGLLCGVGMVTSAFSQTIIHLYLSAGFVG----GLGFCFCFQAGITVLGYYFIRRRTLANSLASAGASIGMALWPLASQHLLETMGWRGSFLLFGGVLLNCCVCGAIMRPVRSLEPAH-EKEVLAPEEPNGIKHKGEKTEQGK--------GLQRYMAFDLLFRHRRYQIYALGVTWMVLGFVLPLFYLVPYATSNNIDEKKAALLLSLVGFMNIFMRPMAGLVSQQKVFHGRLMY-----LFSVAVILNGL 315          
BLAST of slc16a-28 vs. Ensembl Xenopus
Match: slc16a7 (solute carrier family 16 member 7 [Source:NCBI gene;Acc:100127205])

HSP 1 Score: 63.1586 bits (152), Expect = 4.077e-10
Identity = 76/315 (24.13%), Postives = 132/315 (41.90%), Query Frame = 2
Query:   89 DSSKAWSVTIGCMIVNALMVGFIKIYSLIIIEYQDLLNAPMSLLMFGTSMLTSLTGLAAPLSAYLSERFTTMKTGIFASFLAVASIIMMAFSYNIYVQVTSAAFLGKFSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGSSIG-ALIMPLGLSELINTYSIRGVMLIMAGVLFNFAVAAVLIPTHIIKINHGYKPVLIAIQDREKRSEGDIIKIGKWNV--PIGNFAKKSKLKWPPRKLWRSVLLYSFGMTNSMNGFMLLCSLYGAFSRSLSITIQHSAYILIIQSSIDCATRIISGYLVDFKMISRWVLY 1024
            D    W V  G  I       F K  ++   E Q++ N   S + + +S++ ++     P+S+ L  ++ +    I    L   ++I  +F  ++         +G F  GL+F++   P+++I GK   K + ++ G+  AGS +  + + PL    L N +  RG  LI+ G+L N  VA  L+         G KPV    +D EK  + D     K +V   I  +   S  K       R  L+Y  G      GF         +++ + I    SA++L I + +D   R   G + + + I   + Y
Sbjct:   14 DGGWGWVVVFGSFISIGFSYAFPKAITVFFKEIQEIFNTSYSEIAWISSIMLAVMYAGGPISSILVNKYGSRPVVIGGGVLCSLAMISASFCNSVMQLYICIGVMGGF--GLAFNLQ--PSLTIIGKYFFKKRPIANGLAMAGSPVFLSTLAPLN-QFLFNQFGWRGSFLILGGLLLNCCVAGSLMRPI------GPKPVK---KDIEKAPKDDENHKKKESVCQSINKYLDLSLFKH------RGFLIYLSGNVIMFIGFFAPIVFLAPYAKHMGIDQYSSAFLLSILAFVDMVARPTMGMVANTRFIRPRIQY 308          
BLAST of slc16a-28 vs. Ensembl Xenopus
Match: slc16a7 (solute carrier family 16 member 7 [Source:NCBI gene;Acc:100127205])

HSP 1 Score: 61.6178 bits (148), Expect = 1.407e-9
Identity = 76/315 (24.13%), Postives = 132/315 (41.90%), Query Frame = 2
Query:   89 DSSKAWSVTIGCMIVNALMVGFIKIYSLIIIEYQDLLNAPMSLLMFGTSMLTSLTGLAAPLSAYLSERFTTMKTGIFASFLAVASIIMMAFSYNIYVQVTSAAFLGKFSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGSSIG-ALIMPLGLSELINTYSIRGVMLIMAGVLFNFAVAAVLIPTHIIKINHGYKPVLIAIQDREKRSEGDIIKIGKWNV--PIGNFAKKSKLKWPPRKLWRSVLLYSFGMTNSMNGFMLLCSLYGAFSRSLSITIQHSAYILIIQSSIDCATRIISGYLVDFKMISRWVLY 1024
            D    W V  G  I       F K  ++   E Q++ N   S + + +S++ ++     P+S+ L  ++ +    I    L   ++I  +F  ++         +G F  GL+F++   P+++I GK   K + ++ G+  AGS +  + + PL    L N +  RG  LI+ G+L N  VA  L+         G KPV    +D EK  + D     K +V   I  +   S  K       R  L+Y  G      GF         +++ + I    SA++L I + +D   R   G + + + I   + Y
Sbjct:   14 DGGWGWVVVFGSFISIGFSYAFPKAITVFFKEIQEIFNTSYSEIAWISSIMLAVMYAGGPISSILVNKYGSRPVVIGGGVLCSLAMISASFCNSVMQLYICIGVMGGF--GLAFNLQ--PSLTIIGKYFFKKRPIANGLAMAGSPVFLSTLAPLN-QFLFNQFGWRGSFLILGGLLLNCCVAGSLMRPI------GPKPVK---KDIEKAPKDDENHKKKESVCQSINKYLDLSLFKH------RGFLIYLSGNVIMFIGFFAPIVFLAPYAKHMGIDQYSSAFLLSILAFVDMVARPTMGMVANTRFIRPRIQY 308          
BLAST of slc16a-28 vs. Ensembl Xenopus
Match: mad2l1 (mitotic arrest deficient 2 like 1 [Source:Xenbase;Acc:XB-GENE-947153])

HSP 1 Score: 56.9954 bits (136), Expect = 4.070e-8
Identity = 74/328 (22.56%), Postives = 135/328 (41.16%), Query Frame = 2
Query:   89 DSSKAWSVTIGCMIVNALMVGFIKIYSLIIIEYQDLLNAPMSLLMFGTSMLTSLTGLAAPLSAYLSERFTTMKTGIFASFLAVASIIMMAFSYNIYVQVTSAAFLGKFSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGSSIG-ALIMPLGLSELINTYSIRGVMLIMAGVLFNFAVAAVLI----PTHIIKINHGYKPVLIAIQD-REKRSEGDIIKIGKWNVPIGNFAKKSKLKWPPRKL----------WRSVLLYSFGMTNSMNGFMLLCSLYGAFSRSLSITIQHSAYILIIQSSIDCATRIISGYLVDFKMISRWVLY 1024
            D    W V +G  I       F K  ++   E Q+   A  S + + +S+L +      P+S+ L  R+ +    IF   L+   +I+  FS +I   +    F+G  + G  FS+   P++ + GK  +K + ++ G+  AGS +  + + PL    L + +  RG   I+  +L N  VA  L     P+   KI    KP     QD  EK +   ++   K     G   +++K +   +K            R  ++Y  G       F         +++ L +    +A++L I + +D   R  +G + + K +   + Y
Sbjct:   15 DGGWGWMVVLGAFISMGFSYAFSKAITVFFKEIQEHFGASYSEIAWISSILLAAMYAGGPVSSILVNRYGSRPVVIFGGLLSGVGMIIATFSSSI---LQLYIFIGVIA-GFGFSLNLQPSVIVVGKYFLKKRPIANGLAMAGSPVVLSTLAPLN-QFLFDKFGWRGSFFILGALLLNCCVAGALFRPIGPSTTDKIQK--KPA----QDLAEKGTNETLLTANKLPPSYGTKMEETKQETCLQKFNKVLDLTLFKHRGFMIYLVGNVVMFFAFYAPIVFLTPYAKHLGVDEYSAAFLLSILAIVDMFARPGTGLIANTKWVRPKIQY 331          
BLAST of slc16a-28 vs. Ensembl Mouse
Match: Slc16a12 (solute carrier family 16 (monocarboxylic acid transporters), member 12 [Source:MGI Symbol;Acc:MGI:2147716])

HSP 1 Score: 80.8777 bits (198), Expect = 6.605e-16
Identity = 93/441 (21.09%), Postives = 182/441 (41.27%), Query Frame = 2
Query:   89 DSSKAWSVTIGCMIVNALMVGFIKIYSLIIIEYQDLLNAPMSLLMFGTSMLTSLTGLAAPLSAYLSERFTTMKTGIFASFLAVASIIMMAFSYNIYVQVTSAAFLGKFSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGSSIGALIMPLGLSELINTYSIRGVMLIMAGVLFNFAVAAVLIPTHIIKINHGYKPVLIAIQDREKRSEGDIIKIGKWNVPIGNFAKKSKLKWPPRKLWRSVLLYSFGMTNSMNGFMLLCSLYGA---------FSRSLSITIQHSAYILIIQSSIDCATRIISGYLVDFKMIS--RWVLYCSSGFLLSIITILTGIFPSIPLFYFYLLSHAXXXXXXXXXXXXXXXXXXXXXYITATFSFYVFIQGTMSLFSFYAVGYFCDKTGHYEYAICLSGAILALGALCIVTEHIFRSMQSRNV 1378
            D    W +  GC +V        +  S+  +E+Q       S   +  S++  +T L APL + +S + +     +    LA    I+ +F+ ++     S   L     GL F++ Y P I++ GK   + + L+ GI  +GS IG  I+   +  LI  +S RG +LI+ G + N  V   L+    +K +       +  ++  + S+ +  K      P+     +++L    ++ +  +L+  F +      FM     YG          ++ S+ ++   +A+++ I   ID    I  G+L D + +   R+V Y  +  L  +  +   +  + PL   +  +     G  + L  ++  ++VG   +++      F+     L S    G+  D TG Y  A  L G  +   ++ +    I + M+   V
Sbjct:   14 DGGWGWMIVAGCFLVTICTRAVTRCISIFFVEFQTYFAQDYSQTAWIHSIVDCMTMLCAPLGSVVSNQLSCQAGIMLGGLLASTGFILGSFATSLKHLYLSLGVL----TGLGFALCYSPAIAMVGKYFSRRKALAYGIAMSGSGIGTFILAPVVQLLIEQFSWRGALLILGGFVLNLCVCGALMRPITLKEDRS-----VPEKNHNRESQREDCKQASPYSPLTKECTETRLCCSLQQEYGFLLMSDFVVLAVSVLFM----AYGCSPLFVYLVPYALSVGVSHHQAAFLMSILGVIDIVGNITFGWLTDRRCLKNYRYVCYLFAVALDGLCYLCLPMLQTFPLLVPFSCTFGYFDGAYVTLIPVVTAEIVGTTSLSSALGVVYFLHAVPYLVSPPIAGWLVDTTGSYTAAFLLCGFAMIFSSILLGFVRIVKRMKRTQV 441          
BLAST of slc16a-28 vs. Ensembl Mouse
Match: Slc16a5 (solute carrier family 16 (monocarboxylic acid transporters), member 5 [Source:MGI Symbol;Acc:MGI:2443515])

HSP 1 Score: 53.9138 bits (128), Expect = 2.848e-7
Identity = 46/186 (24.73%), Postives = 85/186 (45.70%), Query Frame = 2
Query:   89 DSSKAWSVTIGCMIVNALMVGFIKIYSLIIIEYQDLLNAPMSLLMFGTSMLTSLTGLAAPLSAYLSERFTTMKTGIFASFLAVASIIMMAFSYNI-YVQVTSAAFLGKFSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGSSIGALIMPLGLSELINTYSIRGVMLIMAGVLFNFAVAAVLI 643
            D   AW V +  ++  AL +GF     +   + Q    A  S   +  S+L ++     PL + L + F    T +    LA   +++  FS ++ ++ +T+    G   LG+ FS  +  +I++ G   ++ + L+  + + G S+G  + PL    L+ T   RG  LI  G+L +  V   L+
Sbjct:    9 DGRWAWVVLLSSLVTQALTLGFPTCIGVFFTDLQRDFQASNSETSWFPSILGAMVHGGGPLCSILVKHFGCRVTMMLGGVLASLGMVVSTFSGSLTHLFLTAGVITG---LGMCFS--FQSSITVVGLYFVRRRPLANALASMGLSMGVTLWPLLARYLLETLGWRGAFLIFGGILLHCCVCGALL 189          
BLAST of slc16a-28 vs. Ensembl Mouse
Match: Slc16a9 (solute carrier family 16 (monocarboxylic acid transporters), member 9 [Source:MGI Symbol;Acc:MGI:1914109])

