Voltage-dependent calcium channel subunit alpha-2/delta-1

Overview
NameVoltage-dependent calcium channel subunit alpha-2/delta-1
Smed IDSMED30032130
Length (bp)3764
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Voltage-dependent calcium channel subunit alpha-2/delta-1 (SMED30032130) t-SNE clustered cells

Violin plots show distribution of expression levels for Voltage-dependent calcium channel subunit alpha-2/delta-1 (SMED30032130) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Voltage-dependent calcium channel subunit alpha-2/delta-1 (SMED30032130) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Voltage-dependent calcium channel subunit alpha-2/delta-1 (SMED30032130) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032130

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30032130SMESG000019491.1 SmedASXL_015050SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30032130SMESG000019491.1 dd_Smed_v4_19048_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30032130SMESG000019491.1 dd_Smed_v6_19048_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30032130SMESG000019491.1 OX_Smed_1.0.20585ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Ensembl Human
Match: CACNA2D1 (calcium voltage-gated channel auxiliary subunit alpha2delta 1 [Source:HGNC Symbol;Acc:HGNC:1399])

HSP 1 Score: 194.126 bits (492), Expect = 1.249e-49
Identity = 214/859 (24.91%), Postives = 369/859 (42.96%), Query Frame = 3
Query:  264 IYNWVDMIQNYIKQLA--LNGIRKDVTQSLFDQAKYKLEIKDGMEIVKDISEQLGSYLFNRKKAALRIANAAVEIYDMNKRRKGNFSYEFL----KDLPTNEVMDSD--NPKSLPPMTFNSYFKQNVTEKHSTIKIADEVPRSLNTTIFTVHWTYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREW--SSNFVGFYTDYDPRVRAWYITATSGPKDVIILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVICARNSHWDEIGKWHLYKSHALSCRPDSLVAATIAHRKDLIESIDNLVPGGTSELETGFELAFDLLKS--VPRTGCQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTNMGLTVPARIFSYLVK----DDGEMLPGSIACGHGGSMRKIVYGENIISQLSNYFEFLAKVT-----QKKEGLWTSPYIDSLGTGLLITHAVPAIST----------EDGTLLGVAGVDVTLEEIEMLIARYQWGSMTSFF-INNKGNVIFHPLLKASTTLEDDPIFIHIQSLEQNK----AGNPKDFSKVVDDMINMTAGN-------RRIIDGRRGTPKGDFKAGVK------YDKMPLEYYYAPLKHSNVYSIAIVLADTDKVFRRLEEPSNISQPVPSFFNLLIEYNSTKVLKEYPNIFKELDVRFNETKYPMLRVTYNYSSIFFAPSVHCDPSKYFFDDDLAQKTLDAHRYMNELTHNSDPGCDVPEGKYAQGTRAYVLVTESIENQWKSRNFESIDEVTWTYVGMRSGVFRTYP---GHRSTRLYDPTKRPWYRRTLANPTKISISTPYFDAAGSGKI---ITISQAV 2675
            I +WVD +Q  +  LA   +G+ + V      Q  Y +E  +  ++V+  +  +   L NR KA +R+A  A ++   ++ R+   S E +    KD    E  DS+  + +  P    ++ F + ++ +H+ + I  ++       +  ++WT  L+E+ K+N +ED  + WQ FGS  G+ R +P   W  +S        YD R R WYI   + PKD++IL+D S S++G    + +     +++TL+  D++NV    ++  D            +SC    LV A + ++K L ++++N+   G ++ + GF  AF+ L +  V R  C  II+  TDG    GE                         +   I NK N    V  R+F++ V     D G +    +AC + G   +I     I      Y + L +       + K+  WT+ Y+D+L  GL+IT  +P  +           ++  +LGV GVDV+LE+I+ L  R+       +F I+  G V+ HP       L+  PI + I ++   K      NPK    V  D ++    N        ++IDG  G  +  F+  VK       DK    Y + P+  ++ YS+A+VL                  P  SF+ +  +   T     Y    K  +  F E+ Y            F AP  +C+  K    D+  +  L+ + +++  T N +P C+            +    E ++N W  +  ++I  V   +V    G+ R YP   G       +  +  +Y+R+L N   +  + PYF+ +G G     I +S+AV
Sbjct:   33 IKSWVDKMQEDLVTLAKTASGVNQLVDIYEKYQDLYTVEPNNARQLVEIAARDIEKLLSNRSKALVRLALEAEKVQAAHQWREDFASNEVVYYNAKDDLDPEKNDSEPGSQRIKPVFIEDANFGRQISYQHAAVHIPTDIYEGSTIVLNELNWTSALDEVFKKNREEDPSLLWQVFGSATGLARYYPASPWVDNSRTPNKIDLYDVRRRPWYIQGAASPKDMLILVDVSGSVSGLTLKLIRTSVSEMLETLSDDDFVNVASFNSNAQD------------VSCF-QHLVQANVRNKKVLKDAVNNITAKGITDYKKGFSFAFEQLLNYNVSRANCNKIIMLFTDG----GEE------------------------RAQEIFNKYNKDKKV--RVFTFSVGQHNYDRGPI--QWMACENKGYYYEIPSIGAIRINTQEYLDVLGRPMVLAGDKAKQVQWTNVYLDALELGLVITGTLPVFNITGQFENKTNLKNQLILGVMGVDVSLEDIKRLTPRFTLCPNGYYFAIDPNGYVLLHP------NLQPKPIGVGIPTINLRKRRPNIQNPKSQEPVTLDFLDAELENDIKVEIRNKMIDGESG--EKTFRTLVKSQDERYIDKGNRTYTWTPVNGTD-YSLALVL------------------PTYSFYYIKAKLEETITQARYSETLKPDN--FEESGY-----------TFIAPRDYCNDLK--ISDNNTEFLLNFNEFIDRKTPN-NPSCNADLINRVLLDAGF--TNELVQNYWSKQ--KNIKGVKARFVVTDGGITRVYPKEAGENWQENPETYEDSFYKRSLDNDNYV-FTAPYFNKSGPGAYESGIMVSKAV 798          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Ensembl Human
Match: CACNA2D1 (calcium voltage-gated channel auxiliary subunit alpha2delta 1 [Source:HGNC Symbol;Acc:HGNC:1399])

