SMED30032138

Overview
NameSMED30032138
Smed IDSMED30032138
Length (bp)1159
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30032138 (SMED30032138) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30032138 (SMED30032138) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30032138 (SMED30032138) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30032138 (SMED30032138) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032138

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
muscle cellSMED30032138h1SMcG0004690 dd_Smed_v4_36108_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30032138 vs. TrEMBL
Match: A0A267FSD8 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig025013g6 PE=4 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 1.385e-32
Identity = 115/332 (34.64%), Postives = 171/332 (51.51%), Query Frame = -2
Query:  145 NYETDIITLVSYKIKITVSLFGFVLNLWAFSFFHRFEKQSHFCFMLKHLSLVELIFSLSGVVFECFYFTLVVLQR---PFPKVLV--NFIIYFVFNFMWLMYKSSLLSRNWVIVLIAWRRYQAIHRPXXXXXXXXXXXXXXXIFGIYAISLFLVTPRLFEITYSYSNETKNVI-ITPYLLVNSIYLSTYPILFFILISPVPVCVICFYSIFMLRSLRK----------PECHELETRSDHFQRQNPTXXXXXXXXXXXXNKXXXXXXXXXXXCEFPMCLAGIFNQISRESTGVQFQWFLTHFAGVANILTSCDSIFNFVIYFISFPFFKQSI 1092
            N  T ++    Y IK   ++ G ++NL +   F  F+++S F  M+ +LS  E+ F+  G+ FE FY  +        P    L    F+IY V   +W++YKSSL+ RNW+IVLIAWRRY+AI   LSS++  S++  +  +  I  ++  L TPR FE+ Y    E++ ++ + P    +S   S YP LFF+L SP+P+  +   S  M  SLR           P  + + +  D  +  N T  R       + N+TVLVLC  F  CE PM +AGI          ++       F+GVAN LTS DS  NFV+Y +S P F+  +
Sbjct:   34 NGPTQVMLDSLYFIKCIAAMIGLMVNLVSIKVFLSFKRRSLFISMIFYLSCCEVCFNSCGLSFELFYLLVGSTNSHLMPIGSSLAVAQFLIYLVCQVVWIIYKSSLILRNWIIVLIAWRRYRAISASLSSQRSQSRRSFRLSLLLIGLLAALLTTPRAFELAYFLCAESRQIVRLAPAAFAHSRRYSAYPKLFFVLTSPMPIVCLLVISTLMTCSLRAAANTANVLQVPISNSVSSTRDR-ESTNSTSMRHRRSQSDAVNRTVLVLCGSFVLCELPMLIAGIIKDFECGDHCMKVHV----FSGVANTLTSMDSFANFVVYVVSIPSFRNKL 360          
BLAST of SMED30032138 vs. TrEMBL
Match: A0A1I8HVZ0 (Phosphodiesterase OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 5.578e-15
Identity = 74/232 (31.90%), Postives = 111/232 (47.84%), Query Frame = -2
Query:  145 YFVFNFMWLMYKSSLLSRNWVIVLIAWRRYQAIHRPXXXXXXXXXXXXXXXIFGIYAI-SLFLVTPRLFEITYSYSNETKNVI-ITPYLLVNSIYLSTYPILFFILISPVPVCVICFYSIFMLRSLRKPECHELETRSDHFQRQNPTXXXXXXXXXXXXNKXXXXXXXXXXXCEFPMCLAGIFNQISRESTGVQFQWFLTHFAGVANILTSCDSIFNFVIYFISFPFFKQSI 834
            Y +   +W++YK+SL+ RNW+IV+IAWRRY+AI   L+  +    +    L      + +  L  PR  E+ Y    E++ ++ +      +S   S YP +FF+  SP+P+  +   S  ML SLR        T +        +          S N+TV VLC  F  CE PM +AG+             Q F+    G+ANILTS DS+ NF +YF S   F+  +
Sbjct:    1 YLLCQAVWVVYKASLILRNWIIVVIAWRRYRAIRASLNGYRSGPGRRSLRLSLLCLGVLAALLTAPRSLEVAYYLCVESRQLVRVAVAGFASSRGYSVYPKIFFVATSPLPIVCLLVISFLMLCSLRN------STDAQLLHGGGGSGGSGSGGRCDSVNRTVQVLCATFVLCELPMLVAGVVKDADCNEHCPHLQVFM----GIANILTSLDSLANFGVYFFSIRAFRHKL 222          
BLAST of SMED30032138 vs. TrEMBL
Match: A0A3S5ANT6 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS27551 PE=4 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 1.271e-11
Identity = 40/85 (47.06%), Postives = 51/85 (60.00%), Query Frame = -2
Query:  727 FCFMLKHLSLVELIFSLSGVVFECFYFTLVVLQRPFPKVLVNFIIYF----VFNFMWLMYKSSLLSRNWVIVLIAWRRYQAIHRP 969
            F  ML HLS VE++  LSG +FE  YF+ +VL    P  L   + YF    V    W++YK+SLL+RNWVI  IAWRR   +H P
Sbjct:  246 FSLMLCHLSAVEMVCGLSGFLFETVYFSTIVLGDESPVFLSPRLAYFLALGVLQLDWIVYKASLLARNWVIAFIAWRRLCVVHDP 330          
BLAST of SMED30032138 vs. Planmine SMEST
Match: SMESG000013334.1 (SMESG000013334.1)