HSP 1 Score: 51.6026 bits (122), Expect = 1.568e-6
Identity = 47/219 (21.46%), Postives = 87/219 (39.73%), Query Frame = 2
Query:   89 DSSKAWSVTIGCMIVNALMVGFIKIYSLIIIEYQDLLNAPMSLLMFGTSMLTSLTGLAAPLSAYLSERFTTMKTGIFASFLAVASIIMMAFSYNIYVQVTSAAFLGKFSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGSSIGALIMPLGLSELINTYSIRGVMLIMAGVLFN-FAVAAVLIPTHIIKINHGYKPVLIAIQDR-------EKRSE 721
            D    W + +       L  G      ++ +E+ D          +  S+ + +  LA+P+ +     F      IF+ FL    +++ + + NIY    S   +    +GL   ++Y  T++I+ +     + L+ G+I+ GSS+G  I       LI  Y + G +LI+  +  N  A  +++ P          K     + DR       EK  E
Sbjct:    8 DGGWGWVIVVVSFFTQFLSYGSPLAVGVLYVEWLDAFGEGKGKTAWVGSLASGVGLLASPVCSLFVSSFGARPVTIFSGFLVAGGLMLSSLAPNIYFLFFSYGIV----VGLGCGLLYTATVTITCQYFDSRRGLALGLISTGSSVGLFIYAALQRMLIEFYGLDGCLLIVGALALNILACGSLMRPLQTSDCPFPEKTAPENVPDRYSMYNEKEKNPE 222          
BLAST of slc16a-28 vs. Ensembl Mouse
Match: Slc16a14 (solute carrier family 16 (monocarboxylic acid transporters), member 14 [Source:MGI Symbol;Acc:MGI:1919031])

HSP 1 Score: 50.0618 bits (118), Expect = 5.384e-6
Identity = 43/220 (19.55%), Postives = 85/220 (38.64%), Query Frame = 2
Query:   86 VDSSKAWSVTIGCMIVNALMVGFIKIYSLIIIEYQDLLNAPMSLLMFGTSMLTSLTGLAAPLSAYLSERFTTMKTGIFASFLAVASIIMMAFSYNI---YVQVTSAAFLGKFSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGSSIGALIMPLGLSELINTYSIRGVMLIMAGVLFNFAVAAVLI----PTHIIKINHGYKPVLIAIQDREKRSEG 724
            +D   AW + +    V+ L++G      ++ +E+ +  +    L  + +S+   +T +  P            +T I    +     ++ A++ N+   ++    AA       GL   + Y+P + + G+   K + L+QG+ T G+  G  +M + L  L   Y  R  M I   +  N  V   L+    P  +       +P  +     E    G
Sbjct:   30 IDGGWAWMMVLSSFFVHILIMGSQMALGVLNVEWLEEFHQSRGLTAWVSSLSMGITLIVGPFIGLFINTCGCRQTAIIGGLVNSLGWVLSAYAANVQSLFITFGVAA-------GLGSGMAYLPAVVMVGRYFQKRRALAQGLSTTGTGFGTFLMTVLLKYLCAEYGWRNAMFIQGALSLNLCVCGALMRPLSPEKLENCPEAEEPCALPAYSTESVKSG 242          
BLAST of slc16a-28 vs. UniProt/SwissProt
Match: sp|Q6P2X9|MOT12_XENTR (Monocarboxylate transporter 12 OS=Xenopus tropicalis OX=8364 GN=slc16a12 PE=2 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 5.402e-16
Identity = 75/321 (23.36%), Postives = 149/321 (46.42%), Query Frame = 2
Query:   89 DSSKAWSVTIGCMIVNALMVGFIKIYSLIIIEYQDLLNAPMSLLMFGTSMLTSLTGLAAPLSAYLSERFTTMKTGIFASFLAVASIIMMAFSYNI-YVQVTSAAFLGKFSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGSSIGALIMPLGLSELINTYSIRGVMLIMAGVLFNFAVAAVLIPTHIIKINHGYKPVLIAIQDREKRSEGDIIKIGKWN---VPIGNFAKKSKLKWPPRKLWRSVLLYSFGMTNSMNGFMLLCSLYGA---------FSRSLSITIQHSAYILIIQSSIDCATRIISGYLVDFKMISR 1012
            D    W + IGC  V        +  S+  +E+Q       +   +  S++   T L AP+ +Y+S  F+     I    LA   +++ +F+ ++ Y+ +T    LG  + GL F++ Y P I++ GK   K + L+ GI  +GS IG  I+   +  LI  +S RG +LI+ G + N  V   L+    +K +  + P+      ++++ E +  + G+ +    P+       +L +  +K +  +L   F M  +++ F+ L   YG          ++ ++ ++ Q +A+++ I   ID    I  G++ D + + +
Sbjct:   14 DGGWGWMIVIGCFFVTVCTRAVTRCISIFFVEFQSYFAQDYARTAWIHSIVDCSTMLCAPIGSYVSNHFSCQVGIILGGVLASTGLVLSSFATSLEYLYLT----LGVLT-GLGFALCYSPAIAMVGKYFEKRKALAYGIAMSGSGIGTFILAPVVQLLIEQFSWRGALLILGGFVSNLCVCGALMRPITLKEDSLHYPL------KQEQMENEPTQSGRLDSSCSPLCQDCSHKRLCYCTKKEYSFLLKPKF-MVLAVS-FLFL--AYGCSPPFVYLVPYALNVGVSNQEAAFLMSILGIIDIVGNITFGWVTDTRFLKK 319          
BLAST of slc16a-28 vs. UniProt/SwissProt
Match: sp|Q8BGC3|MOT12_MOUSE (Monocarboxylate transporter 12 OS=Mus musculus OX=10090 GN=Slc16a12 PE=1 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 4.620e-15
Identity = 93/441 (21.09%), Postives = 182/441 (41.27%), Query Frame = 2
Query:   89 DSSKAWSVTIGCMIVNALMVGFIKIYSLIIIEYQDLLNAPMSLLMFGTSMLTSLTGLAAPLSAYLSERFTTMKTGIFASFLAVASIIMMAFSYNIYVQVTSAAFLGKFSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGSSIGALIMPLGLSELINTYSIRGVMLIMAGVLFNFAVAAVLIPTHIIKINHGYKPVLIAIQDREKRSEGDIIKIGKWNVPIGNFAKKSKLKWPPRKLWRSVLLYSFGMTNSMNGFMLLCSLYGA---------FSRSLSITIQHSAYILIIQSSIDCATRIISGYLVDFKMIS--RWVLYCSSGFLLSIITILTGIFPSIPLFYFYLLSHAXXXXXXXXXXXXXXXXXXXXXYITATFSFYVFIQGTMSLFSFYAVGYFCDKTGHYEYAICLSGAILALGALCIVTEHIFRSMQSRNV 1378
            D    W +  GC +V        +  S+  +E+Q       S   +  S++  +T L APL + +S + +     +    LA    I+ +F+ ++     S   L     GL F++ Y P I++ GK   + + L+ GI  +GS IG  I+   +  LI  +S RG +LI+ G + N  V   L+    +K +       +  ++  + S+ +  K      P+     +++L    ++ +  +L+  F +      FM     YG          ++ S+ ++   +A+++ I   ID    I  G+L D + +   R+V Y  +  L  +  +   +  + PL   +  +     G  + L  ++  ++VG   +++      F+     L S    G+  D TG Y  A  L G  +   ++ +    I + M+   V
Sbjct:   14 DGGWGWMIVAGCFLVTICTRAVTRCISIFFVEFQTYFAQDYSQTAWIHSIVDCMTMLCAPLGSVVSNQLSCQAGIMLGGLLASTGFILGSFATSLKHLYLSLGVL----TGLGFALCYSPAIAMVGKYFSRRKALAYGIAMSGSGIGTFILAPVVQLLIEQFSWRGALLILGGFVLNLCVCGALMRPITLKEDRS-----VPEKNHNRESQREDCKQASPYSPLTKECTETRLCCSLQQEYGFLLMSDFVVLAVSVLFM----AYGCSPLFVYLVPYALSVGVSHHQAAFLMSILGVIDIVGNITFGWLTDRRCLKNYRYVCYLFAVALDGLCYLCLPMLQTFPLLVPFSCTFGYFDGAYVTLIPVVTAEIVGTTSLSSALGVVYFLHAVPYLVSPPIAGWLVDTTGSYTAAFLLCGFAMIFSSILLGFVRIVKRMKRTQV 441          
BLAST of slc16a-28 vs. UniProt/SwissProt
Match: sp|Q503M4|MT12B_DANRE (Monocarboxylate transporter 12-B OS=Danio rerio OX=7955 GN=slc16a12b PE=2 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 4.685e-15
Identity = 80/326 (24.54%), Postives = 139/326 (42.64%), Query Frame = 2
Query:   89 DSSKAWSVTIGCMIVNALMVGFIKIYSLIIIEYQDLLNAPMSLLMFGTSMLTSLTGLAAPLSAYLSERFTTMKTGIFASFLAVASIIMMAFSYNIYVQVTSAAFLGKFSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGSSIGALIMPLGLSELINTYSIRGVMLIMAGVLFNFAVAAVLIPTHIIKINHGYK-PVLIAIQDREKRSEGDIIKIGKWN-VPIGNFAKKSKLKWPPRKLWRSVLLYSFGMTNSM----NGFMLL---CSL----YGAFSRSLSITIQHSAYILIIQSSIDCATRIISGYLVDFKMISRWVLYC 1027
            D    W +  GC +V        +  S+  +E+Q       S   +  S++   T L APL + +  + +     I   FLA   +++ +F+ ++     +   L     GL F++ Y P I++ G    + + L+ GI  +GS IG  I+   +  LI  YS RG +LI+ G + N  V   L+   I+K       PV     D E    G  +K    N  P  + A  +K     ++ ++S+  Y F +          F+LL   CSL       ++  + +  QH+A+++ I   ID    I  G+L D + + ++   C
Sbjct:   14 DGGWGWMIVAGCFVVTVCTRAVTRCISIFFVEFQMHFAKDYSGTAWIHSLVDCTTMLCAPLGSLIGNQLSCRIAVILGGFLASVGLVLSSFATSLEYLYATLGLL----TGLGFALCYTPAIAMVGIYFCERKALAYGIAMSGSGIGTFILAPVVQLLIEHYSWRGALLILGGFVLNLCVCGALLRPIILKEEEACPLPV-----DSEC---GYSVKPPTLNGGPTRSAASDAK-----QRCFQSMQEYHFLLMPDFLVLAGSFLLLASGCSLPFVYLVPYALDVGVGHQHAAFLMSILGVIDIVGNITFGWLTDRRCLKKYRNIC 322          
BLAST of slc16a-28 vs. UniProt/SwissProt
Match: sp|Q6GM59|MOT12_XENLA (Monocarboxylate transporter 12 OS=Xenopus laevis OX=8355 GN=slc16a12 PE=2 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 7.738e-15
Identity = 77/323 (23.84%), Postives = 140/323 (43.34%), Query Frame = 2
Query:   89 DSSKAWSVTIGCMIVNALMVGFIKIYSLIIIEYQDLLNAPMSLLMFGTSMLTSLTGLAAPLSAYLSERFTTMKTGIFASFLAVASIIMMAFSYNI-YVQVTSAAFLGKFSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGSSIGALIMPLGLSELINTYSIRGVMLIMAGVLFNFAVAAVLIPTHIIKINHGYKPVLIAIQDREKRSEGDIIKIGKWNVPIGNFAKKSKLKWPPRKLWRSVLLYSFGMTNSMNGFMLLCSLYGA---------FSRSLSITIQHSAYILIIQSSIDCATRIISGYLVDFKMISRWVLYC 1027
            D    W + IGC  V        +  S+  +E+Q       +   +  S++   T L AP+ +Y+S  F+     I    LA   +++ +F+ ++ Y+ +T    LG  + GL F++ Y P I++ GK   K + L+ GI  +GS IG  I+   +  LI  +S RG +LI+ G + N  V   L+    +K +  + P+      RE + +           P+       KL +   K +  +L   F +      F+ L   YG          +S S+ ++ Q +A+++ I   +D    I  G++ D + + +    C
Sbjct:   14 DGGWGWMIVIGCFFVTVCTRAVTRCISIFFVEFQSYFAQDYARTAWIHSIVDCSTMLCAPIGSYVSNHFSCQVGIILGGVLASTGLVLSSFATSLEYLYLT----LGVLT-GLGFALCYSPAIAMVGKYFEKRKALAYGIAMSGSGIGTFILAPVVQLLIEQFSWRGALLILGGFVSNLCVCGALMRPISLKEDSLHYPL-----KREPQLDSSC-------SPLCQDCSHKKLCYCTTKEYHFLLKPKFIILAV--SFLFL--AYGCSPPFVYLVPYSLSVGVSHQEAAFLMSILGIVDIVGNITFGWVTDRRFLKKHRYCC 315          
BLAST of slc16a-28 vs. UniProt/SwissProt
Match: sp|Q6ZSM3|MOT12_HUMAN (Monocarboxylate transporter 12 OS=Homo sapiens OX=9606 GN=SLC16A12 PE=1 SV=3)