HSP 1 Score: 186.037 bits (471), Expect = 4.389e-47
Identity = 208/848 (24.53%), Postives = 368/848 (43.40%), Query Frame = 3
Query:  264 IYNWVDMIQNYIKQLA--LNGIRKDVTQSLFDQAKYKLEIKDGMEIVKDISEQLGSYLFNRKKAALRIANAAVEIYDMNKRRKGNFSYEFL----KDLPTNEVMDSD--NPKSLPPMTFNSYFKQNVTEKHSTIKIADEVPRSLNTTIFTVHWTYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREW--SSNFVGFYTDYDPRVRAWYITATSGPKDVIILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVICARNSHWDEIGKWHLYKSHALSCRPDSLVAATIAHRKDLIESIDNLVPGGTSELETGFELAFDLLKS--VPRTGCQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTNMGLTVPARIFSYLVK----DDGEMLPGSIACGHGGSMRKIVYGENIISQLSNYFEFLAKVT-----QKKEGLWTSPYIDSLGTGLLITHAVPAIST----------EDGTLLGVAGVDVTLEEIEMLIARYQWGSMTSFF-INNKGNVIFHPLLKASTTLEDDPIFIHIQSLEQNKAGNPKDFSKVVDDMINMTAGNRRIIDGRRGTPKGDFKAGVK------YDKMPLEYYYAPLKHSNVYSIAIVLADTDKVFRRLEEPSNISQPVPSFFNLLIEYNSTKVLKEYPNIFKELDVRFNETKYPMLRVTYNYSSIFFAPSVHCDPSKYFFDDDLAQKTLDAHRYMNELTHNSDPGCDVPEGKYAQGTRAYVLVTESIENQWKSRNFESIDEVTWTYVGMRSGVFRTYP---GHRSTRLYDPTKRPWYRRTLANPTKISISTPYFDAAGSGKI---ITISQAV 2675
            I +WVD +Q  +  LA   +G+ + V      Q  Y +E  +  ++V+  +  +   L NR KA +R+A  A ++   ++ R+   S E +    KD    E  DS+  + +  P    ++ F + ++ +H+ + I  ++       +  ++WT  L+E+ K+N +ED  + WQ FGS  G+ R +P   W  +S        YD R R WYI   + PKD++IL+D S S++G    + +     +++TL+  D++NV    ++  D            +SC    LV A + ++K L ++++N+   G ++ + GF  AF+ L +  V R  C  II+  TDG    GE                         +   I NK N    V  R+F++ V     D G +    +AC + G   +I     I      Y + L +       + K+  WT+ Y+D+L  GL+IT  +P  +           ++  +LGV GVDV+LE+I+ L  R+       +F I+  G V+ HP L+       +P+ +     E             +++ I +   N ++IDG  G  +  F+  VK       DK    Y + P+  ++ YS+A+VL                  P  SF+ +  +   T          K+  ++ +ET  P       Y+  F AP  +C+  K    D+  +  L+ + +++  T N +P C+            +    E ++N W  +  ++I  V   +V    G+ R YP   G       +  +  +Y+R+L N   +  + PYF+ +G G     I +S+AV
Sbjct:   33 IKSWVDKMQEDLVTLAKTASGVNQLVDIYEKYQDLYTVEPNNARQLVEIAARDIEKLLSNRSKALVRLALEAEKVQAAHQWREDFASNEVVYYNAKDDLDPEKNDSEPGSQRIKPVFIEDANFGRQISYQHAAVHIPTDIYEGSTIVLNELNWTSALDEVFKKNREEDPSLLWQVFGSATGLARYYPASPWVDNSRTPNKIDLYDVRRRPWYIQGAASPKDMLILVDVSGSVSGLTLKLIRTSVSEMLETLSDDDFVNVASFNSNAQD------------VSCF-QHLVQANVRNKKVLKDAVNNITAKGITDYKKGFSFAFEQLLNYNVSRANCNKIIMLFTDG----GEE------------------------RAQEIFNKYNKDKKV--RVFTFSVGQHNYDRGPI--QWMACENKGYYYEIPSIGAIRINTQEYLDVLGRPMVLAGDKAKQVQWTNVYLDALELGLVITGTLPVFNITGQFENKTNLKNQLILGVMGVDVSLEDIKRLTPRFTLCPNGYYFAIDPNGYVLLHPNLQPKNPKSQEPVTLDFLDAE-------------LENDIKVEIRN-KMIDGESG--EKTFRTLVKSQDERYIDKGNRTYTWTPVNGTD-YSLALVL------------------PTYSFYYIKAKLEETITQARS----KKGKMKDSETLKPDNFEESGYT--FIAPRDYCNDLK--ISDNNTEFLLNFNEFIDRKTPN-NPSCNADLINRVLLDAGF--TNELVQNYWSKQ--KNIKGVKARFVVTDGGITRVYPKEAGENWQENPETYEDSFYKRSLDNDNYV-FTAPYFNKSGPGAYESGIMVSKAV 786          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Ensembl Human
Match: CACNA2D2 (calcium voltage-gated channel auxiliary subunit alpha2delta 2 [Source:HGNC Symbol;Acc:HGNC:1400])

HSP 1 Score: 180.644 bits (457), Expect = 2.483e-45
Identity = 225/1000 (22.50%), Postives = 416/1000 (41.60%), Query Frame = 3
Query:  363 YKLEIKDGMEIVKDISEQLGSYLFNRKKAALRIANAAVEIYDMNKRRKGNFSYEFLK----------DLPTNEVMDSDNPKSLPPMTF--NSYFKQNVTEKHSTIKIADEVPRSLNTTIFTVHWTYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREWSSNFVGFYTDYDPRVRAWYITATSGPKDVIILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVICARNSHWDEIGKWHLYKSHALSCRPDSLVAATIAHRKDLIESIDNLVPGGTSELETGFELAFDLLK--SVPRTGCQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTNMGLTVPARIFSYLV-KDDGEMLPGS-IACGHGGSMRKIVYGENIISQLSNYFEFLAKVT-----QKKEGLWTSPYIDSLGTGLLITHAVPAIS-TEDG-------TLLGVAGVDVTLEEIEMLIARYQWGSMTSFF-INNKGNVIFHPLLKASTTLEDDPIFIHIQSLEQNKAGNPKDFSKVVDDMINMTAGNRRIIDGRRGTPKGDFKAGVK------YDKMPLEYYYAPLKHSNVYSIAIVLADTDKVFRRLEEPSNISQPVPSFFNLLIEYN-STKVLKEYPNIFKELDVRFNETKYPMLRVTYNYSS-IFFAPSVHC------DPSKYFFDD--DLAQK-TLDAHRYMNELTHN--SDPGCDVPEGKYAQGTRAYVLVTESIENQWKSRNFESIDEVTWTYVGMRSGVFRTYPGHRS---TRLYDPTKRPWYRRTLANPTKISISTPYFDAAGSGKIITISQAVFEGMPTLSKEHCKNINSLKPGGCHCVKDSDCLSGYCYISKAPGPDAHETRCATERIEAITSLDIGYDSFHKRLFQIMQAS----DGVKSCNSSYKCPDGYLDCWTK-----CYIFDDRANIIMASEFVAATAFDTNKYLGITVGKKESEIMKDL---IYHHKFFQRSESIDFQGACT 3170
            ++++  +  ++V+ ++  + S L  + +A  R+A+AA E +    R + N   E +           D P +E ++  +  S   + F  +  FK  V   ++ ++I  ++ +     +  ++WT  LE +  EN ++D  + WQ FGS  GV R +P   W +        YD R R WYI   S PKD++I++D S S++G    + K     ++ TL+  DY+NV     + ++E       K+  +SC    LV A + ++K   E++  +V  GT+  + GFE AFD L+  ++ R  C  +I+  TDG +   ++V                  KYNW       N+T        R+F++ V + + ++ P   +AC + G   +I     I      Y + L +       + K+  WT+ Y D+LG GL++T  +P  + T+DG        +LGV G+DV L +I+ L   Y  G+    F I+  G V+ HP LK  TT   +P+ +              DF     +  N     R +IDG +G  +   +  VK       D++   Y + P++ +N YS+ +VL                    P +    ++ N S ++L+    I K  D  F      +L  ++     +F AP  +C      D +  F  +  +L +K T D+ +  N L HN   D G                +  + +E  W+ ++  +   +   +     G+ R +P   +   T   +P    +YRR+L N   +    P+ DA    + + +       + + + E      +L+P                                     A+  + +  +++ ++ F+++ ++    D  + C  +  C    +DC        C + DD   ++++++           +    VG+  SE+  +L   +Y++ F+ R ES D+Q AC 
Sbjct:  105 FEVQENEPQKLVEKVAGDIESLLDRKVQALKRLADAA-ENFQKAHRWQDNIKEEDIVYYDAKADAELDDPESEDVERGSKASTLRLDFIEDPNFKNKVNYSYAAVQIPTDIYKGSTVILNELNWTEALENVFMENRRQDPTLLWQVFGSATGVTRYYPATPWRA--PKKIDLYDVRRRPWYIQGASSPKDMVIIVDVSGSVSGLTLKLMKTSVCEMLDTLSDDDYVNV-----ASFNE-------KAQPVSCF-THLVQANVRNKKVFKEAVQGMVAKGTTGYKAGFEYAFDQLQNSNITRANCNKMIMMFTDGGEDRVQDV----------------FEKYNWP------NRT-------VRVFTFSVGQHNYDVTPLQWMACANKGYYFEIPSIGAIRINTQEYLDVLGRPMVLAGKEAKQVQWTNVYEDALGLGLVVTGTLPVFNLTQDGPGEKKNQLILGVMGIDVALNDIKRLTPNYTLGANGYVFAIDLNGYVLLHPNLKPQTTNFREPVTL--------------DFLDAELEDENKEEIRRSMIDGNKGHKQ--IRTLVKSLDERYIDEVTRNYTWVPIRSTN-YSLGLVL--------------------PPYSTFYLQANLSDQILQVKLPISKLKDFEF------LLPSSFESEGHVFIAPREYCKDLNASDNNTEFLKNFIELMEKVTPDSKQCNNFLLHNLILDTG----------------ITQQLVERVWRDQDLNTYSLLA-VFAATDGGITRVFPNKAAEDWTENPEPFNASFYRRSLDNHGYV-FKPPHQDAL--LRPLELENDTVGILVSTAVELSLGRRTLRP-------------------------------------AVVGVKLDLEAWAEK-FKVLASNRTHQDQPQKCGPNSHCE---MDCEVNNEDLLCVLIDDGGFLVLSNQ----------NHQWDQVGRFFSEVDANLMLALYNNSFYTRKESYDYQAACA 945          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Ensembl Human
Match: CACNA2D2 (calcium voltage-gated channel auxiliary subunit alpha2delta 2 [Source:HGNC Symbol;Acc:HGNC:1400])