HSP 1 Score: 650.203 bits (1676), Expect = 0.000e+0
Identity = 368/369 (99.73%), Postives = 368/369 (99.73%), Query Frame = -2
Query:   25 MFNFTINESSKGINYETDIITLVSYKIKITVSLFGFVLNLWAFSFFHRFEKQSHFCFMLKHLSLVELIFSLSGVVFECFYFTLVVLQRPFPKVLVNFIIYFVFNFMWLMYKSSLLSRNWVIVLIAWRRYQAIHRPXXXXXXXXXXXXXXXIFGIYAISLFLVTPRLFEITYSYSNETKNVIITPYLLVNSIYLSTYPILFFILISPVPVCVICFYSIFMLRSLRKPECHELETRSDHFQRQNPTXXXXXXXXXXXXNKXXXXXXXXXXXCEFPMCLAGIFNQISRESTGVQFQWFLTHFAGVANILTSCDSIFNFVIYFISFPFFKQSILKGFSAISCYDFQNNYRLDNSNFSRQKTINQCEETVFSND 1131
            MFNFTINESSKGINYETDIITLVSYKIKITVSLFGFVLNLWAFSFFHRFEKQSHFCFMLKHLSLVELIFSLSGVVFECFYFTLVVLQRPFPKVLVNFIIY VFNFMWLMYKSSLLSRNWVIVLIAWRRYQAIHRPLSSKQLLSKKLIQYLIFGIYAISLFLVTPRLFEITYSYSNETKNVIITPYLLVNSIYLSTYPILFFILISPVPVCVICFYSIFMLRSLRKPECHELETRSDHFQRQNPTISRRIARNRSSSNKTVLVLCTVFTTCEFPMCLAGIFNQISRESTGVQFQWFLTHFAGVANILTSCDSIFNFVIYFISFPFFKQSILKGFSAISCYDFQNNYRLDNSNFSRQKTINQCEETVFSND
Sbjct:    1 MFNFTINESSKGINYETDIITLVSYKIKITVSLFGFVLNLWAFSFFHRFEKQSHFCFMLKHLSLVELIFSLSGVVFECFYFTLVVLQRPFPKVLVNFIIYLVFNFMWLMYKSSLLSRNWVIVLIAWRRYQAIHRPLSSKQLLSKKLIQYLIFGIYAISLFLVTPRLFEITYSYSNETKNVIITPYLLVNSIYLSTYPILFFILISPVPVCVICFYSIFMLRSLRKPECHELETRSDHFQRQNPTISRRIARNRSSSNKTVLVLCTVFTTCEFPMCLAGIFNQISRESTGVQFQWFLTHFAGVANILTSCDSIFNFVIYFISFPFFKQSILKGFSAISCYDFQNNYRLDNSNFSRQKTINQCEETVFSND 369          
BLAST of SMED30032138 vs. Planmine SMEST
Match: SMESG000061638.1 (SMESG000061638.1)