HSP 1 Score: 75.8702 bits (185), Expect = 2.376e-13
Identity = 79/335 (23.58%), Postives = 143/335 (42.69%), Query Frame = 2
Query:   89 DSSKAWSVTIGCMIVNALMVGFIKIYSLIIIEYQDLLNAPMSLLMFGTSMLTSLTGLAAPLSAYLSERFTTMKTGIFASFLAVASIIMMAFSYNI-YVQVTSAAFLGKFSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGSSIGALIMPLGLSELINTYSIRGVMLIMAGVLFNFAVAAVLIPTHIIKINHGYKPVLIAIQDREKRSEGDIIKIGKWNVPIGNFAKKSKLKWPPRKLWRSVLL-------YSFGMTNSMNGFMLLCS-----LYGA---------FSRSLSITIQHSAYILIIQSSIDCATRIISGYLVDFKMISRWVLYC 1027
            D    W +  GC +V        +  S+  +E+Q       +   +  S++  +T L APL + +S   +     +    LA   +I+ +F+ ++ ++ +T    LG  + GL F++ Y P I++ GK   + + L+ GI  +GS IG  I+   +  LI  +S RG +LI+ G + N  V   L+    +K +H         Q+   R++ + IK           +  S L     K W    L       YSF +   M+ F++L        YG          ++ S+ ++ Q +A+++ I   ID    I  G+L D + +  +   C
Sbjct:   44 DGGWGWMIVAGCFLVTICTRAVTRCISIFFVEFQTYFTQDYAQTAWIHSIVDCVTMLCAPLGSVVSNHLSCQVGIMLGGLLASTGLILSSFATSLKHLYLT----LGVLT-GLGFALCYSPAIAMVGKYFSRRKALAYGIAMSGSGIGTFILAPVVQLLIEQFSWRGALLILGGFVLNLCVCGALMRPITLKEDHTTPE-----QNHVCRTQKEDIK---------RVSPYSSLT----KEWAQTCLCCCLQQEYSFLL---MSDFVVLAVSVLFMAYGCSPLFVYLVPYALSVGVSHQQAAFLMSILGVIDIIGNITFGWLTDRRCLKNYQYVC 352          
BLAST of slc16a-28 vs. TrEMBL
Match: A0A0H3YK78 (Slc16a-28 OS=Schmidtea mediterranea OX=79327 GN=slc16a-28 PE=2 SV=1)

HSP 1 Score: 828.935 bits (2140), Expect = 0.000e+0
Identity = 438/438 (100.00%), Postives = 438/438 (100.00%), Query Frame = 2
Query:   71 MKLVIVDSSKAWSVTIGCMIVNALMVGFIKIYSLIIIEYQDLLNAPMSLLMFGTSMLTSLTGLAAPLSAYLSERFTTMKTGIFASFLAVASIIMMAFSYNIYVQVTSAAFLGKFSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGSSIGALIMPLGLSELINTYSIRGVMLIMAGVLFNFAVAAVLIPTHIIKINHGYKPVLIAIQDREKRSEGDIIKIGKWNVPIGNFAKKSKLKWPPRKLWRSVLLYSFGMTNSMNGFMLLCSLYGAFSRSLSITIQHSAYILIIQSSIDCATRIISGYLVDFKMISRWVLYCSSGFLLSIITILTGIFPSIPLFYFYLLSHAXXXXXXXXXXXXXXXXXXXXXYITATFSFYVFIQGTMSLFSFYAVGYFCDKTGHYEYAICLSGAILALGALCIVTEHIFRSMQSRNVTL 1384
            MKLVIVDSSKAWSVTIGCMIVNALMVGFIKIYSLIIIEYQDLLNAPMSLLMFGTSMLTSLTGLAAPLSAYLSERFTTMKTGIFASFLAVASIIMMAFSYNIYVQVTSAAFLGKFSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGSSIGALIMPLGLSELINTYSIRGVMLIMAGVLFNFAVAAVLIPTHIIKINHGYKPVLIAIQDREKRSEGDIIKIGKWNVPIGNFAKKSKLKWPPRKLWRSVLLYSFGMTNSMNGFMLLCSLYGAFSRSLSITIQHSAYILIIQSSIDCATRIISGYLVDFKMISRWVLYCSSGFLLSIITILTGIFPSIPLFYFYLLSHAILGGILMMLHLLILLDVVGVDYITATFSFYVFIQGTMSLFSFYAVGYFCDKTGHYEYAICLSGAILALGALCIVTEHIFRSMQSRNVTL
Sbjct:    1 MKLVIVDSSKAWSVTIGCMIVNALMVGFIKIYSLIIIEYQDLLNAPMSLLMFGTSMLTSLTGLAAPLSAYLSERFTTMKTGIFASFLAVASIIMMAFSYNIYVQVTSAAFLGKFSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGSSIGALIMPLGLSELINTYSIRGVMLIMAGVLFNFAVAAVLIPTHIIKINHGYKPVLIAIQDREKRSEGDIIKIGKWNVPIGNFAKKSKLKWPPRKLWRSVLLYSFGMTNSMNGFMLLCSLYGAFSRSLSITIQHSAYILIIQSSIDCATRIISGYLVDFKMISRWVLYCSSGFLLSIITILTGIFPSIPLFYFYLLSHAILGGILMMLHLLILLDVVGVDYITATFSFYVFIQGTMSLFSFYAVGYFCDKTGHYEYAICLSGAILALGALCIVTEHIFRSMQSRNVTL 438          
BLAST of slc16a-28 vs. TrEMBL
Match: A0A4Z2D142 (Monocarboxylate transporter 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_005764 PE=4 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 3.625e-16
Identity = 61/213 (28.64%), Postives = 108/213 (50.70%), Query Frame = 2
Query:   71 MKLVIVDSSKAWSVTIGCMIVNALMVGFIKIYSLIIIEYQDLLNAPMSLLMFGTSMLTSLTGLAAPLSAYLSERFTTMKTGIFASFLAVASIIMMAFSYNIYVQVTSAAFLGKFSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGSSIGALIMPLGLSELINTYSIRGVMLIMAGVLFNFAVAAVLIPTHIIKINHGYKPVLIAIQDRE 709
            M  V VD   AW   +G  + N L+ G  K YSL++  +Q++  +  + L     ++ +L    + ++  LS+R+ +    +  +F +  S+++ A S N+ + V +  F     +G S S IY    ++ G C  ++  L+ GI  AG S+G +I P  ++ L  TYS RG  ++MA +  +  V A L+P HII  +    PV++  +  E
Sbjct:    1 MSTVYVDRGMAWCTVVGGFVANLLLGGLGKSYSLVMEAFQEVFESGSAYLFLAGGLIYTLMYCLSLVNHLLSKRYGSRPVVMVGAFGSCISLLIAACSPNLALWVVAVGF----GVGASLSCIYFTVFAVVGCCFKRYLGLANGISVAGVSVGQMIFPSLITYLNTTYSARGGTVVMAAICLHLLVTAALMPRHIIDPD---APVVVPTEKAE 206          
BLAST of slc16a-28 vs. TrEMBL
Match: G7YEU6 (Monocarboxylate transporter 2 OS=Clonorchis sinensis OX=79923 GN=CLF_106233 PE=4 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 5.684e-16
Identity = 61/217 (28.11%), Postives = 111/217 (51.15%), Query Frame = 2
Query:   71 MKLVIVDSSKAWSVTIGCMIVNALMVGFIKIYSLIIIEYQDLLNAPMSLLMFGTSMLTSLTGLAAPLSAYLSERFTTMKTGIFASFLAVASIIMMAFSYNIYVQVTSAAFLGKFSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGSSIGALIMPLGLSELINTYSIRGVMLIMAGVLFNFAVAAVLIPTHIIKINHGYKPVLIAIQD--REKR 715
            MK V VDS +AW   IG  + N L+ G  K Y LI+  +Q++  +  +L M    ++ +L    + ++ Y+S+R+ +       +  +  S+++ AFS +I + V +        LG S S IY    S+ G+C  ++  L+ GI  AG S+G +  P  ++ L   Y  RG  +I++ +  +  + A L+P +I++ N   + V    +D  R++R
Sbjct:    1 MKTVYVDSPQAWCTVIGGFVANFLLGGLGKSYGLIMDAFQEVYQSGSALFMLAGGLIYTLMFCLSLVNHYISQRYGSRPVVFAGAIGSCLSLLVAAFSPSIGLWVLAVGV----GLGASLSCIYFTVFSVVGQCFRRYLGLANGISVAGVSVGQMAFPSLMTHLNEVYGTRGGAVIISALCLHLLITAALMPRYIVERNSSSEQVTKKQRDPARKRR 213          
BLAST of slc16a-28 vs. TrEMBL
Match: A0A419PSJ8 (Monocarboxylate transporter 1 OS=Clonorchis sinensis OX=79923 GN=SLC16A1 PE=4 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 8.571e-16
Identity = 61/217 (28.11%), Postives = 111/217 (51.15%), Query Frame = 2
Query:   71 MKLVIVDSSKAWSVTIGCMIVNALMVGFIKIYSLIIIEYQDLLNAPMSLLMFGTSMLTSLTGLAAPLSAYLSERFTTMKTGIFASFLAVASIIMMAFSYNIYVQVTSAAFLGKFSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGSSIGALIMPLGLSELINTYSIRGVMLIMAGVLFNFAVAAVLIPTHIIKINHGYKPVLIAIQD--REKR 715
            MK V VDS +AW   IG  + N L+ G  K Y LI+  +Q++  +  +L M    ++ +L    + ++ Y+S+R+ +       +  +  S+++ AFS +I + V +        LG S S IY    S+ G+C  ++  L+ GI  AG S+G +  P  ++ L   Y  RG  +I++ +  +  + A L+P +I++ N   + V    +D  R++R
Sbjct:   46 MKTVYVDSPQAWCTVIGGFVANFLLGGLGKSYGLIMDAFQEVYQSGSALFMLAGGLIYTLMFCLSLVNHYISQRYGSRPVVFAGAIGSCLSLLVAAFSPSIGLWVLAVGV----GLGASLSCIYFTVFSVVGQCFRRYLGLANGISVAGVSVGQMAFPSLMTHLNEVYGTRGGAVIISALCLHLLITAALMPRYIVERNSSSEQVTKKQRDPARKRR 258          
BLAST of slc16a-28 vs. TrEMBL
Match: A0A4S2JPW1 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_011287 PE=4 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 1.067e-15
Identity = 60/217 (27.65%), Postives = 110/217 (50.69%), Query Frame = 2
Query:   71 MKLVIVDSSKAWSVTIGCMIVNALMVGFIKIYSLIIIEYQDLLNAPMSLLMFGTSMLTSLTGLAAPLSAYLSERFTTMKTGIFASFLAVASIIMMAFSYNIYVQVTSAAFLGKFSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGSSIGALIMPLGLSELINTYSIRGVMLIMAGVLFNFAVAAVLIPTHIIKINHGYKPVLIAIQD--REKR 715
            MK V VDS +AW   IG  + N L+ G  K Y LI+  +Q++  +  +L M    ++ +L    + ++ Y+S+R+ +       +  +  S+++ AFS +I + V +        LG S S IY    S+ G+C  ++  L+ GI  AG S+G +  P  ++ L   Y  RG  +I++ +  +  + A L+P +I++     + V    +D  R++R
Sbjct:    1 MKTVYVDSPQAWCTVIGGFVANFLLGGLGKSYGLIMDAFQEVYQSGSALFMLAGGLIYTLMFCLSLVNHYISQRYGSRPVVFAGAIGSCLSLLVAAFSPSIGLWVVAVGV----GLGASLSCIYFTVFSVVGQCFRRYLGLANGISVAGVSVGQMAFPSLMTHLNEVYGTRGGAVIISALCLHLLITAALMPRYIVERGSSSEQVTKKQRDPARKRR 213          
BLAST of slc16a-28 vs. Ensembl Cavefish
Match: slc16a12b (solute carrier family 16 member 12 [Source:NCBI gene;Acc:111192338])