HSP 1 Score: 180.259 bits (456), Expect = 3.651e-45
Identity = 227/996 (22.79%), Postives = 410/996 (41.16%), Query Frame = 3
Query:  363 YKLEIKDGMEIVKDISEQLGSYLFNRKKAALRIANAAVEIYDMNKRRKGNFSYEFLK----------DLPTNEVMDSDNPKSLPPMTF--NSYFKQNVTEKHSTIKIADEVPRSLNTTIFTVHWTYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREWSSNFVGFYTDYDPRVRAWYITATSGPKDVIILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVICARNSHWDEIGKWHLYKSHALSCRPDSLVAATIAHRKDLIESIDNLVPGGTSELETGFELAFDLLK--SVPRTGCQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTNMGLTVPARIFSYLV-KDDGEMLPGS-IACGHGGSMRKIVYGENIISQLSNYFEFLAKVT-----QKKEGLWTSPYIDSLGTGLLITHAVPAIS-TEDG-------TLLGVAGVDVTLEEIEMLIARYQWGSMTSFF-INNKGNVIFHPLLKASTTLEDDPIFIHIQSLEQNKAGNPKDFSKVVDDMINMTAGNRRIIDGRRGTPKGDFKAGVK------YDKMPLEYYYAPLKHSNVYSIAIVLADTDKVFRRLEEPSNISQPVPSFFNLLIEYN-STKVLKEYPNIFKELDVRFNETKYPMLRVTYNYSS-IFFAPSVHC------DPSKYFFDD--DLAQK-TLDAHRYMNELTHN--SDPGCDVPEGKYAQGTRAYVLVTESIENQWKSRNFESIDEVTWTYVGMRSGVFRTYPGHRS---TRLYDPTKRPWYRRTLANPTKISISTPYFDAAGSGKIITISQAVFEGMPTLSKEHCKNINSLKPGGCHCVKDSDCLSGYCYISKAPGPDAHETRCATERIEAITSLDIGYDSFHKRLFQIMQASDGVKSCNSSYKCPDGYLDCWTK-----CYIFDDRANIIMASEFVAATAFDTNKYLGITVGKKESEIMKDL---IYHHKFFQRSESIDFQGACT 3170
            ++++  +  ++V+ ++  + S L  + +A  R+A+AA E +    R + N   E +           D P +E ++  +  S   + F  +  FK  V   ++ ++I  ++ +     +  ++WT  LE +  EN ++D  + WQ FGS  GV R +P   W +        YD R R WYI   S PKD++I++D S S++G    + K     ++ TL+  DY+NV     + ++E       K+  +SC    LV A + ++K   E++  +V  GT+  + GFE AFD L+  ++ R  C  +I+  TDG +   ++V                  KYNW       N+T        R+F++ V + + ++ P   +AC + G   +I     I      Y + L +       + K+  WT+ Y D+LG GL++T  +P  + T+DG        +LGV G+DV L +I+ L   Y  G+    F I+  G V+ HP LK  TT   +P+ +              DF     +  N     R +IDG +G  +   +  VK       D++   Y + P++ +N YS+ +VL                    P +    ++ N S ++L+    I K  D  F      +L  ++     +F AP  +C      D +  F  +  +L +K T D+ +  N L HN   D G                +  + +E  W+ ++  +   +   +     G+ R +P   +   T   +P    +YRR+L N   +    P+ DA    + + +       + + + E      +L+P       D +  +                    E+ + + S     D   K+             C  +  C    +DC        C + DD   ++++++           +    VG+  SE+  +L   +Y++ F+ R ES D+Q AC 
Sbjct:  105 FEVQENEPQKLVEKVAGDIESLLDRKVQALKRLADAA-ENFQKAHRWQDNIKEEDIVYYDAKADAELDDPESEDVERGSKASTLRLDFIEDPNFKNKVNYSYAAVQIPTDIYKGSTVILNELNWTEALENVFMENRRQDPTLLWQVFGSATGVTRYYPATPWRA--PKKIDLYDVRRRPWYIQGASSPKDMVIIVDVSGSVSGLTLKLMKTSVCEMLDTLSDDDYVNV-----ASFNE-------KAQPVSCF-THLVQANVRNKKVFKEAVQGMVAKGTTGYKAGFEYAFDQLQNSNITRANCNKMIMMFTDGGEDRVQDV----------------FEKYNWP------NRT-------VRVFTFSVGQHNYDVTPLQWMACANKGYYFEIPSIGAIRINTQEYLDVLGRPMVLAGKEAKQVQWTNVYEDALGLGLVVTGTLPVFNLTQDGPGEKKNQLILGVMGIDVALNDIKRLTPNYTLGANGYVFAIDLNGYVLLHPNLKPQTTNFREPVTL--------------DFLDAELEDENKEEIRRSMIDGNKGHKQ--IRTLVKSLDERYIDEVTRNYTWVPIRSTN-YSLGLVL--------------------PPYSTFYLQANLSDQILQVKLPISKLKDFEF------LLPSSFESEGHVFIAPREYCKDLNASDNNTEFLKNFIELMEKVTPDSKQCNNFLLHNLILDTG----------------ITQQLVERVWRDQDLNTYSLLA-VFAATDGGITRVFPNKAAEDWTENPEPFNASFYRRSLDNHGYV-FKPPHQDAL--LRPLELENDTVGILVSTAVELSLGRRTLRPAVVGVKLDLEAWA--------------------EKFKVLASNRTHQDQPQKQ-------------CGPNSHCE---MDCEVNNEDLLCVLIDDGGFLVLSNQ----------NHQWDQVGRFFSEVDANLMLALYNNSFYTRKESYDYQAACA 946          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Ensembl Human
Match: CACNA2D2 (calcium voltage-gated channel auxiliary subunit alpha2delta 2 [Source:HGNC Symbol;Acc:HGNC:1400])

HSP 1 Score: 175.252 bits (443), Expect = 1.092e-43
Identity = 158/599 (26.38%), Postives = 275/599 (45.91%), Query Frame = 3
Query:  363 YKLEIKDGMEIVKDISEQLGSYLFNRKKAALRIANAAVEIYDMNKRRKGNFSYEFLK----------DLPTNEVMDSDNPKSLPPMTF--NSYFKQNVTEKHSTIKIADEVPRSLNTTIFTVHWTYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREWSSNFVGFYTDYDPRVRAWYITATSGPKDVIILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVICARNSHWDEIGKWHLYKSHALSCRPDSLVAATIAHRKDLIESIDNLVPGGTSELETGFELAFDLLK--SVPRTGCQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTNMGLTVPARIFSYLV-KDDGEMLPGS-IACGHGGSMRKIVYGENIISQLSNYFEFLAKVT-----QKKEGLWTSPYIDSLGTGLLITHAVPAIS-TEDG-------TLLGVAGVDVTLEEIEMLIARYQWGSMTSFF-INNKGNVIFHPLLKASTTLEDDPIFIHIQSLEQNKAGNPKDFSKVVDDMINMTAGNRRIIDGRRGTPKGDFKAGVK------YDKMPLEYYYAPLKHSNVYSIAIVL 2051
            ++++  +  ++V+ ++  + S L  + +A  R+A+AA E +    R + N   E +           D P +E ++  +  S   + F  +  FK  V   ++ ++I  ++ +     +  ++WT  LE +  EN ++D  + WQ FGS  GV R +P   W +        YD R R WYI   S PKD++I++D S S++G    + K     ++ TL+  DY+NV     + ++E       K+  +SC    LV A + ++K   E++  +V  GT+  + GFE AFD L+  ++ R  C  +I+  TDG +   ++V                  KYNW       N+T        R+F++ V + + ++ P   +AC + G   +I     I      Y + L +       + K+  WT+ Y D+LG GL++T  +P  + T+DG        +LGV G+DV L +I+ L   Y  G+    F I+  G V+ HP LK  TT   +P+ +              DF     +  N     R +IDG +G  +   +  VK       D++   Y + P++ +N YS+ +VL
Sbjct:  105 FEVQENEPQKLVEKVAGDIESLLDRKVQALKRLADAA-ENFQKAHRWQDNIKEEDIVYYDAKADAELDDPESEDVERGSKASTLRLDFIEDPNFKNKVNYSYAAVQIPTDIYKGSTVILNELNWTEALENVFMENRRQDPTLLWQVFGSATGVTRYYPATPWRA--PKKIDLYDVRRRPWYIQGASSPKDMVIIVDVSGSVSGLTLKLMKTSVCEMLDTLSDDDYVNV-----ASFNE-------KAQPVSCF-THLVQANVRNKKVFKEAVQGMVAKGTTGYKAGFEYAFDQLQNSNITRANCNKMIMMFTDGGEDRVQDV----------------FEKYNWP------NRT-------VRVFTFSVGQHNYDVTPLQWMACANKGYYFEIPSIGAIRINTQEYLDVLGRPMVLAGKEAKQVQWTNVYEDALGLGLVVTGTLPVFNLTQDGPGEKKNQLILGVMGIDVALNDIKRLTPNYTLGANGYVFAIDLNGYVLLHPNLKPQTTNFREPVTL--------------DFLDAELEDENKEEIRRSMIDGNKGHKQ--IRTLVKSLDERYIDEVTRNYTWVPIRSTN-YSLGLVL 641          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Ensembl Celegans
Match: tag-180 (pep chromosome:WBcel235:II:11323051:11329429:-1 gene:WBGene00007041.1 transcript:T24F1.6a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:tag-180)