HSP 1 Score: 133.265 bits (334), Expect = 1.841e-35
Identity = 115/314 (36.62%), Postives = 173/314 (55.10%), Query Frame = -2
Query:  145 IKITVSLFGFVLNLWAFSFFHRFEKQSHFCFMLKHLSLVELIFSLSGVVFECFYFTLVVLQRPFPKVL-VNFIIYFVFNFMWLMYKSSLLSRNWVIVLIAWRRYQAIHRPXXXXXXXXXXXXXXXIFGIYAISLFLVTPRLFEITYSYSNETKNVIITPYLLVNSIYLST-----YPILFFILISPVPVCVICFYSIFMLRSLRKPECH-----ELETRSDHFQRQNPTXXXXXXXXXXXXNKXXXXXXXXXXXCEFPMCLAGIFNQISRESTGVQFQWFLTHFAGVANILTSCDSIFNFVIYFISFPFFKQSI 1053
            +K T SL G + N+ +  +F    +   F  +L HLS VE+IF  SG +FE  Y+                FIIY V+ ++W++YKSSLL+RNW+  ++AW+RY+AI  PLS+KQ  + K I  ++F +Y + +    PR FE +Y Y  E    IIT   + NSIY +      Y  L+F L SP+P+ VI   S+ ML  L+K + +        +R   +++++   +        S NKTV++LC  FT CE P C+AGI   +   ST +     L++F G+A +LTS DS+ +F IYF S   F+Q+I
Sbjct:    1 MKATFSLLGLMFNIISMIYFATVNRYKIFNLLLLHLSCVEVIFCSSGFIFEVTYYWYAAKHNILSYTWQAKFIIYLVYFWLWVVYKSSLLARNWITAVVAWQRYRAISHPLSTKQYETYKSISMILFIMYFLVILFSIPRAFEKSY-YLCEKDVYIIT---MNNSIYYTDLYKNIYNPLYFFLSSPLPLLVIIVCSLSMLIVLKKRQENLNNLTSQPSRFSKYKQKSSLGNNSSNSRGQSINKTVIILCAAFTICELPACIAGIMLNV---STDMSIWKILSYFVGIAMVLTSVDSLLDFFIYFYSIVHFRQAI 307          
BLAST of SMED30032138 vs. Planmine SMEST
Match: SMESG000063294.1 (SMESG000063294.1)

HSP 1 Score: 62.7734 bits (151), Expect = 1.117e-10
Identity = 95/339 (28.02%), Postives = 153/339 (45.13%), Query Frame = -2
Query:  118 ETDII----TLVSYKIKITVSLFGFVLNLWAFSFFHRFEKQSHFCFMLKHLSLVELIFSLSGVVFECFYFTLVVLQRPFPKVLVNFIIYFVFNFMWLMYKSSLLSRNWVIVLIAWRRYQAIHRPXXXXXXXXXXXXXXXIFGIYAISLFLVTPRLFEITYSYSNETKNVIITPYLLVNS-----------IYLSTYPILFFILISPVPVCVICFYSIFMLRSLRKPECHELETRSDHFQRQNPTXXXXXXXXXXXXNKXXXXXXXXXXXCEFPMCLAGIFNQISRESTGVQFQWFLT-HFAGVANILTSCDSIFNFVIYFISFPFFKQSILKGFSAISC 1086
            ETD I    TL+   + I  + F FV+      F     K+S    +L+ LSL E++F+++ V+ E      +  Q P    LV FI  +V     ++    L++RNW +V++A  RY+A+ RP+ S + +    I      I+A+S+ +  PR+         ETK  I  P L VN            +YL T  IL F++ +  PV ++CF S  +L+ +RK +    + R  +F   +          + S ++ +++L   F   E P      F++I       Q  + L  H   +AN L   DSI N  +Y IS P F+ S     S + C
Sbjct:   29 ETDTIYKYITLILTPLSILSNTFAFVV------FKESIWKKSVMSKILRMLSLFEILFNVN-VLLEASIRHKIEEQHPSMVELVIFI--YVITAAKVLMIVFLIARNWTVVILAGYRYEAVCRPVGSCKYIRYNNINLAFCFIFALSILIALPRMM--------ETKIEICQPTLSVNRFVPFLISYKWYLYLHT-GILLFLIQNGGPVILVCFLSSCVLKVIRKMK----KIRKSNFNLADKK-----GSPQPSGDRLIVILSAAFFVLETP----AFFSKILHHYFEYQGYYNLDIHIGLLANTLIYLDSIINVAVYVISNPTFRISSKALLSKLIC 336          
BLAST of SMED30032138 vs. Planmine SMEST
Match: SMESG000023730.1 (SMESG000023730.1)