HSP 1 Score: 78.5666 bits (192), Expect = 2.731e-15
Identity = 76/339 (22.42%), Postives = 140/339 (41.30%), Query Frame = 2
Query:   89 DSSKAWSVTIGCMIVNALMVGFIKIYSLIIIEYQDLLNAPMSLLMFGTSMLTSLTGLAAPLSAYLSERFTTMKTGIFASFLAVASIIMMAFSYNIYVQVTSAAFLGKFSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGSSIGALIMPLGLSELINTYSIRGVMLIMAGVLFNFAVAAVLIPTHIIKINH----------GY--KPVLIAIQDREKRSEGDIIKIGKWNVPIGNFAKKSKLKWPPRKLWRSVLLYSFGMTNSMNGFMLL----------CSL----YGAFSRSLSITIQHSAYILIIQSSIDCATRIISGYLVDFKMISRWVLYC 1027
            D    W +  GC +V        +  S+  +E+Q       S   +  S++   T L APL + +    +     I   FLA   +++ +F+ ++     S   L     GL F++ Y P I++ G    + ++L+ GI  +GS IG  I+   +  LI  YS RG +LI+ G++ N  V   L+    +K             GY  KP++      EK+ E +               +  + +   ++  +S+  Y F +   M  F++L          CSL       ++  + ++  H+A+++ I   ID    I  G+L D + + ++   C
Sbjct:   15 DGGWGWMIVAGCFVVTVCTRAVTRCISIFFVEFQMHFARDYSGTAWIHSLVDCTTMLCAPLGSLIGNHLSCRVAVILGGFLASIGLVLSSFATSLEYLYLSLGVL----TGLGFALCYTPAIAMVGIYFCERKSLAYGIAMSGSGIGTFILAPVVQMLIEHYSWRGALLILGGLVSNLCVCGALLRPITLKEEEACPLPVDSECGYSTKPLVAISPAEEKQLEAE---------------RSKQQRDSKQRCLQSMQEYHFLL---MPDFLVLAGSFLFLASGCSLPFVYLVPYALDVGVSHHHAAFLMSILGVIDIVGNITFGWLTDRRCLKKYRGIC 331          
BLAST of slc16a-28 vs. Ensembl Cavefish
Match: slc16a12b (solute carrier family 16 member 12 [Source:NCBI gene;Acc:111192338])

HSP 1 Score: 78.1814 bits (191), Expect = 3.646e-15
Identity = 76/339 (22.42%), Postives = 140/339 (41.30%), Query Frame = 2
Query:   89 DSSKAWSVTIGCMIVNALMVGFIKIYSLIIIEYQDLLNAPMSLLMFGTSMLTSLTGLAAPLSAYLSERFTTMKTGIFASFLAVASIIMMAFSYNIYVQVTSAAFLGKFSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGSSIGALIMPLGLSELINTYSIRGVMLIMAGVLFNFAVAAVLIPTHIIKINH----------GY--KPVLIAIQDREKRSEGDIIKIGKWNVPIGNFAKKSKLKWPPRKLWRSVLLYSFGMTNSMNGFMLL----------CSL----YGAFSRSLSITIQHSAYILIIQSSIDCATRIISGYLVDFKMISRWVLYC 1027
            D    W +  GC +V        +  S+  +E+Q       S   +  S++   T L APL + +    +     I   FLA   +++ +F+ ++     S   L     GL F++ Y P I++ G    + ++L+ GI  +GS IG  I+   +  LI  YS RG +LI+ G++ N  V   L+    +K             GY  KP++      EK+ E +               +  + +   ++  +S+  Y F +   M  F++L          CSL       ++  + ++  H+A+++ I   ID    I  G+L D + + ++   C
Sbjct:   15 DGGWGWMIVAGCFVVTVCTRAVTRCISIFFVEFQMHFARDYSGTAWIHSLVDCTTMLCAPLGSLIGNHLSCRVAVILGGFLASIGLVLSSFATSLEYLYLSLGVL----TGLGFALCYTPAIAMVGIYFCERKSLAYGIAMSGSGIGTFILAPVVQMLIEHYSWRGALLILGGLVSNLCVCGALLRPITLKEEEACPLPVDSECGYSTKPLVAISPAEEKQLEAE---------------RSKQQRDSKQRCLQSMQEYHFLL---MPDFLVLAGSFLFLASGCSLPFVYLVPYALDVGVSHHHAAFLMSILGVIDIVGNITFGWLTDRRCLKKYRGIC 331          
BLAST of slc16a-28 vs. Ensembl Cavefish
Match: slc16a12b (solute carrier family 16 member 12 [Source:NCBI gene;Acc:111192338])

HSP 1 Score: 78.1814 bits (191), Expect = 4.108e-15
Identity = 76/339 (22.42%), Postives = 140/339 (41.30%), Query Frame = 2
Query:   89 DSSKAWSVTIGCMIVNALMVGFIKIYSLIIIEYQDLLNAPMSLLMFGTSMLTSLTGLAAPLSAYLSERFTTMKTGIFASFLAVASIIMMAFSYNIYVQVTSAAFLGKFSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGSSIGALIMPLGLSELINTYSIRGVMLIMAGVLFNFAVAAVLIPTHIIKINH----------GY--KPVLIAIQDREKRSEGDIIKIGKWNVPIGNFAKKSKLKWPPRKLWRSVLLYSFGMTNSMNGFMLL----------CSL----YGAFSRSLSITIQHSAYILIIQSSIDCATRIISGYLVDFKMISRWVLYC 1027
            D    W +  GC +V        +  S+  +E+Q       S   +  S++   T L APL + +    +     I   FLA   +++ +F+ ++     S   L     GL F++ Y P I++ G    + ++L+ GI  +GS IG  I+   +  LI  YS RG +LI+ G++ N  V   L+    +K             GY  KP++      EK+ E +               +  + +   ++  +S+  Y F +   M  F++L          CSL       ++  + ++  H+A+++ I   ID    I  G+L D + + ++   C
Sbjct:   15 DGGWGWMIVAGCFVVTVCTRAVTRCISIFFVEFQMHFARDYSGTAWIHSLVDCTTMLCAPLGSLIGNHLSCRVAVILGGFLASIGLVLSSFATSLEYLYLSLGVL----TGLGFALCYTPAIAMVGIYFCERKSLAYGIAMSGSGIGTFILAPVVQMLIEHYSWRGALLILGGLVSNLCVCGALLRPITLKEEEACPLPVDSECGYSTKPLVAISPAEEKQLEAE---------------RSKQQRDSKQRCLQSMQEYHFLL---MPDFLVLAGSFLFLASGCSLPFVYLVPYALDVGVSHHHAAFLMSILGVIDIVGNITFGWLTDRRCLKKYRGIC 331          
BLAST of slc16a-28 vs. Ensembl Cavefish
Match: slc16a12a (uncharacterized LOC103025054 [Source:NCBI gene;Acc:103025054])

HSP 1 Score: 68.1662 bits (165), Expect = 6.960e-12
Identity = 55/217 (25.35%), Postives = 94/217 (43.32%), Query Frame = 2
Query:   89 DSSKAWSVTIGCMIVNALMVGFIKIYSLIIIEYQDLLNAPMSLLMFGTSMLTSLTGLAAPLSAYLSERFTTMKTGIFASFLAVASIIMMAFSYNIYVQVTSAAFLGKFSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGSSIGALIMPLGLSELINTYSIRGVMLIMAGVLFNFAVAAVLI-PTHIIKINHGYKPVLIAIQDREKRSEGDIIK 736
            D    W +  GC I         +  S+  +E+Q   ++  S   +  S++   T L APL +Y+  RF+     +    L+   +I+ +F+ ++     S   L     GL F++ Y P +++ G    + + L+ GI  +GS IG  ++   +  LI  YS RG +LI+ G   +  V   L+ P +  + N          QD E R E    K
Sbjct:   13 DGGWGWMIVAGCFITTICTRAVTRCVSIFFLEFQMHFSSDYSRTAWIHSLVDCTTMLCAPLGSYIGNRFSCRVAVMVGGLLSSLGLILSSFASSLEYLYLSLGIL----TGLGFALCYTPAVAMVGSYFSERKALAYGIAMSGSGIGTFVLAPVVQLLIELYSWRGALLILGGFASHLCVCGALMRPLNRHRQN----------QDGEGREEEYCCK 215          
BLAST of slc16a-28 vs. Ensembl Cavefish
Match: slc16a5a (solute carrier family 16 member 5 [Source:NCBI gene;Acc:103035800])

HSP 1 Score: 62.3882 bits (150), Expect = 5.453e-10
Identity = 83/407 (20.39%), Postives = 165/407 (40.54%), Query Frame = 2
Query:   89 DSSKAWSVTIGCMIVNALMVGFIKIYSLIIIEYQDLLNAPMSLLMFGTSMLTSLTGLAAPLSAYLSERFTTMKTGIFASFLAVASIIMMAFSYNIYVQVTSAAFLGKFSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGSSIGALIMPLGLSELINTYSIRGVMLIMAGVLFNFAVAAVLIPTHIIKINHGYKPVLIAIQDREKRSEGDIIKIGKWNVPIGNFAKKSKLKWPPRKLWRSVLLYSFGMTNSMNGFMLLCSLYGAFSRSLSITIQHSAYILIIQSSIDCATRIISGYLVDFKMISRWVLYCSSGFLLSIITILTGIFPSI-------PLFYFYLLSHAXXXXXXXXXXXXXXXXXXXXXYITATFSFYVFIQGTMSLFSFYAVGYFCDKTGHYEY 1288
            D    W + +  ++V AL + F    S+   + Q   +A  S+  +  S++T++     PL + L ERF    T I    L+   +   AF+ +I     +A  +     GL F   + P ++I G+  ++ +  +  + + G+++G   +P   + L   +  RG  LI+ G+L N  V   L+           +P+  +     K+      K GK N+ +     +  + +      +   ++S G+T  M GF++       F+    +    +A +L +   ++   R   G L +        +Y     +LS+  +L G+   I       P+   Y+L + +   ++  L   +L+D+V ++   +       ++    L      G   DKTG Y Y
Sbjct:   40 DGGWGWVILVSSIVVLALTLAFPSCMSIFYTDLQKQFHASNSVTSWVPSIMTAVLHAGGPLCSVLVERFGCRATVIMGGVLSGIGMAASAFTNSIVELYITAGVI----TGLGFCFSFQPAVTILGQYFVRRRVFANAMSSTGTALGLSTLPTLSNYLHTEFGWRGSFLILGGMLLNCCVCGALM-----------RPLGPSKPKAHKQKANGPTKTGKENLKLLASCIRRHMAFDQFCNNQRYRVFSLGVTWMMLGFVVPLIFLVPFATDNGMDQNKAALLLNVLGFVNIIVRPAFGLLFNLAWFKGRHIY-----VLSVALLLNGLSNCICCFSATFPVLLVYMLCYGLTMSVVGTLLFTVLMDIVEMNRFLSALGLLAIMESVTLLIGPPLAGLLVDKTGEYTY 426          
BLAST of slc16a-28 vs. Ensembl Sea Lamprey
Match: SLC16A12 (solute carrier family 16 member 12 [Source:HGNC Symbol;Acc:HGNC:23094])