HSP 1 Score: 112.849 bits (281), Expect = 8.638e-25
Identity = 96/399 (24.06%), Postives = 174/399 (43.61%), Query Frame = 3
Query:  699 TYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREWSSNFVGFYTD-YDPRVRAWYITATSGPKDVIILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVICARNSHWDEIGKWHLYKSHALSCRPDSLVAATIAHRKDLIESIDNLVPGGTSELETGFELAFDLLK----------SVPRTGCQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTNMGLTVPARIFSYLVKDDGEMLPGS--IAC-GHGG------------SMRKIVYGENIISQLSNYFEFLAKVTQKKEGLWTSPYIDSLGTGLLITHAVPAISTE-----DGTLLGVAGVDVTLEEIEMLIARYQWGSMTSFFINNKGNVIFHPLLKASTT 1802
            T  LE+ M +N ++   +  QY G+ +G+ R++P R W         D +DPR R W++ A S PKD++ L+D S S+ G    + K     I+ TL+ +DY   +   N+H++ I          +SC   + + AT +++K   E +  L     +   T  + + D+L+          +  R+    +++  TDG D     +     + TR+  +                           RIF + +     +LP    +AC  HGG              R I   +N++SQ+    E      +K+E  WT  Y+++ GTG ++T ++P +++E     D  L GV  +D++++E    +       M  + ++N G +I+HP L+   T
Sbjct:  168 TKHLEKTMSDNKEKAPEMGHQYIGTYSGLTRMYPRRHWKVEPTPITIDLFDPRFRPWFVNAESVPKDIVFLLDYSGSVKGPTMHLIKITMMYILSTLSPNDYFFGVYF-NNHFNPI----------ISCANRTFMPATTSNKKVFFEELGMLEEKDQAHFATPLKFSLDVLRGNLDSNQSLFADYRSEGHKLLIIFTDGVDEWPHQI-LDEEFQTRNSEL--------------------------IRIFGFSMGYGTSLLPLQQYMACKSHGGYSEIDSIMDVKPQSRTI---QNVLSQVRGD-ELKGTNAEKREPSWTQLYMETQGTGPIVTLSLPILTSEQRIWRDQKLAGVVAIDISIKEFTKHLPTSS-EQMYGYIVDNNGMLIYHPQLQIPKT 523          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Ensembl Celegans
Match: tag-180 (pep chromosome:WBcel235:II:11323051:11329147:-1 gene:WBGene00007041.1 transcript:T24F1.6b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:tag-180)

HSP 1 Score: 112.464 bits (280), Expect = 9.650e-25
Identity = 96/399 (24.06%), Postives = 174/399 (43.61%), Query Frame = 3
Query:  699 TYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREWSSNFVGFYTD-YDPRVRAWYITATSGPKDVIILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVICARNSHWDEIGKWHLYKSHALSCRPDSLVAATIAHRKDLIESIDNLVPGGTSELETGFELAFDLLK----------SVPRTGCQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTNMGLTVPARIFSYLVKDDGEMLPGS--IAC-GHGG------------SMRKIVYGENIISQLSNYFEFLAKVTQKKEGLWTSPYIDSLGTGLLITHAVPAISTE-----DGTLLGVAGVDVTLEEIEMLIARYQWGSMTSFFINNKGNVIFHPLLKASTT 1802
            T  LE+ M +N ++   +  QY G+ +G+ R++P R W         D +DPR R W++ A S PKD++ L+D S S+ G    + K     I+ TL+ +DY   +   N+H++ I          +SC   + + AT +++K   E +  L     +   T  + + D+L+          +  R+    +++  TDG D     +     + TR+  +                           RIF + +     +LP    +AC  HGG              R I   +N++SQ+    E      +K+E  WT  Y+++ GTG ++T ++P +++E     D  L GV  +D++++E    +       M  + ++N G +I+HP L+   T
Sbjct:  168 TKHLEKTMSDNKEKAPEMGHQYIGTYSGLTRMYPRRHWKVEPTPITIDLFDPRFRPWFVNAESVPKDIVFLLDYSGSVKGPTMHLIKITMMYILSTLSPNDYFFGVYF-NNHFNPI----------ISCANRTFMPATTSNKKVFFEELGMLEEKDQAHFATPLKFSLDVLRGNLDSNQSLFADYRSEGHKLLIIFTDGVDEWPHQI-LDEEFQTRNSEL--------------------------IRIFGFSMGYGTSLLPLQQYMACKSHGGYSEIDSIMDVKPQSRTI---QNVLSQVRGD-ELKGTNAEKREPSWTQLYMETQGTGPIVTLSLPILTSEQRIWRDQKLAGVVAIDISIKEFTKHLPTSS-EQMYGYIVDNNGMLIYHPQLQIPKT 523          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Ensembl Celegans
Match: unc-36 (Voltage-dependent calcium channel unc-36 [Source:UniProtKB/Swiss-Prot;Acc:P34374])

HSP 1 Score: 101.293 bits (251), Expect = 3.278e-21
Identity = 97/424 (22.88%), Postives = 176/424 (41.51%), Query Frame = 3
Query:  690 VHWTYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREWSSNFVGFYTD-YDPRVRAWYITATSGPKDVIILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVICARNSHWDEIGKWHLYKSHALSCR-PDSLVAATIAHRKDLIESIDNLVPGGTSELETGFELAFDLLKSV-------PRTGCQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTNMGLTVPARIFSYLVKDDGEMLP--GSIACGHGGSMRKIVYGENIISQLSNYFEFLAKVTQK--KE----GLWTSPYIDSL---------------------------------------GTGLLITHAVPAISTEDGTLLGVAGVDVTLEEIEMLIARYQWGSMTSFF-INNKGNVIFHPLLK 1790
            + W+  ++ + + N +E   + +Q F S AG +R +P   W  +    + D +D R   WYI + +  K+V+I++D S SM G+++ +AK+ ++AI++TL+ +DY N++    + +   G           C   + L+ AT+ ++K L   +D     G +E E    LAF +L  +        R  C+++I+ +TDG           P  Y +                  I +  N    V  R+F++LV D+         +AC + G M  +    ++  ++ +Y   +++V  +  KE      WT  Y + L                                           + T + P I  E  T +GVA V++ L E+         GS + FF ++  G V+ HP L+
Sbjct:  182 IDWS-DIDAVYRTNREETKDLAFQLFCSEAGYMRYYPAASWFWDNQDEHLDLFDCRNTEWYINSATNSKNVLIMLDMSGSMLGQRYEVAKQTTEAILETLSHNDYFNIMTFSKNTFLLDG-----------CNGTNGLLQATMRNKKALRRKMDTYQSEGKAEYEKALPLAFSVLLDINNGGGDNNRGACENVIMLITDG----------APNAYKK------------------IFDMYNADKKV--RVFTFLVGDEAIDFNEVREMACNNRGYMVHVANMADVDEKIHHYIRRMSRVVGRHYKESGQLSWWTGVYRERLYLPRPEIFAEPVPITNQSFAVMNKMASRRKIRLQKSEARSRMFVTTVSYPVIVNE--TFMGVAAVNIPLTEVAQKSHPANIGSKSYFFMLDQNGFVMTHPQLR 561          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Ensembl Celegans
Match: unc-36 (Voltage-dependent calcium channel unc-36 [Source:UniProtKB/Swiss-Prot;Acc:P34374])