HSP 1 Score: 60.077 bits (144), Expect = 1.322e-9
Identity = 85/344 (24.71%), Postives = 150/344 (43.60%), Query Frame = -2
Query:   43 ITVSLFGFVLNLWAFSFFHRFEKQSHFCFMLKHLSLVELIFSLSGVVFECFYFTLVVLQRPFPKVLVNFIIYFVFNFMWLMYKSSLLSRNWVIVLIAWRRYQAIHRPXXXXXXXXXXXXXXXIFGIYAISLFLVTPRLFEITYSYSNETKNVIITPYLLVNSIYLSTY-PILFFILISPVPVCVICFYSIFMLRSLRKPECHELETRSDHFQRQNPTXXXXXXXXXXXXNKXXXXXXXXXXXCEFPMCLA-GIFNQISRESTGVQFQWFLTH-------FAGVANILTSCDSIFNFVIYFISFPFFKQSILKGFSAISCYDFQNNYRLDNSNFSRQKTINQCEE 1047
            I++   GF L    F FF +  K+S    +LK+LS  E++F++SG ++    F    +  P           F+         S L+ RNW I+ +A  R+ +I RPL++K++ ++     L++  Y ++  +  PR FE   ++     N+++ P LL    Y   Y   L FI+ +  PV      SI ++R++ K +    ++ S   + +N  IS                           +CLA  +F   S  S  +Q      +        A VAN+L   DS+ N  +Y +S P F++  LK       ++ +  Y  + +   R++TI+Q +E
Sbjct:  278 ISIIFNGFCL----FIFFDKIWKKSILSILLKYLSATEIVFNISGFLYSVTKF----IDYPSINQFSKLFWVFILQIGTFSVASGLICRNWTILHLAIYRFDSICRPLNTKKIYTETSTYKLLWITYILAAVIAFPRTFEYKATFCE--GNLVLKPSLLNYDWYAYGYQGSLIFIIQTAAPVVCTSILSISVMRAILKVKRFR-KSFSKTIKTKNNAISGDALMIF--------------------ICLAFFLFETPSFFSKALQSYLMRNNKIIEDVLLATVANLLVYLDSVINIFVYILSNPVFRKK-LKQIFHFKAFNLK-EYPTEATALERRETISQSKE 588          
BLAST of SMED30032138 vs. Planmine SMEST
Match: SMESG000004763.1 (SMESG000004763.1)

HSP 1 Score: 57.7658 bits (138), Expect = 5.039e-9
Identity = 75/286 (26.22%), Postives = 142/286 (49.65%), Query Frame = -2
Query:  121 MLKHLSLVELIFSLSGVVFECFYFTLVVLQRPFPKVLVN-FIIYFVFNFMWLMYKSSLLSRNWVIVLIAWRRYQAIHRPXXXXXXXXXXXXXXXIFGIYAISLFLVTPRLFEITYSYSNETKNVIITPYLLVNS-----IYLSTYPILFFILISPVPVCVICFYSIFMLRSLRKPECHELETRSDHFQRQNPTXXXXXXXXXXXXNKXXXXXXXXXXXCEFPMCLAGIFNQISRESTGVQFQWFLTHFAGVANILTSCDSIFNFVIYFISFPFFKQSILKGFSAIS 960
            +L   S +ELIF ++ ++F    + + + +       VN  I+  +F  ++L     L++RN  I+L+A+ R++ I  PL +K+ ++   I +  FGI + ++ +  PR+FE TY+Y  +T +V+     L N      IYL+ +  +F I I  +P+  +   SI MLR +R+       + + + ++++            +++K V+ LC  F T E P      F+++   S  +     + H   +ANI    DS  N +IY +S   F+ ++L+  S +S
Sbjct:   84 ILARFSFIELIFQMTLLLFYLVEY-IKIDEYIISSRFVNPGIMDALFRCIYLFSVGFLIARNSWIILLAFHRFECICYPLRTKRYVTSANINFYFFGIVSFAILIAFPRMFEQTYTYCLQTGDVVNVSEALSNVYQYRIIYLNVF--VFLIQIG-IPLLSVNILSILMLRKIRQSLTFRRTSAAPNQKKKS-----------FAADKLVVALCITFFTFEMP----SFFSKLFHNSHIISNDKIIYHLTFIANISIYIDSSMNLLIYLVSNRIFRGAVLQQISKVS 350          
The following BLAST results are available for this feature:
BLAST of SMED30032138 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30032138 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30032138 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30032138 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30032138 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30032138 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30032138 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30032138 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 3
Match NameE-valueIdentityDescription
A0A267FSD81.385e-3234.64G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A1I8HVZ05.578e-1531.90Phosphodiesterase OS=Macrostomum lignano OX=282301... [more]
A0A3S5ANT61.271e-1147.06G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
back to top
BLAST of SMED30032138 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30032138 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30032138 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30032138 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30032138 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30032138 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000013334.10.000e+099.73SMESG000013334.1[more]
SMESG000061638.11.841e-3536.62SMESG000061638.1[more]
SMESG000063294.11.117e-1028.02SMESG000063294.1[more]
SMESG000023730.11.322e-924.71SMESG000023730.1[more]
SMESG000004763.15.039e-926.22SMESG000004763.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032138 ID=SMED30032138|Name=SMED30032138|organism=Schmidtea mediterranea sexual|type=transcript|length=1159bp
GATTAAACGTTATATTTGAATTTAATCATTAGAAAAAACAGTTTCTTCGC
ATTGATTAATGGTTTTTTGTCTGGAAAAATTCGAATTGTCCAATCGATAA
TTGTTTTGAAAATCATAACAAGAAATTGCAGAAAAACCTTTCAAAATCGA
TTGTTTGAAAAACGGAAATGAAATAAAGTAAATAACAAAATTGAAAATCG
AATCGCAACTTGTCAAAATATTTGCTACGCCAGCAAAATGGGTCAAAAAC
CATTGAAATTGAACTCCAGTTGATTCTCGGGAAATTTGATTAAAAATGCC
CGCAAGACACATGGGAAACTCACAAGTTGTAAACACGGTGCAGAGAACCA
GCACGGTTTTGTTCGAGGATGATCGATTTCTTGCAATACGTCTTGAAATC
GTTGGATTCTGTCTTTGGAAATGGTCGCTTCGAGTTTCTAATTCATGACA
TTCCGGCTTCCTTAATGATCTCAACATAAAAATACTATAAAAACATATAA
CGCATACGGGTACCGGAGATATTAAGATAAAAAACAATATGGGATAAGTT
GATAAATAAATTGAATTGACAAGTAAATAAGGTGTAATTATAACATTTTT
CGTTTCATTTGAATAGGAATATGTAATCTCAAACAGTCTGGGGGTCACGA
GAAATAAGGATATTGCGTAGATTCCAAAGATCAAATATTGAATTAACTTT
TTCGACAGTAATTGCTTCGATGAGAGTGGCCGATGGATCGCTTGGTATCT
CCTCCATGCAATGAGTACAATGACCCAATTTCTTGATAGTAAAGAACTTT
TATACATGAGCCACATAAAATTGAAAACAAAATAGATAATAAAATTCACT
AAAACCTTTGGAAAAGGTCTCTGTAGAACGACTAGAGTGAAATAGAAACA
TTCAAAAACAACTCCCGACAGAGAGAATATCAATTCAACTAGCGACAAAT
GCTTGAGCATGAAACAAAAATGACTCTGTTTTTCAAAACGATGAAAAAAT
GAAAATGCCCACAAATTTAAAACAAATCCAAATAGTGAGACGGTTATTTT
GATTTTGTAGGAAACTAAAGTTATGATGTCTGTTTCGTAATTTATTCCTT
TGCTGCTTTCATTTATTGTGAAATTGAACATTTCCTATCTATATTCAATA
AATTACTGT
back to top