HSP 1 Score: 77.0258 bits (188), Expect = 2.044e-15
Identity = 59/210 (28.10%), Postives = 100/210 (47.62%), Query Frame = 2
Query:   89 DSSKAWSVTIGCMIVNALMVGFIKIYSLIIIEYQDLLNAPMSLLMFGTSMLTSLTGLAAPLSAYLSERF----TTMKTGIFASFLAVASIIMMAFSYNIYVQVTSAAFLGKFSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGSSIGALIMPLGLSELINTYSIRGVMLIMAGVLFNFAV-AAVLIPTHIIKINHGYKPVLIAIQD 703
            D    W V + C IVN       +  S+  +E+Q       +   +  SM+  LT L AP+ + LS  F    T M  G+F+S    A  IM +F+ +I +      FLG F+ G  FS+ Y P+I +  K   + + L+ G+  +GS +G  ++   +  L++ +S RG +L++   + N  V  A+L P H+    +  +  L+   D
Sbjct:    7 DGGWGWMVVLACFIVNVCTRAVTRCISIFFMEFQSHFQKDYATTAWINSMVDCLTMLCAPIGSLLSSHFGCRATVMAGGLFSS----AGFIMASFATSIEMLYV---FLGVFA-GFGFSLCYSPSIVMVTKYFRRRRALATGLAMSGSGVGTFLLAPLVQYLLDVFSWRGALLLLGAFVSNLCVCGALLRPIHLQYSCYAMRITLVGKTD 208          
BLAST of slc16a-28 vs. Ensembl Sea Lamprey
Match: SLC16A12 (solute carrier family 16 member 12 [Source:HGNC Symbol;Acc:HGNC:23094])

HSP 1 Score: 72.7886 bits (177), Expect = 3.960e-14
Identity = 55/218 (25.23%), Postives = 95/218 (43.58%), Query Frame = 2
Query:   89 DSSKAWSVTIGCMIVNALMVGFIKIYSLIIIEYQDLLNAPMSLLMFGTSMLTSLTGLAAPLSAYLSERFTTMKTGIFASFLAVASIIMMAFSYNIYVQVTSAAFLGKFSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGSSIGALIM-PLGLSELINTYSIRGVMLIMAGVLFNFAVAAVLIPTHIIKINHGYKPVLIAIQDREKRSEGDIIKI 739
            D    W V   C  V A      +   +  +E+Q   +   S   +  S++   T L AP+ + LS RF    T +F   ++ +  I+ +FS  I        FLG  + GL F++ Y P+I+I  +   +H+ L+ G+  +G+ +G  ++ P+    LI  Y+ RG +L++   +    V   L+           KP L+  Q  E     D  K+
Sbjct:   14 DGGWGWVVVCSCFTVTACTRAITRCIPIFFVEFQQHFSKDTSTTAWINSIMDCTTMLFAPIGSLLSTRFGCRATVMFGGLVSSSGFIIASFSPTIEFLYL---FLGLMA-GLGFALCYSPSIAIVSRYFQRHRLLATGLAMSGNGVGTFVLAPVVQQLLIEVYAWRGALLLLGAFVAQLCVCGALLRPLASPATPTAKPGLLGKQPAETAMPLDHYKL 227          
BLAST of slc16a-28 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009306.1 (pep scaffold:Pmarinus_7.0:GL482464:27972:31767:-1 gene:ENSPMAG00000008418.1 transcript:ENSPMAT00000009306.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.4698 bits (158), Expect = 6.433e-12
Identity = 70/323 (21.67%), Postives = 132/323 (40.87%), Query Frame = 2
Query:   89 DSSKAWSVTIGCMIVNALMVGFIKIYSLIIIEYQDLLNAPMSLLMFGTSMLTSLTGLAAPLSAYLSERFTTMKTGIFASFLAVASIIMMAFSYNIYVQVTSAAFLGKFSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGSSIG-ALIMPLGLSELINTYSIRGVMLIMAGVLFNFAVAAVLIPTHIIKINHGYKPVLIAIQD-----REKRSEGDIIKIGKWNVPIGNFAKKSKLKWPPRKLW-------RSVLLYSFGMTNSMNGFMLLCSLYGAFSRSLSITIQHSAYILIIQSSIDCATRIISGYLVDFKMISRWV 1018
            D    W+V +G  I       F K  ++   E Q++     S + + +S++ ++     P+S+ L  R+ +    +    LA   +++ +F  +I         +G F L ++      P ++I GK   K + ++ G+  AGS +  + + PL    L+N +  RG  +I+ G+L N  VA  L+    +K        L A +      R ++ +  + + G   V I     K       ++L        R  L+Y  G      GF         ++R + I    +A++L I + +D   R   G + +    SRW+
Sbjct:   15 DGGWGWAVVVGAFISIGFSYAFPKAITVFFSEIQEIFQTTYSEIAWISSIMLAIMYAGGPVSSILVNRYGSRPVVVAGGVLAGTGMVLASFCTSILQLYFCIGVIGGFGLAMNLQ----PALTIIGKYFYKKRPIANGLAMAGSPVMLSTLAPLN-QLLLNNFGWRGSFMILGGLLLNCCVAGALM--RPVKPPPSAPAALTATESATEIGRLRKQKHSVSRCGNSPVKINPHDTKEGFLQRFKELLDLTLFKHRGFLIYLSGNVVMFLGFFSPIVFLAPYARHMGIEKYSAAFLLTILAIVDMVCRPTCGLIAN----SRWI 326          
BLAST of slc16a-28 vs. Ensembl Sea Lamprey
Match: zgc:165507 (solute carrier family 16 member 7 [Source:HGNC Symbol;Acc:HGNC:10928])

HSP 1 Score: 65.0846 bits (157), Expect = 1.440e-11
Identity = 77/326 (23.62%), Postives = 132/326 (40.49%), Query Frame = 2
Query:   89 DSSKAWSVTIGCMIVNALMVGFIKIYSLIIIEYQDLLNAPMSLLMFGTSMLTSLTGLAAPLSAYLSERFTTMKTGIFASFLAVASIIMMAFSYNIYVQVTSAAFLGKFSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGSSIG-ALIMPLGLSELINTYSIRGVMLIMAGVLFNFAVAAVLI----PTHIIKI---------NHGYKPVLIAIQDREKRSEGDIIKIGKWNVPIGNFAKKSKLKWPPRKLWRSVLLYSFGMTNSMNGFMLLCSLYGAFSRSLSITIQHSAYILIIQSSIDCATRIISGYLVDFKMISRWVLY 1024
            D    W+V +G  I       F K  ++   + Q++ +   S + + +S++ ++     P+S+ L  ++ +    I    LA   +I  +F   I+        +G   LGL+F++   P ++I GK   K + ++ GI  AGS +G + I PL    LIN +  RG  LI+A +LFN  VA  L+    PT              N+   P+L       K   GD             F +   L        R  L+Y  G      GF         +++ + I    +A++L + + +D   R  +G L +   I   + Y
Sbjct:   15 DGGWGWAVVVGAFISIGFSYAFPKAITVFFKDIQEIFHTTYSEIAWISSIMLAVMYAGGPISSILVNKYGSRPIVIAGGILAGTGMIAASFCNTIFQLYFCIGVIG--GLGLAFNLQ--PALTIIGKYFYKKRPIANGISMAGSPVGLSTIAPLN-QVLINNFGWRGSFLILAALLFNCCVAGSLMRPVGPTPAKDARKKGKEEVPNNLENPLLATSNSEAKDKNGDSFS--------SRFMQLLDLTLFKH---RGFLIYLSGNVIMFFGFFAPVVFLAPYAKHMGIENYSAAFLLSVMAFVDMVARPTTGLLANHPRIRPKIQY 324          
BLAST of slc16a-28 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001631.1 (pep scaffold:Pmarinus_7.0:GL477961:12469:26731:1 gene:ENSPMAG00000001470.1 transcript:ENSPMAT00000001631.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.8322 bits (120), Expect = 3.616e-7
Identity = 41/185 (22.16%), Postives = 82/185 (44.32%), Query Frame = 2
Query:   89 DSSKAWSVTIGCMIVNALMVGFIKIYSLIIIEYQDLLNAPMSLLMFGTSMLTSLTGLAAPLSAYLSERFTTMKTGIFASFLAVASIIMMAFSYNIYVQVTSAAFLGKFSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGSSIGALIMPLGLSELINTYSIRGVMLIMAGVLFNFAVAAVLI 643
            D    W + +   +  +L+ G ++   +  IE+ +      + + + TS+   +   A+P+++ LS +F +    I     A    +  +F++ +     S   L  F   + FS    P+IS   K   K ++L+ GI  +G  + +         L+ TY+ RG ++I+AG+  N  V   L+
Sbjct:    9 DGGWGWLIVLAAFVQVSLVFGVVRSVGVFFIEFTEYFQESSTAISWITSIALCVHQFASPIASTLSNQFGSRSVVIVGGISACIGFLCASFAHCLLHLYLSLGLLTGFGWAMVFS----PSISTLSKYFDKRRSLALGIAFSGVGMSSFAFSPLFQMLVETYTWRGALMILAGLELNLCVCGALL 189          
BLAST of slc16a-28 vs. Ensembl Nematostella
Match: EDO46709 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPB5])

HSP 1 Score: 67.3958 bits (163), Expect = 2.854e-12
Identity = 73/327 (22.32%), Postives = 137/327 (41.90%), Query Frame = 2
Query:   86 VDSSKAWSVTIGCMIVNALMVGFIKIYSLIIIEYQDLLNAPMSLLMFGTSMLTSLTGLAAPLSAYLSERFTTMKTGIFASFLAVASIIMMAFSYNIYVQVTSAAFLG-KFSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGSSIGALIMPLGLSELINTYSIRGVMLIMAGVLFNFAVAAVLIPTHIIKINHGYKPVLIAIQDREKRSEGDIIKIGKWNVPIGNFAKKSKLKWPPRKLWRSVLLYSFGMTNSMNGFMLLCSLYGAFSRSLSITIQHSAYILIIQSSIDCATRIISGYLVDFKMISRWVLYCSSGFLLSIITIL 1063
            V+    W V  G  IVN ++ G    + ++ +   D L    +   +  +M   L  L  PL++ L  R++   T    + L+V  + + +F     VQ     +L      G+  S+ ++ +I I G+   K   L  GI T+GS +G+L+    ++ L+     +  M +++G      +AA L           +KP    +  R  +  G ++ +  W         K+ + W       +V L+ FG    +  F+ L      ++  L I+    A+++   S      R++ G L DF+ ++R  +Y  S F + + TIL
Sbjct:    3 VEGGWGWIVCAGTFIVNFIVFGIHNSFGVVYVNLLDELKLGKAETAWIGAMAMGLNFLCGPLTSILCTRYSCQATAFIGALLSVLGLFLTSF-----VQEPPKMYLTYGLLFGVGSSLSFVSSIVILGEYFQKRLALVNGIATSGSGVGSLVTGPVMNYLLANIGWQNCMRVLSGFAMLLWIAAFL-----------FKPNKRRVSTRPSKDAGKLVDLSIWR-------NKAYVTWV-----ITVALFQFGY---LFPFVHLIK----YAEELGISKSKGAWLIGFLSITSTIGRVLFGRLCDFQRVNRITVYQLSVFAIGVSTIL 294          
BLAST of slc16a-28 vs. Ensembl Nematostella
Match: EDO48615 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJ37])