HSP 1 Score: 83.9593 bits (206), Expect = 6.506e-16
Identity = 49/175 (28.00%), Postives = 92/175 (52.57%), Query Frame = 3
Query:  690 VHWTYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREWSSNFVGFYTD-YDPRVRAWYITATSGPKDVIILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVICARNSHWDEIGKWHLYKSHALSCR-PDSLVAATIAHRKDLIESIDNLVPGGTSELETGFELAFDLL 1208
            + W+  ++ + + N +E   + +Q F S AG +R +P   W  +    + D +D R   WYI + +  K+V+I++D S SM G+++ +AK+ ++AI++TL+ +DY N++    + +   G           C   + L+ AT+ ++K L   +D     G +E E    LAF +L
Sbjct:  182 IDWS-DIDAVYRTNREETKDLAFQLFCSEAGYMRYYPAASWFWDNQDEHLDLFDCRNTEWYINSATNSKNVLIMLDMSGSMLGQRYEVAKQTTEAILETLSHNDYFNIMTFSKNTFLLDG-----------CNGTNGLLQATMRNKKALRRKMDTYQSEGKAEYEKALPLAFSVL 344          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Ensembl Fly
Match: Ca-Ma2d (gene:FBgn0261999 transcript:FBtr0303797)

HSP 1 Score: 147.517 bits (371), Expect = 2.575e-35
Identity = 139/552 (25.18%), Postives = 240/552 (43.48%), Query Frame = 3
Query:  312 LNGIRKDVTQSLFDQAKYK-----LEIKDGMEIVKDISEQLGSYLFNRKKAALRIANAAVEIYDMNKRRKGNFSY---EFLKDLPTNEVMDSDNPKSLPP-----------MTFN---SYFKQNVTEKHSTIKIADEVPRSLNTTIFTVHWTYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREWSSNFVGF--YTDYDPRVRAWYITATSGPKDVIILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVICARNSHWDEIGKWHLYKSHALSCRPDSLVAAT---IAHRKDLIESIDNLVPGGTSELETGFELAFDLLK-------SVPRTGCQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTNMGLTVPARIFSYLVKDDGEMLP--GSIACGHGGSMRKIVYGENIISQLSNYFEFLAK--VTQKKEG--LWTSPYIDSL---------GTGLLITHAVPAI---------STEDGTLLGVAGVDVTLEEIEMLIARYQWG-SMTSFFINNKGNVIFHPLLK 1790
            L  + + +T+S   + KYK     +E+K+G E++K I++ +G  L  RK  A+R      E   +N+  + N +Y    F          + ++ + L P           M  N    ++   V  +HS++ +   +       + T+ W+  L+E+ ++N + D  + WQYFGS  G+LR +P  +W+           YD R R+WYI   +  KD++IL+D S SMTG +  +AK   ++I+ T + +D+  ++           ++    +  + C   +LV AT   I      IE +D+  P G + L   +E AF LL+        V  + C   I+ +TDG                 +G       KYNW       N  N    +  R+F+YL+  +   +     +AC + G    +   + +  ++  Y + +A   V Q ++    WT  + D              L+I+  VPA          +     LLGVAG DV +E+I+ L   Y+ G +  SF ++N G V+ HP L+
Sbjct:   66 LFALAQKITKSQEIKEKYKEYNARVELKNGTELIKSITKNVGRML-ARKMDAVRCIQERAEY--VNENFEFNLTYALQNFTYFSSKYSTFNGNSSEELEPNEAEFAWMYRNMELNPDTHFYNTPVDTEHSSVHVPSNIWDRSERVLKTIMWSEHLDEVFRQNYQSDPALSWQYFGSDTGILRHYPAAQWTDTRPNRDDADTYDCRKRSWYIETATCSKDIVILLDHSGSMTGFRHHVAKFTIRSILDTFSNNDFFTIL-----------RYSSEVNDIIPCFNGALVQATPENIEVFNQQIEQLDD--PEGYANLTLAYETAFQLLRKYYDSRHCVTNSTCNQAIMLVTDG----------------VAGNTTEVFQKYNWG------NGENGTSQMDTRVFTYLLGKEVTKVREIQWMACLNRGYYSHVQTLDEVHEEVLKYVDVIATPLVLQNEQHPPTWTHAFTDKTYDPKTSNEKRPRLMISVGVPAFDRFYRHANSTNPRARLLGVAGTDVPVEDIDKLTLPYKLGVNGYSFVVSNNGYVLLHPDLR 579          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Ensembl Fly
Match: Ca-Ma2d (gene:FBgn0261999 transcript:FBtr0332356)

HSP 1 Score: 147.517 bits (371), Expect = 2.575e-35
Identity = 139/552 (25.18%), Postives = 240/552 (43.48%), Query Frame = 3
Query:  312 LNGIRKDVTQSLFDQAKYK-----LEIKDGMEIVKDISEQLGSYLFNRKKAALRIANAAVEIYDMNKRRKGNFSY---EFLKDLPTNEVMDSDNPKSLPP-----------MTFN---SYFKQNVTEKHSTIKIADEVPRSLNTTIFTVHWTYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREWSSNFVGF--YTDYDPRVRAWYITATSGPKDVIILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVICARNSHWDEIGKWHLYKSHALSCRPDSLVAAT---IAHRKDLIESIDNLVPGGTSELETGFELAFDLLK-------SVPRTGCQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTNMGLTVPARIFSYLVKDDGEMLP--GSIACGHGGSMRKIVYGENIISQLSNYFEFLAK--VTQKKEG--LWTSPYIDSL---------GTGLLITHAVPAI---------STEDGTLLGVAGVDVTLEEIEMLIARYQWG-SMTSFFINNKGNVIFHPLLK 1790
            L  + + +T+S   + KYK     +E+K+G E++K I++ +G  L  RK  A+R      E   +N+  + N +Y    F          + ++ + L P           M  N    ++   V  +HS++ +   +       + T+ W+  L+E+ ++N + D  + WQYFGS  G+LR +P  +W+           YD R R+WYI   +  KD++IL+D S SMTG +  +AK   ++I+ T + +D+  ++           ++    +  + C   +LV AT   I      IE +D+  P G + L   +E AF LL+        V  + C   I+ +TDG                 +G       KYNW       N  N    +  R+F+YL+  +   +     +AC + G    +   + +  ++  Y + +A   V Q ++    WT  + D              L+I+  VPA          +     LLGVAG DV +E+I+ L   Y+ G +  SF ++N G V+ HP L+
Sbjct:   66 LFALAQKITKSQEIKEKYKEYNARVELKNGTELIKSITKNVGRML-ARKMDAVRCIQERAEY--VNENFEFNLTYALQNFTYFSSKYSTFNGNSSEELEPNEAEFAWMYRNMELNPDTHFYNTPVDTEHSSVHVPSNIWDRSERVLKTIMWSEHLDEVFRQNYQSDPALSWQYFGSDTGILRHYPAAQWTDTRPNRDDADTYDCRKRSWYIETATCSKDIVILLDHSGSMTGFRHHVAKFTIRSILDTFSNNDFFTIL-----------RYSSEVNDIIPCFNGALVQATPENIEVFNQQIEQLDD--PEGYANLTLAYETAFQLLRKYYDSRHCVTNSTCNQAIMLVTDG----------------VAGNTTEVFQKYNWG------NGENGTSQMDTRVFTYLLGKEVTKVREIQWMACLNRGYYSHVQTLDEVHEEVLKYVDVIATPLVLQNEQHPPTWTHAFTDKTYDPKTSNEKRPRLMISVGVPAFDRFYRHANSTNPRARLLGVAGTDVPVEDIDKLTLPYKLGVNGYSFVVSNNGYVLLHPDLR 579          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Ensembl Fly
Match: CG4587 (gene:FBgn0028863 transcript:FBtr0344773)