protein sequence of SMED30032138-orf-1

>SMED30032138-orf-1 ID=SMED30032138-orf-1|Name=SMED30032138-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=370bp
MFNFTINESSKGINYETDIITLVSYKIKITVSLFGFVLNLWAFSFFHRFE
KQSHFCFMLKHLSLVELIFSLSGVVFECFYFTLVVLQRPFPKVLVNFIIY
FVFNFMWLMYKSSLLSRNWVIVLIAWRRYQAIHRPLSSKQLLSKKLIQYL
IFGIYAISLFLVTPRLFEITYSYSNETKNVIITPYLLVNSIYLSTYPILF
FILISPVPVCVICFYSIFMLRSLRKPECHELETRSDHFQRQNPTISRRIA
RNRSSSNKTVLVLCTVFTTCEFPMCLAGIFNQISRESTGVQFQWFLTHFA
GVANILTSCDSIFNFVIYFISFPFFKQSILKGFSAISCYDFQNNYRLDNS
NFSRQKTINQCEETVFSND*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 9..339
e-value: 2.5E-31
score: 110.8
NoneNo IPR availablePANTHERPTHR24240:SF85OPSIN RH1-RELATEDcoord: 30..347
NoneNo IPR availablePANTHERPTHR24240OPSINcoord: 30..347
NoneNo IPR availableCDDcd149787tmA_FMRFamide_R-likecoord: 29..321
e-value: 2.65563E-15
score: 73.436
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 19..336
NoneNo IPR availableTMHMMTMhelixcoord: 258..280
NoneNo IPR availableTMHMMTMhelixcoord: 20..42
NoneNo IPR availableTMHMMTMhelixcoord: 99..121
NoneNo IPR availableTMHMMTMhelixcoord: 196..218
NoneNo IPR availableTMHMMTMhelixcoord: 62..84
NoneNo IPR availableTMHMMTMhelixcoord: 141..163
NoneNo IPR availableTMHMMTMhelixcoord: 300..322
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 58..318
e-value: 2.9E-10
score: 39.9
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 35..318
score: 19.93