HSP 1 Score: 55.4546 bits (132), Expect = 2.453e-8
Identity = 51/227 (22.47%), Postives = 99/227 (43.61%), Query Frame = 2
Query:   89 DSSKAWSVTIGCMIVNALMVGFIKIYSLIIIEYQDLLNAPMSLLMFGTSMLTSLTGLAAPLSAYLSERFTTMKTGIFASFLAVASIIMMAFSYNIYVQVTSAAFLGKFSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGSSIGALIMPLGLSELINTYSIRGVMLIMAGVLFNFAVAAVLIPTHIIKINHGYKPVLIAIQDREKRSEGDI----IKIGKWNVP 757
            DS+ +W V +     + L +     +++++       N       +  S+  S++   APLSA+   RF   +T I  +     S+I+ +F+  + +      F+     G+    I+   +  + K   K ++L+ GI+ AG+SIG LI P+    LI+    R    I+ G LF+ A   V + ++  K+  G +   ++ +   +R  G      +    W +P
Sbjct:   18 DSAWSWFVCLSATFADGLSLSLSNCFAIMLPVLIQEFNETRENAAWVGSIAYSMSYFCAPLSAWCCVRFGCRRTAIVGTLTCAVSLIISSFAPGLLMMY----FIYGALFGIGGGFIHTSGLLTTTKYFYKRRSLATGIVAAGASIGTLIGPV-YQALIDGVGWRNSYRII-GALFSIACILVWV-SYDPKVKDGQEDRTVSCEQGSQRRSGSCACPSLDCAVWRIP 237          
BLAST of slc16a-28 vs. Ensembl Nematostella
Match: EDO46850 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RP46])

HSP 1 Score: 52.373 bits (124), Expect = 2.012e-7
Identity = 38/181 (20.99%), Postives = 85/181 (46.96%), Query Frame = 2
Query:   89 DSSKAWSVTIGCMIVNALMVGFIKIYSLIIIEYQDLLNAPMSLLMFGTSMLTSLTGLAAPLSAYLSERFTTMKTGIFASFLAVASIIMMAFSYNI-YVQVTSAAFLGK-----FSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGSSIGALIMPLGLSELINTYSIRGVMLIMAGVL 613
            D + AW   +   + N+L  GF + + + +    ++ N       +  S+   LT L  P++A LS+RF+     + +  L  AS++  +F+ +I Y+  T     G       ++G + +  Y  +         ++++L+ G+I +G+ +G ++    L  +I+    R  + +M+G++
Sbjct:   11 DGAWAWLCCLSAAVCNSLHFGFTQSFGVFLPILAEVFNENREKTAWAGSIALFLTFLVGPVAALLSQRFSPRTVTLVSGLLCAASLLSTSFATSIVYIYFTYGVLFGTGAGCILNMGYAVARQYFTS---------RYRSLTTGVIASGAGVGVIMTGPILQAVIDAVGWRDTLRVMSGIM 182          
BLAST of slc16a-28 vs. Ensembl Nematostella
Match: EDO42483 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1C3])

HSP 1 Score: 50.8322 bits (120), Expect = 4.266e-7
Identity = 54/236 (22.88%), Postives = 105/236 (44.49%), Query Frame = 2
Query:   71 MKLVIVDSSKAWSV----TIGCMIVNALMVGFIKIYSLIIIEY--QDLLNAPMSLLMFGTSMLTSLTGLAAPLSAYLSERFTTMKTGIFASFLAVASIIMMAFSYNIYVQVTSAAFLGKFSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGSSIGALIMPLGLSELIN------TYSIRGVMLIMAGVL-FNFAVAAVLIPTHIIKINHGYKPVLIAIQDREKRSEGDIIKI 739
            M +  VDS ++W V    TI   +V+++++ F  I  ++I E+       A +  L +G    T L      L+A L +RF   +T IF +     +++  +++ +  +   + + L     GL  S +++P      K   +H+  + G++TAG + G L+M   L  L+N       Y I  V+ +++  L + F   A    TH   ++           +R+ R +  + +I
Sbjct:    1 MAVYRVDSGRSWGVCCCATIANGLVHSVVLSFGVILPVLIKEFGISKEQTALVGALAYGVGCFTGL------LAARLCDRFGLQRTHIFGTLTCAVALLSSSWATSNAILYFTYSVL----FGLGMSSVFMPCFLAVAKYFRRHRCSAVGMVTAGPAAGVLVMGPSLQALVNAVGWRHAYRILSVVFVLSCALSWPFREEAPDNETHDAMVHDKEGKNREQPANRKCRPDFTVCRI 226          
BLAST of slc16a-28 vs. Ensembl Nematostella
Match: EDO35238 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM28])

HSP 1 Score: 50.447 bits (119), Expect = 9.774e-7
Identity = 66/315 (20.95%), Postives = 129/315 (40.95%), Query Frame = 2
Query:   89 DSSKAWSVTIGCMIVNALMVGFIKIYSLIIIEYQDLLNAPMSLLMFGTSMLTSLTGLAAPLSAYLSERFTTMKTGIFASFLAVASIIMMAFSYNIYVQVTSAAFLGKFSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGSSIGALIMPLGLSELINTYSIRGVMLIMAGVLFNFA-VAAVLIPTHIIKINHGYKPVLIAIQDREKRSEGDIIKIGKWNVPIGNFAKKSKLKWPPRKLW--RSVLLYSFGMTNSMNGFMLLCSLYGAFSRSLSITIQHSAYILIIQSSIDCATRIISGYLVDFKMISRWVLY 1024
            D    W V +   I   +++G +  + +I +E         +   +  S+   +  L  PL   L ++     T +    +A    ++ + + NIY+   +   +     G+  S+ Y P++ I G    K  +L+ G+ +AGS +G+L M   L ++I    +R  M I A ++ +   V+A+  P +         P L A +   K  E +               KK  LK+    L+  ++ LL++  ++  M G+ +      + +    I I  +  ++ I S      R+I G + D   ++R  LY
Sbjct:   20 DGGWGWLVCLAAFITQFIVLGTMNNFGVIYVELLQEFKVGKAEAAWVGSITYGMMFLLGPLGTTLCKKIGCRLTTVVGCIIAAGGCLLGSVAPNIYIMDLTYGLM----FGVGASMCYFPSVIILGTYFNKRLSLANGLTSAGSGVGSLAMGPILQKVIEAVGMRNTMRISAAMISSIVLVSAIYRPIN--------TPFLNAAKYETKHQEAN--------------KKKGCLKFLDFSLFKNKAYLLWAASLSLWMLGYFVPFVHLISLATIQGIDIYMATLLIGIMSVGSTIGRLIFGKIADHPKVNRLYLY 308          
BLAST of slc16a-28 vs. Ensembl Medaka
Match: slc16a12a (monocarboxylate transporter 12-B-like [Source:NCBI gene;Acc:101175502])

HSP 1 Score: 79.7221 bits (195), Expect = 1.322e-15
Identity = 50/191 (26.18%), Postives = 92/191 (48.17%), Query Frame = 2
Query:  101 AWSVTIGCMIVNALMVGFIKIYSLIIIEYQDLLNAPMSLLMFGTSMLTSLTGLAAPLSAYLSERFTTMKTGIFASFLAVASIIMMAFSYNIYVQVTSAAFLGKFSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGSSIGALIMPLGLSELINTYSIRGVMLIMAGVLFNFAVAAVLI-PTHIIKINH 670
             W V  GC +    +    +  S+  +E+Q       S   +  S++ S T L APL ++L  R +   T +    L+ A +++ +F+ ++     S   +     GL F++ + P I+I GK  ++ + L+ GI  +GS IG  ++   +  LI  YS RG +LI+ G++ N  V   L+ P   +++  
Sbjct:   24 GWMVVAGCFLATICIRAVTRCVSMFFVEFQMHFEKDYSTTAWIHSLIDSTTMLCAPLGSFLGNRLSCRVTVMLGGLLSSAGLVLSSFASSVEFLYISLGVI----TGLGFALSFTPAIAIVGKYFVERKALAYGIALSGSGIGTFLLAPAVQLLIEHYSWRGALLILGGIVSNLCVCGALMRPLEDMEVQK 210          
BLAST of slc16a-28 vs. Ensembl Medaka
Match: ENSORLT00000025268.2 (solute carrier family 16 member 12 [Source:NCBI gene;Acc:101161384])

HSP 1 Score: 69.707 bits (169), Expect = 2.109e-12
Identity = 81/328 (24.70%), Postives = 141/328 (42.99%), Query Frame = 2
Query:   89 DSSKAWSVTIGCMIVNALMVGFIKIYSLIIIEYQDLLNAPMSLLMFGTSMLTSLTGLAAPLSAYLSERFTTMKTGIFASFLAVASIIMMAFSYNIYVQVTSAAFLGKFSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGSSIGALIMPLGLSELINTYSIRGVMLIMAGVLFNFAVAAVLI-PTHIIKINHGYKPVLIAIQDRE---KRSEGDIIKIGKWNVPIGNFAKKSKLKWPPRKLWRSVLLYSFGMTNSMNG----FMLL---CSL----YGAFSRSLSITIQHSAYILIIQSSIDCATRIISGYLVDFKMISRWVLYC 1027
            D    W +   C +V        +  S+  +E+Q    A  S   +  S++  +T L AP+ + +  R++     +    L+   +++ +FS ++ +   +   L     GL F++ Y P I++ G    + + L+ GI  +GS IG  ++   L  LI  YS RG +LIM+ V+ N  V   L+ P  + +         ++ QD E   K  +   + +    +P G     S  K   R+   S   YSF +     G    F+ L   CSL       ++ S  I+ QH+A+++ I   ID    I  G+L D + +    L C
Sbjct:   15 DGGWGWVIVGCCFMVTVCTRAVTRCISIFFVEFQGHFGAEYSATAWIHSLVDCITMLCAPVGSLVGNRWSCRVAVMLGGVLSSCGLLLSSFSTSLELLYLTMGVL----TGLGFALCYTPAIALVGCYFQQRKALAYGIAMSGSGIGTFVLAPVLQLLIELYSWRGALLIMSAVVANLCVCGALMRPITVQEQTEEATCGEVSSQDTELSIKPPKETEVGLLPLTLP-GEKPNPSPKK---RRFSFSRTEYSFLLQPDFLGLAVSFLFLASGCSLPFVYLVPYALSAGISHQHAAFLMSILGVIDIVGNITFGWLTDQRCLKPHRLSC 334          
BLAST of slc16a-28 vs. Ensembl Medaka
Match: si:dkey-246g23.4 (monocarboxylate transporter 2 [Source:NCBI gene;Acc:101159501])

HSP 1 Score: 68.9366 bits (167), Expect = 3.051e-12
Identity = 55/220 (25.00%), Postives = 99/220 (45.00%), Query Frame = 2
Query:   74 KLVIVDSSKAWSVTIGCMIVNALMVGFIKIYSLIIIEYQDLLNAPMSLLMFGTSMLTSLT----GLAAPLSAYLSERFTTMKTGIFASFLAVASIIMMAFSYNIYVQVTSAAFLGKFSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGSSIGALIMPLGLSELINTYSIRGVMLIMAGVLFNFAVAAVLIPTHIIKINHGYKPVLIAIQDREKRSE 721
            + V  D   AW + + C  V  L  G +K + +  +E Q       +    GTS +TS+      +AAPL++ LS R++     I    +     I+ +F  N+     +  FL     G  +++ + PT+++ G    K + ++  + +AG  I   I+      LIN++S RG +LIM  +  N  V  +L+           +P L + +D+E  +E
Sbjct:   16 RAVAPDGGYAWFILVSCFFVFGLTFGVVKSFGVFYVEIQQYFGTTAA----GTSWITSIAVATIHVAAPLASALSSRYSHRSVVIAGGLICSVGAILGSFGNNLVQLYLTVGFLN----GFGYALTWTPTVTMLGMYFDKRRPVANALASAGECILTFILTPMFQLLINSFSWRGALLIMGALQLNLCVCGLLL-----------RP-LKSTRDKELYTE 215          
BLAST of slc16a-28 vs. Ensembl Medaka
Match: si:dkey-246g23.4 (monocarboxylate transporter 2 [Source:NCBI gene;Acc:101159501])