HSP 1 Score: 135.961 bits (341), Expect = 8.053e-32
Identity = 142/663 (21.42%), Postives = 283/663 (42.68%), Query Frame = 3
Query:  222 ENIPKNLDGTLYGDIYNWVDMIQNYIKQLALNGIRKDVTQSLFDQAKYKLEIKDGMEIVKDISEQLGSYLFNRKKAALRIANAAVE--IYDMNKRRKGNFSYEFLKDLPTNEVMD-------SDNPKSLPPMTFNSYFKQNVTEKHSTIKIADEVPRSLNTTIFTVHWTYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREWS-SNFVGFYTDYDPRVRAWYITATSGPKDVIILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVICARNSHWDEIGKWHLYKSHALSCRPDSLVAATIAHRKDLIESIDNLVPGGTSELETGFELAFDLLKSVPRTG----CQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTNMGLTVPARIFSYLVKDDGEMLPG--SIACGHGGSMRKIVYGENIISQLSNYFEFLAK---VTQKKEGLWTSPYIDSLGTG-----------LLITHAVPAI-----STEDGTLLGVAGVDVTLEEIEMLIARYQWG-SMTSFFINNKGNVIFHPLLKAS-------TTLEDDPIFIHIQSLE--QNKAGNPKDFSKVVDDMINMTAGNRRIIDGRRGTPKGDFKAGVKYDKMPL------EYYYAPLKHSNVYSIAIVLAD 2057
            E+IP N       ++ NW       + +      + +  +S F     +++ KDG+ ++++++ ++ +++  ++ A +R+ ++A +  + ++  + +        +      + +       +D  + +       + +  V    S+I +   V          + W+  L+ + + N ++D  + WQYFGS+ G LR FPG  W      G    +D R   W++ A S PKD++IL+D S SMT + F +    +  I+ TL + D++N+I      + E+ K        + C  D +V AT  + +++  ++  +    T+    G E AF LL    ++G    C   I+ +T+      ++V                + +YNW               +P RIF+YL+  D         +AC + G   +I   +    ++ +Y   +A+   + Q    +  SP   +  +G           L+ T + P       S     LLGV G DV +EEI  +I +++ G +  SF ++N G V++HP L+           L+     + I  LE  + + GN  +  ++  +++N   G+  +I  + G  + +F     YD           Y+Y P++ +  +++AIVL +
Sbjct:   32 EDIPHN-------EVRNWALKFGVDLWEFGRQFTKMNEIKSRFKDNDIEVKRKDGIILLRELAAEVKNFMDFKRNAVMRLMDSAEQAALSELEGQGQAESPMGGQQHYDARRINEYNADGKLADGARHMDIRFMRRFERLPVNLSLSSILVPHGVDLDEPDVKSALQWSGHLDPLFQNNLEQDPALSWQYFGSSTGFLRRFPGTAWPPEGSKGSKLIHDFRTHNWFVQAASSPKDIMILLDASSSMTEKSFDLGMATAFNILDTLGEDDFVNLIT-----FSEVVKT------PVPCFKDRMVRATPDNIQEIKSAVKAIKLQDTANFTAGLEYAFSLLHKYNQSGAGSQCNQAIMLITESTSESHKDV----------------IKQYNWPH-------------MPVRIFTYLIGSDSGSRSNLHDMACSNKGFFVQINDYDEARRKVIDYALVMARPMIMYQADHPVHWSPVFVAGKSGGLGRDSEYQRRLVTTVSTPVFDRRNHSVRVANLLGVVGTDVPIEEIRKVIPQHKLGPNGYSFIVDNNGRVLYHPDLRPLGDANQYIDQLKPKYASVDITELELPETEFGNNNEPIEINKNLLNEMRGD--MIKPKEG--ETEFTVMNHYDDSKRVSTRTHRYFYGPIEDT-PFTLAIVLPE 642          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Ensembl Fly
Match: CG4587 (gene:FBgn0028863 transcript:FBtr0344774)

HSP 1 Score: 135.961 bits (341), Expect = 8.053e-32
Identity = 142/663 (21.42%), Postives = 283/663 (42.68%), Query Frame = 3
Query:  222 ENIPKNLDGTLYGDIYNWVDMIQNYIKQLALNGIRKDVTQSLFDQAKYKLEIKDGMEIVKDISEQLGSYLFNRKKAALRIANAAVE--IYDMNKRRKGNFSYEFLKDLPTNEVMD-------SDNPKSLPPMTFNSYFKQNVTEKHSTIKIADEVPRSLNTTIFTVHWTYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREWS-SNFVGFYTDYDPRVRAWYITATSGPKDVIILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVICARNSHWDEIGKWHLYKSHALSCRPDSLVAATIAHRKDLIESIDNLVPGGTSELETGFELAFDLLKSVPRTG----CQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTNMGLTVPARIFSYLVKDDGEMLPG--SIACGHGGSMRKIVYGENIISQLSNYFEFLAK---VTQKKEGLWTSPYIDSLGTG-----------LLITHAVPAI-----STEDGTLLGVAGVDVTLEEIEMLIARYQWG-SMTSFFINNKGNVIFHPLLKAS-------TTLEDDPIFIHIQSLE--QNKAGNPKDFSKVVDDMINMTAGNRRIIDGRRGTPKGDFKAGVKYDKMPL------EYYYAPLKHSNVYSIAIVLAD 2057
            E+IP N       ++ NW       + +      + +  +S F     +++ KDG+ ++++++ ++ +++  ++ A +R+ ++A +  + ++  + +        +      + +       +D  + +       + +  V    S+I +   V          + W+  L+ + + N ++D  + WQYFGS+ G LR FPG  W      G    +D R   W++ A S PKD++IL+D S SMT + F +    +  I+ TL + D++N+I      + E+ K        + C  D +V AT  + +++  ++  +    T+    G E AF LL    ++G    C   I+ +T+      ++V                + +YNW               +P RIF+YL+  D         +AC + G   +I   +    ++ +Y   +A+   + Q    +  SP   +  +G           L+ T + P       S     LLGV G DV +EEI  +I +++ G +  SF ++N G V++HP L+           L+     + I  LE  + + GN  +  ++  +++N   G+  +I  + G  + +F     YD           Y+Y P++ +  +++AIVL +
Sbjct:   32 EDIPHN-------EVRNWALKFGVDLWEFGRQFTKMNEIKSRFKDNDIEVKRKDGIILLRELAAEVKNFMDFKRNAVMRLMDSAEQAALSELEGQGQAESPMGGQQHYDARRINEYNADGKLADGARHMDIRFMRRFERLPVNLSLSSILVPHGVDLDEPDVKSALQWSGHLDPLFQNNLEQDPALSWQYFGSSTGFLRRFPGTAWPPEGSKGSKLIHDFRTHNWFVQAASSPKDIMILLDASSSMTEKSFDLGMATAFNILDTLGEDDFVNLIT-----FSEVVKT------PVPCFKDRMVRATPDNIQEIKSAVKAIKLQDTANFTAGLEYAFSLLHKYNQSGAGSQCNQAIMLITESTSESHKDV----------------IKQYNWPH-------------MPVRIFTYLIGSDSGSRSNLHDMACSNKGFFVQINDYDEARRKVIDYALVMARPMIMYQADHPVHWSPVFVAGKSGGLGRDSEYQRRLVTTVSTPVFDRRNHSVRVANLLGVVGTDVPIEEIRKVIPQHKLGPNGYSFIVDNNGRVLYHPDLRPLGDANQYIDQLKPKYASVDITELELPETEFGNNNEPIEINKNLLNEMRGD--MIKPKEG--ETEFTVMNHYDDSKRVSTRTHRYFYGPIEDT-PFTLAIVLPE 642          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Ensembl Fly
Match: CG4587 (gene:FBgn0028863 transcript:FBtr0344775)