HSP 1 Score: 67.781 bits (164), Expect = 9.378e-12
Identity = 50/194 (25.77%), Postives = 89/194 (45.88%), Query Frame = 2
Query:   74 KLVIVDSSKAWSVTIGCMIVNALMVGFIKIYSLIIIEYQDLLNAPMSLLMFGTSMLTSLT----GLAAPLSAYLSERFTTMKTGIFASFLAVASIIMMAFSYNIYVQVTSAAFLGKFSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGSSIGALIMPLGLSELINTYSIRGVMLIMAGVLFNFAVAAVLI 643
            + V  D   AW + + C  V  L  G +K + +  +E Q       +    GTS +TS+      +AAPL++ LS R++     I    +     I+ +F  N+     +  FL     G  +++ + PT+++ G    K + ++  + +AG  I   I+      LIN++S RG +LIM  +  N  V  +L+
Sbjct:   16 RAVAPDGGYAWFILVSCFFVFGLTFGVVKSFGVFYVEIQQYFGTTAA----GTSWITSIAVATIHVAAPLASALSSRYSHRSVVIAGGLICSVGAILGSFGNNLVQLYLTVGFLN----GFGYALTWTPTVTMLGMYFDKRRPVANALASAGECILTFILTPMFQLLINSFSWRGALLIMGALQLNLCVCGLLL 201          
BLAST of slc16a-28 vs. Ensembl Medaka
Match: zgc:165507 (solute carrier family 16 member 7 [Source:NCBI gene;Acc:101155977])

HSP 1 Score: 59.3066 bits (142), Expect = 4.837e-9
Identity = 74/316 (23.42%), Postives = 130/316 (41.14%), Query Frame = 2
Query:   89 DSSKAWSVTIGCMIVNALMVGFIKIYSLIIIEYQDLLNAPMSLLMFGTSMLTSLTGLAAPLSAYLSERFTTMKTGIFASFLAVASIIMMAFSYNIYVQVTSAAFLGKFSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGSSIG-ALIMPLGLSELINTYSIRGVMLIMAGVLFNFAVAAVLI-----PTHIIKINHGYKPVLIAIQDREKRSEGDIIKIGKWNVPIGNFAKKSKLKWPPRKLWRSVLLYSFGMTNSMNGFMLLCSLYGAFSRSLSITIQHSAYILIIQSSIDCATRIISGYLVDFKMISRWV 1018
            D    W+V +   I       F K  ++   E Q + +A  S + + +S++ ++   A P+S+ L   +      +    L    +I  +F  N+         +G   LGL+F++   P +++ G+   K + ++ G+  AGS +  + + PL    L N +  RG  LI+ G+L N  VA  L+     P    K +    P  IA   +EKRS         W   +  +   +  K       R  L+Y  G      GF        A+++ + +    +A++L I + +D   R   G L +    SRWV
Sbjct:   15 DGGWGWAVVLASFISIGFSYAFPKAITVFFKEIQIIFDASYSQIAWISSIMLAVMYAAGPISSILVNTYGCRPIVMMGGCLCAVGMISASFCTNVLQLYMCIGVIG--GLGLAFNLQ--PALTMIGRYFFKKRPIANGLAMAGSPVFLSTLAPLN-QYLFNRFGWRGSFLILGGLLLNCCVAGSLMRPLGPPPGKAKKDEALTP--IATTTKEKRS--------LWKT-VNKYLDLTLFKH------RGFLIYLSGNVIMFLGFFAPIVFLTAYAKDMGVDEYSAAFLLSILAFVDMFARPSMGLLAN----SRWV 304          
BLAST of slc16a-28 vs. Planmine SMEST
Match: SMESG000056616.1 (SMESG000056616.1)

HSP 1 Score: 327.02 bits (837), Expect = 1.175e-111
Identity = 159/160 (99.38%), Postives = 159/160 (99.38%), Query Frame = 2
Query:  539 MPLGLSELINTYSIRGVMLIMAGVLFNFAVAAVLIPTHIIKINHGYKPVLIAIQDREKRSEGDIIKIGKWNVPIGNFAKKSKLKWPPRKLWRSVLLYSFGMTNSMNGFMLLCSLYGAFSRSLSITIQHSAYILIIQSSIDCATRIISGYLVDFKMISRWV 1018
            MPLGLSELINTYSIRGVMLIMAGVLFNFAVAAVLIPTHIIKINHGYKPVLIAIQDREKRSEGDIIKIGKWNVPIGNFAKKSKLKWPPRKLWRSVLLYSFGMTNSMNGFMLLCSLYGAFSRSLSITIQHSAYILIIQSSIDCATRIISGYLVDFKMISR V
Sbjct:    1 MPLGLSELINTYSIRGVMLIMAGVLFNFAVAAVLIPTHIIKINHGYKPVLIAIQDREKRSEGDIIKIGKWNVPIGNFAKKSKLKWPPRKLWRSVLLYSFGMTNSMNGFMLLCSLYGAFSRSLSITIQHSAYILIIQSSIDCATRIISGYLVDFKMISRLV 160          
BLAST of slc16a-28 vs. Planmine SMEST
Match: SMESG000006948.1 (SMESG000006948.1)

HSP 1 Score: 58.5362 bits (140), Expect = 6.438e-9
Identity = 48/183 (26.23%), Postives = 79/183 (43.17%), Query Frame = 2
Query:  101 AWSVTIGCMIVNALMVGFIKIYSLIIIEYQDLLNAPMSLLMFGTSMLTSLTGLAAPLSAYLSERFTTMKTGIFASFLAVASIIMMAFSYNIYVQVTSAAFLGKFSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGSSIGALIMPLGLSELINTYSIRGVMLIMAGVLFN-FAVAAVLIP 646
             W V     +V+ L  G    + ++  E+     A    + +  S+L  +T  A PL++ L  +F      I  SF++        F    +    SA+ +     GL F ++Y+P+I        + +  + G+   GS IG  +    +  LI TY  RG MLI+ G++FN  A  AV  P
Sbjct:   41 GWVVVFASFMVHVLADGVTYSFGVLTTEFISHFGASREAVGWMASILVGMTLSAGPLASILCNKFGFRTVTIIGSFISAIGFCAPFFYPEFWFLYFSASVIS----GLGFGLVYLPSIVTVSIYFKRKRAFAIGLAVCGSGIGTFVFSPLIEYLIETYGWRGTMLIVGGLIFNCLACGAVYRP 219          
BLAST of slc16a-28 vs. Planmine SMEST
Match: SMESG000023545.1 (SMESG000023545.1)

HSP 1 Score: 55.4546 bits (132), Expect = 2.345e-8
Identity = 50/212 (23.58%), Postives = 99/212 (46.70%), Query Frame = 2
Query:   89 DSSKAWSVTIGCMIVNALMVGFIKIYSLIIIEYQDLLNAPMSLLMFGTSMLTSLTG----LAAPLSAYLSERFTTMKTGIFASFLAVASIIMMAFSYNIYVQVTSAAFLGKFSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGSSIGALIMPLGLSELINTYSIRGVMLIMAGVLFNFAVAAVLIPTHIIKINHGYKPVLIAIQDREK 712
            D    W V       N +  G    +S  II Y+ + N   S   F TS+ T L      L  P++++L+E+++     I   ++      +  F+ +      + + +    +GLSF  +YIP+I +  +   K +  + GI  +GS +GA++    +  L + Y+++G +LI++G++ +  V  +L           +KP+ I++ D +K
Sbjct:   33 DGGYGWIVVFAAFCNNMVADGLT--FSFGIIFYELMKNHDES--HFKTSLFTCLFNGIPLLFGPVTSFLTEKYSCRLIAILGGYITHLGFFLSFFTTSFSTLFLTLSIIA--PIGLSF--VYIPSIVMVSRYFDKKRAFATGIAVSGSGVGAIVFSPLIEFLCSNYTLKGALLILSGIILHVCVFGLL-----------FKPITISVIDEQK 225          
BLAST of slc16a-28 vs. Planmine SMEST
Match: SMESG000023545.1 (SMESG000023545.1)

HSP 1 Score: 55.4546 bits (132), Expect = 2.367e-8
Identity = 50/212 (23.58%), Postives = 99/212 (46.70%), Query Frame = 2
Query:   89 DSSKAWSVTIGCMIVNALMVGFIKIYSLIIIEYQDLLNAPMSLLMFGTSMLTSLTG----LAAPLSAYLSERFTTMKTGIFASFLAVASIIMMAFSYNIYVQVTSAAFLGKFSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGSSIGALIMPLGLSELINTYSIRGVMLIMAGVLFNFAVAAVLIPTHIIKINHGYKPVLIAIQDREK 712
            D    W V       N +  G    +S  II Y+ + N   S   F TS+ T L      L  P++++L+E+++     I   ++      +  F+ +      + + +    +GLSF  +YIP+I +  +   K +  + GI  +GS +GA++    +  L + Y+++G +LI++G++ +  V  +L           +KP+ I++ D +K
Sbjct:   34 DGGYGWIVVFAAFCNNMVADGLT--FSFGIIFYELMKNHDES--HFKTSLFTCLFNGIPLLFGPVTSFLTEKYSCRLIAILGGYITHLGFFLSFFTTSFSTLFLTLSIIA--PIGLSF--VYIPSIVMVSRYFDKKRAFATGIAVSGSGVGAIVFSPLIEFLCSNYTLKGALLILSGIILHVCVFGLL-----------FKPITISVIDEQK 226          
BLAST of slc16a-28 vs. Planmine SMEST
Match: SMESG000004625.1 (SMESG000004625.1)