HSP 1 Score: 135.576 bits (340), Expect = 1.014e-31
Identity = 142/663 (21.42%), Postives = 283/663 (42.68%), Query Frame = 3
Query:  222 ENIPKNLDGTLYGDIYNWVDMIQNYIKQLALNGIRKDVTQSLFDQAKYKLEIKDGMEIVKDISEQLGSYLFNRKKAALRIANAAVE--IYDMNKRRKGNFSYEFLKDLPTNEVMD-------SDNPKSLPPMTFNSYFKQNVTEKHSTIKIADEVPRSLNTTIFTVHWTYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREWS-SNFVGFYTDYDPRVRAWYITATSGPKDVIILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVICARNSHWDEIGKWHLYKSHALSCRPDSLVAATIAHRKDLIESIDNLVPGGTSELETGFELAFDLLKSVPRTG----CQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTNMGLTVPARIFSYLVKDDGEMLPG--SIACGHGGSMRKIVYGENIISQLSNYFEFLAK---VTQKKEGLWTSPYIDSLGTG-----------LLITHAVPAI-----STEDGTLLGVAGVDVTLEEIEMLIARYQWG-SMTSFFINNKGNVIFHPLLKAS-------TTLEDDPIFIHIQSLE--QNKAGNPKDFSKVVDDMINMTAGNRRIIDGRRGTPKGDFKAGVKYDKMPL------EYYYAPLKHSNVYSIAIVLAD 2057
            E+IP N       ++ NW       + +      + +  +S F     +++ KDG+ ++++++ ++ +++  ++ A +R+ ++A +  + ++  + +        +      + +       +D  + +       + +  V    S+I +   V          + W+  L+ + + N ++D  + WQYFGS+ G LR FPG  W      G    +D R   W++ A S PKD++IL+D S SMT + F +    +  I+ TL + D++N+I      + E+ K        + C  D +V AT  + +++  ++  +    T+    G E AF LL    ++G    C   I+ +T+      ++V                + +YNW               +P RIF+YL+  D         +AC + G   +I   +    ++ +Y   +A+   + Q    +  SP   +  +G           L+ T + P       S     LLGV G DV +EEI  +I +++ G +  SF ++N G V++HP L+           L+     + I  LE  + + GN  +  ++  +++N   G+  +I  + G  + +F     YD           Y+Y P++ +  +++AIVL +
Sbjct:   32 EDIPHN-------EVRNWALKFGVDLWEFGRQFTKMNEIKSRFKDNDIEVKRKDGIILLRELAAEVKNFMDFKRNAVMRLMDSAEQAALSELEGQGQAESPMGGQQHYDARRINEYNADGKLADGARHMDIRFMRRFERLPVNLSLSSILVPHGVDLDEPDVKSALQWSGHLDPLFQNNLEQDPALSWQYFGSSTGFLRRFPGTAWPPEGSKGSKLIHDFRTHNWFVQAASSPKDIMILLDASSSMTEKSFDLGMATAFNILDTLGEDDFVNLIT-----FSEVVK------TPVPCFKDRMVRATPDNIQEIKSAVKAIKLQDTANFTAGLEYAFSLLHKYNQSGAGSQCNQAIMLITESTSESHKDV----------------IKQYNWPH-------------MPVRIFTYLIGSDSGSRSNLHDMACSNKGFFVQINDYDEARRKVIDYALVMARPMIMYQADHPVHWSPVFVAGKSGGLGRDSEYQRRLVTTVSTPVFDRRNHSVRVANLLGVVGTDVPIEEIRKVIPQHKLGPNGYSFIVDNNGRVLYHPDLRPLGDANQYIDQLKPKYASVDITELELPETEFGNNNEPIEINKNLLNEMRGD--MIKPKEG--ETEFTVMNHYDDSKRVSTRTHRYFYGPIEDT-PFTLAIVLPE 642          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Ensembl Zebrafish
Match: CACNA2D1 (si:dkey-266j7.2 [Source:ZFIN;Acc:ZDB-GENE-060503-162])

HSP 1 Score: 192.971 bits (489), Expect = 1.563e-49
Identity = 206/845 (24.38%), Postives = 364/845 (43.08%), Query Frame = 3
Query:  264 IYNWVDMIQNYIKQLALNGIRKDVTQSLF--DQAKYKLEIKDGMEIVKDISEQLGSYLFNRKKAALRIANAAVEIYDMNKRRKGNFSYEFL-----KDLPTNEVMDSDNPKSLPPMTFNSYFKQNVTE-KHSTIKIADEVPRSLNTTIFTVHWTYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREW--SSNFVGFYTDYDPRVRAWYITATSGPKDVIILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVICARNSHWDEIGKWHLYKSHALSCRPDSLVAATIAHRKDLIESIDNLVPGGTSELETGFELAFDLLK--SVPRTGCQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTNMGLTVPARIFSYLVK----DDGEMLPGSIACGHGGSMRKIVYGENIISQLSNYFEFLAK---VTQKKEGLWTSPYIDSLGTGLLITHAVPAIS----------TEDGTLLGVAGVDVTLEEIEMLIARYQWGSMTSFF-INNKGNVIFHPLLKASTTLEDDPIFIHIQSLEQNKAGNPKDFSKVVDDMINMTAGNRRIIDGRRGTPKGDFKAGVKYDKMPLEYYYAPLKHSNVYSIAIVLADTDKVFRRLEEPSNISQPVPSFFNLLIEYNSTKVLKEYPNIFKELDVRFNETKYPMLRVTYNYSSIFFAPSVHCDPSKYFFDDDLAQKTLDAHRYMNELTHNSDPGCDVPEGKYAQGTRAYV--LVTESIENQWKSRNFESIDEVTWTYVGMRSGVFRTYPGH------RSTRLYDPTKRPWYRRTLANPTKISISTPYFD---AAGSGKIITISQAV 2675
            I  WVD +Q  +  LA      D  + +F  +Q  + +   + +++V+  +  + ++L  R  A   +A AA E + M  + K  F+ + +      +L TN+     N +  P    +  FK  +T   H+ + I  ++       +  ++WT  LE++ K+N +ED  + WQ FGS  G+ R +P   W  +         YD R R WY+   + PKD++IL+D S S++G    + +     +++TL+  DY+NV+     H++        K +  +C  D LV A + ++K L +++ N+   G +    GFE AF+ L   ++ R  C  II+  TDG +   E +      ++R                H+I  K         R+F++ V     D G +    +AC + G   +I     I      Y + L +   +   K+  WT+ Y+D+L  GL+IT  +P  +          +++  +LGV GVDV+L++I+ L  R+  G    +F I+  G V+ HP L+        P       + Q       D+  +   MIN ++G + I    +   +     G++      +Y +AP+  ++ YS+A+VL +    +        I Q       ++ EY    + +E          +F E  Y            F AP  +C   K   ++   Q  +D + Y+N+ T N DP C+     Y    R  +   +T  +   WK    +S+D V   +V    G+ R YP         ++  YD +   +Y+R+L N   I  + PY +    +G    I +S+AV
Sbjct:   19 IKEWVDQLQQELVSLADTASAGDNLRQIFMDNQKSFTVRSNNAVQLVETAARNIENFLKKRATALETLATAA-ENFQMEHQWKDEFADDIVYFNAKDNLETNDTEGRKN-RIRPEFKEDPSFKNRLTSYNHTAVHIPTDIYDGSTIVLNELNWTEALEDVFKKNREEDPTLLWQVFGSATGLARFYPASPWMDARKTPSKIDLYDVRRRPWYVQGAASPKDMLILVDASGSVSGLTLKLIRTSVSEMLETLSDDDYVNVV-----HFNT-------KVNNTACF-DHLVQANVRNKKILKDAVQNITAKGITNYTKGFEFAFNQLSNPNISRANCNKIIMLFTDGGEERAEEI------FSR----------------HNIDRK--------VRVFTFSVGQHNYDTGPI--KWMACQNKGYFYEIPSIGAIRINTQEYLDVLGRPMVLADAKQVQWTNVYLDALELGLVITGTLPVFNKTKSTEARSRSQNQLILGVMGVDVSLDDIKRLTPRFTIGPNGYYFAIDPNGYVLLHPNLQ--------PKVPKTPRVHQ-------DYLDIRTMMINNSSGEKTIETLVKSQDERYIDRGIR------KYTWAPVNGTD-YSLALVLPEYSLHYIEANLGDTIKQ-------VMCEYLFETIQQE----------KFEEFGY-----------TFIAPREYCKDLKVSSNN--TQFLMDFNEYINKQTPN-DPTCN-----YTLVNRMLLDAGLTAKLIKVWKE---QSVDGVLARFVATDGGITRVYPKSAGEEWGENSETYDSS---FYKRSLDNDIYI-FTAPYVNKSRESGYESGILVSKAV 751          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Ensembl Zebrafish
Match: cacna2d2b (calcium channel, voltage-dependent, alpha 2/delta subunit 2b [Source:ZFIN;Acc:ZDB-GENE-060503-99])