HSP 1 Score: 56.225 bits (134), Expect = 2.954e-8
Identity = 73/331 (22.05%), Postives = 140/331 (42.30%), Query Frame = 2
Query:  149 GFIKIYSLIIIEYQDLLNAPMSLLMFGTSMLTSLTGLAAPLSAYLSERFTTMKTGIFASFLAVASIIMMAFSYNIYVQVTSAAFLGKFSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGSSIGALIMPLGLSELINTYSIRGVMLIMAGVLFNFAVAAVLIPTHIIKINHGYKPVLIAIQDR--EKRSEGDIIKIGKWNVPIGNFAKKSKLKWPPRKLWRS---------VLLYSFGMTNSMNGFMLLCSLYGAFSRSLSITIQHSAYILIIQSSIDCATRIISGYLVDFKMISRWVLYCSSGFLLSIITILTGIFPSIPLFYFYLL 1108
            G  K + +I+   Q+LL + ++ L     ++ +     +P++  L ++F         S   V S I   F+ N+ + V +        +G+S   IY P   + G+C      ++ G+  AG SIG +  P  ++ LI+ Y++RG  L+ AG+  +F V A L+P +I +     +       +R  +  S+ +I K+    +  G      KLK      ++          ++   F     + G       YG   +SL ++ Q  +  + +   +D  +R++ G + D +   R  L  ++ +LL   T     F   P +Y Y +
Sbjct:   16 GLAKSFGIIMGSTQELLYSSIAPLTLAGGLIYTFMYCLSPITILLCQKFGYRLMINIGSAGCVLSFICAYFATNVIMWVIAIGG----GIGISLGFIYSPIFVMVGRCFRNRVGIAMGLSVAGVSIGQIAFPSIITVLIDKYTVRGAYLVGAGIACHFFVTAALMPLYIEEEEVMKRNNKNTCNNRIEKDSSDKEIEKVPLQEMENGKVNHNEKLKEKKPSTYKRIHVVMLVIYIIAKVFADVGDV-GIAFALPPYG--EKSLEMSNQDISNAIAVAGCVDLISRVVIGMVSD-QPWCRRSLILNAAWLLEAFTAF--FFVWFPSYYSYFI 336          
The following BLAST results are available for this feature:
BLAST of slc16a-28 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC16A124.948e-1423.58solute carrier family 16 member 12 [Source:HGNC Sy... [more]
SLC16A52.865e-1025.95solute carrier family 16 member 5 [Source:HGNC Sym... [more]
SLC16A59.763e-1025.95solute carrier family 16 member 5 [Source:HGNC Sym... [more]
SLC16A59.763e-1025.95solute carrier family 16 member 5 [Source:HGNC Sym... [more]
SLC16A59.763e-1025.95solute carrier family 16 member 5 [Source:HGNC Sym... [more]
back to top
BLAST of slc16a-28 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc16a-28 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hrm1.380e-1125.78gene:FBgn0033028 transcript:FBtr0086072[more]
hrm1.380e-1125.78gene:FBgn0033028 transcript:FBtr0345359[more]
Sln2.745e-724.06gene:FBgn0033657 transcript:FBtr0088032[more]
kar4.932e-725.82gene:FBgn0001296 transcript:FBtr0082666[more]
kar5.611e-726.20gene:FBgn0001296 transcript:FBtr0302563[more]
back to top
BLAST of slc16a-28 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc16a12b6.500e-1624.54solute carrier family 16 member 12b [Source:NCBI g... [more]
SLC16A71.139e-923.45zgc:165507 [Source:ZFIN;Acc:ZDB-GENE-070620-11][more]
BX511087.32.786e-922.22solute carrier family 16 member 12a [Source:NCBI g... [more]
BX511087.31.589e-824.19solute carrier family 16 member 12a [Source:NCBI g... [more]
slc16a12a2.007e-825.79solute carrier family 16 member 12a [Source:ZFIN;A... [more]
back to top
BLAST of slc16a-28 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc16a128.865e-1723.66solute carrier family 16 member 12 [Source:NCBI ge... [more]
SLC16A51.512e-1424.01solute carrier family 16 (monocarboxylate transpor... [more]
slc16a74.077e-1024.13solute carrier family 16 member 7 [Source:NCBI gen... [more]
slc16a71.407e-924.13solute carrier family 16 member 7 [Source:NCBI gen... [more]
mad2l14.070e-822.56mitotic arrest deficient 2 like 1 [Source:Xenbase;... [more]
back to top
BLAST of slc16a-28 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Slc16a126.605e-1621.09solute carrier family 16 (monocarboxylic acid tran... [more]
Slc16a52.848e-724.73solute carrier family 16 (monocarboxylic acid tran... [more]
Slc16a91.568e-621.46solute carrier family 16 (monocarboxylic acid tran... [more]
Slc16a145.384e-619.55solute carrier family 16 (monocarboxylic acid tran... [more]
back to top
BLAST of slc16a-28 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6P2X9|MOT12_XENTR5.402e-1623.36Monocarboxylate transporter 12 OS=Xenopus tropical... [more]
sp|Q8BGC3|MOT12_MOUSE4.620e-1521.09Monocarboxylate transporter 12 OS=Mus musculus OX=... [more]
sp|Q503M4|MT12B_DANRE4.685e-1524.54Monocarboxylate transporter 12-B OS=Danio rerio OX... [more]
sp|Q6GM59|MOT12_XENLA7.738e-1523.84Monocarboxylate transporter 12 OS=Xenopus laevis O... [more]
sp|Q6ZSM3|MOT12_HUMAN2.376e-1323.58Monocarboxylate transporter 12 OS=Homo sapiens OX=... [more]
back to top
BLAST of slc16a-28 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YK780.000e+0100.00Slc16a-28 OS=Schmidtea mediterranea OX=79327 GN=sl... [more]
A0A4Z2D1423.625e-1628.64Monocarboxylate transporter 2 OS=Schistosoma japon... [more]
G7YEU65.684e-1628.11Monocarboxylate transporter 2 OS=Clonorchis sinens... [more]
A0A419PSJ88.571e-1628.11Monocarboxylate transporter 1 OS=Clonorchis sinens... [more]
A0A4S2JPW11.067e-1527.65Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of slc16a-28 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc16a12b2.731e-1522.42solute carrier family 16 member 12 [Source:NCBI ge... [more]
slc16a12b3.646e-1522.42solute carrier family 16 member 12 [Source:NCBI ge... [more]
slc16a12b4.108e-1522.42solute carrier family 16 member 12 [Source:NCBI ge... [more]
slc16a12a6.960e-1225.35uncharacterized LOC103025054 [Source:NCBI gene;Acc... [more]
slc16a5a5.453e-1020.39solute carrier family 16 member 5 [Source:NCBI gen... [more]
back to top
BLAST of slc16a-28 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC16A122.044e-1528.10solute carrier family 16 member 12 [Source:HGNC Sy... [more]
SLC16A123.960e-1425.23solute carrier family 16 member 12 [Source:HGNC Sy... [more]
ENSPMAT00000009306.16.433e-1221.67pep scaffold:Pmarinus_7.0:GL482464:27972:31767:-1 ... [more]
zgc:1655071.440e-1123.62solute carrier family 16 member 7 [Source:HGNC Sym... [more]
ENSPMAT00000001631.13.616e-722.16pep scaffold:Pmarinus_7.0:GL477961:12469:26731:1 g... [more]
back to top
BLAST of slc16a-28 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc16a-28 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO467092.854e-1222.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO486152.453e-822.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO468502.012e-720.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO424834.266e-722.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352389.774e-720.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc16a-28 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc16a12a1.322e-1526.18monocarboxylate transporter 12-B-like [Source:NCBI... [more]
ENSORLT00000025268.22.109e-1224.70solute carrier family 16 member 12 [Source:NCBI ge... [more]
si:dkey-246g23.43.051e-1225.00monocarboxylate transporter 2 [Source:NCBI gene;Ac... [more]
si:dkey-246g23.49.378e-1225.77monocarboxylate transporter 2 [Source:NCBI gene;Ac... [more]
zgc:1655074.837e-923.42solute carrier family 16 member 7 [Source:NCBI gen... [more]
back to top
BLAST of slc16a-28 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000056616.11.175e-11199.38SMESG000056616.1[more]
SMESG000006948.16.438e-926.23SMESG000006948.1[more]
SMESG000023545.12.345e-823.58SMESG000023545.1[more]
SMESG000023545.12.367e-823.58SMESG000023545.1[more]
SMESG000004625.12.954e-822.05SMESG000004625.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30032143
GenBankAKN21523.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032143 ID=SMED30032143|Name=slc16a-28|organism=Schmidtea mediterranea sexual|type=transcript|length=1435bp
AAATCACCCAATCATATCATATATCTATTGTTAAGTATACTGTTAAACTA
TGTAACACTGTATCTTTGAAATGAAATTGGTGATAGTCGATTCTTCTAAA
GCATGGAGTGTCACGATAGGATGCATGATAGTAAATGCCCTAATGGTTGG
CTTCATAAAAATATATTCCTTGATTATTATTGAATATCAAGATTTATTGA
ATGCCCCAATGTCGCTTTTAATGTTTGGAACAAGTATGCTAACGTCTTTA
ACCGGATTAGCAGCCCCGCTATCTGCTTATTTATCCGAAAGATTTACAAC
TATGAAAACTGGGATTTTTGCATCATTCCTAGCGGTAGCTTCAATAATAA
TGATGGCATTTTCTTACAATATTTATGTCCAAGTGACATCTGCAGCATTT
CTCGGTAAATTCTCACTGGGCCTTTCATTTTCAATTATATATATTCCAAC
AATAAGTATTTCAGGAAAATGTCACATTAAACATCAGAACCTATCTCAGG
GAATAATAACAGCAGGTTCATCAATTGGAGCATTAATAATGCCCTTAGGT
TTGTCAGAATTAATTAATACTTATTCTATTCGTGGAGTAATGCTAATAAT
GGCTGGCGTACTTTTCAATTTTGCAGTTGCTGCAGTTTTAATTCCGACTC
ATATTATAAAAATTAACCATGGGTACAAGCCAGTTCTGATAGCGATTCAA
GATAGAGAAAAAAGATCAGAAGGAGATATAATAAAAATAGGAAAATGGAA
TGTTCCAATTGGTAATTTTGCGAAAAAGTCAAAACTAAAATGGCCACCTC
GTAAGTTATGGAGATCAGTATTATTGTATTCCTTTGGAATGACAAACTCC
ATGAATGGATTCATGCTTTTATGTAGTTTATATGGTGCCTTTTCCAGATC
TCTATCTATAACTATTCAACATTCAGCTTACATCCTGATTATTCAATCAT
CAATTGATTGTGCTACGAGAATTATATCGGGATATTTGGTTGATTTTAAA
ATGATTTCTAGATGGGTTTTATATTGCTCCAGTGGCTTTCTTTTGAGTAT
TATAACTATTCTAACAGGAATATTTCCGTCAATTCCATTATTCTATTTTT
ATTTGCTTTCTCATGCAATTCTTGGAGGAATTTTGATGATGCTACATCTT
CTTATTTTGCTAGATGTTGTTGGAGTCGATTATATTACTGCAACTTTTTC
TTTTTACGTTTTTATTCAAGGAACAATGTCTCTATTTAGTTTCTATGCTG
TCGGTTATTTTTGTGACAAAACTGGTCATTACGAATATGCTATATGCCTT
TCAGGCGCTATTTTAGCACTTGGAGCACTCTGTATCGTTACTGAACATAT
TTTTCGATCGATGCAGTCCAGAAACGTTACTTTATAAAAAGATTTATCCT
ATTGTTTTTATATAATTTAATTTTAATAAACGAGA
back to top

protein sequence of SMED30032143-orf-1

>SMED30032143-orf-1 ID=SMED30032143-orf-1|Name=SMED30032143-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=439bp
MKLVIVDSSKAWSVTIGCMIVNALMVGFIKIYSLIIIEYQDLLNAPMSLL
MFGTSMLTSLTGLAAPLSAYLSERFTTMKTGIFASFLAVASIIMMAFSYN
IYVQVTSAAFLGKFSLGLSFSIIYIPTISISGKCHIKHQNLSQGIITAGS
SIGALIMPLGLSELINTYSIRGVMLIMAGVLFNFAVAAVLIPTHIIKINH
GYKPVLIAIQDREKRSEGDIIKIGKWNVPIGNFAKKSKLKWPPRKLWRSV
LLYSFGMTNSMNGFMLLCSLYGAFSRSLSITIQHSAYILIIQSSIDCATR
IISGYLVDFKMISRWVLYCSSGFLLSIITILTGIFPSIPLFYFYLLSHAI
LGGILMMLHLLILLDVVGVDYITATFSFYVFIQGTMSLFSFYAVGYFCDK
TGHYEYAICLSGAILALGALCIVTEHIFRSMQSRNVTL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR011701MFS
IPR020846MFS_dom
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011701Major facilitator superfamilyPFAMPF07690MFS_1coord: 24..389
e-value: 1.1E-11
score: 44.3
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 5..194
e-value: 1.0E-9
score: 40.0
coord: 243..427
e-value: 1.1E-6
score: 30.0
NoneNo IPR availablePANTHERPTHR11360MONOCARBOXYLATE TRANSPORTERcoord: 11..423
NoneNo IPR availableCDDcd17352MFS_MCT_SLC16coord: 11..425
e-value: 2.80465E-29
score: 115.342
NoneNo IPR availableTMHMMTMhelixcoord: 81..103
NoneNo IPR availableTMHMMTMhelixcoord: 250..272
NoneNo IPR availableTMHMMTMhelixcoord: 49..71
NoneNo IPR availableTMHMMTMhelixcoord: 174..196
NoneNo IPR availableTMHMMTMhelixcoord: 311..333
NoneNo IPR availableTMHMMTMhelixcoord: 406..428
NoneNo IPR availableTMHMMTMhelixcoord: 15..37
NoneNo IPR availableTMHMMTMhelixcoord: 285..307
NoneNo IPR availableTMHMMTMhelixcoord: 108..130
NoneNo IPR availableTMHMMTMhelixcoord: 372..394
NoneNo IPR availableTMHMMTMhelixcoord: 145..167
NoneNo IPR availableTMHMMTMhelixcoord: 340..362
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 8..423