HSP 1 Score: 180.644 bits (457), Expect = 1.278e-45
Identity = 193/786 (24.55%), Postives = 342/786 (43.51%), Query Frame = 3
Query:  390 EIVKDISEQLGSYLFNRKKAALRIANAAVEIYDMNKRRKG----NFSYEFLKDLPTNEVMDSDNPKSLP-PMTFNSYFKQNVTEKHSTIKIADEVPRSLNTTIFTVHWTYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREWSS-NFVGFYTDYDPRVRAWYITATSGPKDVIILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVICARNSHWDEIGKWHLYKSHALSCRPDSLVAATIAHRKDLIESIDNLVPGGTSELETGFELAFDLL---KSVPRTGCQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTNMGLTVPARIFSYLV-KDDGEMLPGS-IACGHGGSMRKIVYGENIISQLSNYFEFLAKVTQ-----KKEGLWTSPYIDSLGTGLLITHAVPAIS------TEDGTLLGVAGVDVTLEEIEMLIARYQWGSMTSFF-INNKGNVIFHPLLKASTTLEDDPIFIHIQSLEQNKAGNPKDFSKVVDDMINMTAGNRRIIDGRRGTP------KGDFKAGVKYDKMPLEYYYAPLKHSNVYSIAIVLADTDKVFRRLEEPSNISQPVPSFFNLLIEYNSTKVLKEYPNIFKELDVRFNETKYPMLRVTYNYSSIFFAPSVHCDPSKYFFDDDLAQKTLDAHRYMNELTHNSDPGCDVPEGKYAQGTRAYVLVTESIENQWKSRNFESIDEVTWTYVGM----RSGVFRTYPGHRSTRLYDPTKRP----WYRRTLAN-------PTKISI 2615
            +IV+ ++  +   L  ++KA  R+A+ A  +   ++ + G    N  Y   K     +  D D+  SL     ++  FK  V   H+ ++I  ++ +     +  ++WT  LE +  EN+++D  + WQ FGS  GV R +P   W + + +     YD R R WYI   S PKD++IL+D S S++G    + K     ++ TL+  DY+NV     + ++E       K+ A+    D LV A + ++K   E++  +   GT++ ++GF  AF+ L    +VPR  C  II+  TDG +   +++                  +YNW       NKT        R+F++ V + + ++ P   IAC + G   +I     I      Y + L +         K+  WT+ Y D+LG GL++T  +P  +      +++  +LGV GVDV L+E++ L  +Y+ G+    F I+  G V+ HP L+     ED P  + +  L+     + K   +            R++IDGR G        K   +A    D +   Y + P+  ++ YS+ +VL                    P +    I+ + + V+ +   +   L   F    +           +F AP  +C   +    ++  Q  +D    M E++  S+  CD       QG    +++   I  Q  +R +++ D  T+ ++ +      GV R YP + +   +D    P    +YRR+L N       PT+ S+
Sbjct:   43 DIVEKVATDIERLLAKKRKALERLASEAERLQKEHRWQDGIKEENIEYYNSKAEMDYDGEDIDSQMSLKLDFVYDPSFKNQVNYSHTAVQIPTDIYKGAPVILNELNWTQALERVFIENSRDDPSLLWQAFGSATGVTRYYPAAPWRAPDKIDL---YDVRRRPWYIQGASSPKDMVILVDVSGSVSGLTLKLIKASVTEMLDTLSDDDYVNV-----ARFNE-------KAEAVVPCFDHLVQANVRNKKIFKEAVQQMQAKGTTDYKSGFHFAFNQLLNKTNVPRANCNKIIMLFTDGGEDRAQDI----------------FEQYNWP------NKT-------VRVFTFSVGQHNYDVTPLQWIACSNKGYYFEIRSICAIRINTQEYLDVLGRPMVLAGRIAKQVQWTNVYQDALGLGLVVTGTMPVFNLTVNGDSQNQLILGVMGVDVHLDELKRLTPQYKLGANGYIFAIDPNGYVLMHPNLQPRE--EDLPEQVTLDFLDAEVEDSSKQEIR------------RQMIDGRSGDMTIKTLIKSMDEASRYIDDVTRMYTWTPINDTD-YSLGLVL--------------------PPYSEHYIQADLSDVMLQLQYLQSLLPNSFESAGH-----------VFLAPRDYC--RRLHISENNTQFLVDFLSLMVEISPESE-DCD-------QGLIHNLILDSGILWQLATRVWQNKDLGTYGFLALFASTNGGVTRVYP-NMAAESWDEDPEPLNSNFYRRSLDNKGYIFRAPTRTSM 727          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Ensembl Zebrafish
Match: cacna2d2b (calcium channel, voltage-dependent, alpha 2/delta subunit 2b [Source:ZFIN;Acc:ZDB-GENE-060503-99])

HSP 1 Score: 180.259 bits (456), Expect = 1.836e-45
Identity = 194/781 (24.84%), Postives = 342/781 (43.79%), Query Frame = 3
Query:  390 EIVKDISEQLGSYLFNRKKAALRIANAAVEIYDMNKRRKGNFSYEFLKDLPTNEVMDSDNPKSLPPMTFNSYFKQNVTEKHSTIKIADEVPRSLNTTIFTVHWTYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREWSS-NFVGFYTDYDPRVRAWYITATSGPKDVIILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVICARNSHWDEIGKWHLYKSHALSCRPDSLVAATIAHRKDLIESIDNLVPGGTSELETGFELAFDLL---KSVPRTGCQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTNMGLTVPARIFSYLV-KDDGEMLPGS-IACGHGGSMRKIVYGENIISQLSNYFEFLAKVTQ-----KKEGLWTSPYIDSLGTGLLITHAVPAIS------TEDGTLLGVAGVDVTLEEIEMLIARYQWGSMTSFF-INNKGNVIFHPLLKASTTLEDDPIFIHIQSLEQNKAGNPKDFSKVVDDMINMTAGNRRIIDGRRG--TPKGDFK----AGVKYDKMPLEYYYAPLKHSNVYSIAIVLADTDKVFRRLEEPSNISQPVPSFFNLLIEYNSTKVLKEYPNIFKELDVRFNETKYPMLRVTYNYSSIFFAPSVHCDPSKYFFDDDLAQKTLDAHRYMNELTHNSDPGCDVPEGKYAQGTRAYVLVTESIENQWKSRNFESIDEVTWTYVGM----RSGVFRTYPGHRSTRLYDPTKRP----WYRRTLAN-------PTKISI 2615
            +IV+ ++  +   L  ++KA  R+A+ A  +   ++ + G      +KD    E +DS     L    ++  FK  V   H+ ++I  ++ +     +  ++WT  LE +  EN+++D  + WQ FGS  GV R +P   W + + +     YD R R WYI   S PKD++IL+D S S++G    + K     ++ TL+  DY+NV     + ++E       K+ A+    D LV A + ++K   E++  +   GT++ ++GF  AF+ L    +VPR  C  II+  TDG +   +++                  +YNW       NKT        R+F++ V + + ++ P   IAC + G   +I     I      Y + L +         K+  WT+ Y D+LG GL++T  +P  +      +++  +LGV GVDV L+E++ L  +Y+ G+    F I+  G V+ HP L+     ED P  + +  L+     + K   +            R++IDGR G  T K   K    A    D +   Y + P+  ++ YS+ +VL                    P +    I+ + + V+ +   +   L   F    +           +F AP  +C   +    ++  Q  +D    M E++  S+  CD       QG    +++   I  Q  +R +++ D  T+ ++ +      GV R YP + +   +D    P    +YRR+L N       PT+ S+
Sbjct:   44 DIVEKVATDIERLLAKKRKALERLASEAERLQKEHRWQDG------IKD---GEDIDSQMSLKLD-FVYDPSFKNQVNYSHTAVQIPTDIYKGAPVILNELNWTQALERVFIENSRDDPSLLWQAFGSATGVTRYYPAAPWRAPDKIDL---YDVRRRPWYIQGASSPKDMVILVDVSGSVSGLTLKLIKASVTEMLDTLSDDDYVNV-----ARFNE-------KAEAVVPCFDHLVQANVRNKKIFKEAVQQMQAKGTTDYKSGFHFAFNQLLNKTNVPRANCNKIIMLFTDGGEDRAQDI----------------FEQYNWP------NKT-------VRVFTFSVGQHNYDVTPLQWIACSNKGYYFEIRSICAIRINTQEYLDVLGRPMVLAGRIAKQVQWTNVYQDALGLGLVVTGTMPVFNLTVNGDSQNQLILGVMGVDVHLDELKRLTPQYKLGANGYIFAIDPNGYVLMHPNLQPRE--EDLPEQVTLDFLDAEVEDSSKQEIR------------RQMIDGRSGDMTIKTLIKSMDEASRYIDDVTRMYTWTPINDTD-YSLGLVL--------------------PPYSEHYIQADLSDVMLQLQYLQSLLPNSFESAGH-----------VFLAPRDYC--RRLHISENNTQFLVDFLSLMVEISPESE-DCD-------QGLIHNLILDSGILWQLATRVWQNKDLGTYGFLALFASTNGGVTRVYP-NMAAESWDEDPEPLNSNFYRRSLDNKGYIFRAPTRTSM 713          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Ensembl Zebrafish
Match: cacna2d4a (calcium channel, voltage-dependent, alpha 2/delta subunit 4a [Source:ZFIN;Acc:ZDB-GENE-041210-213])

HSP 1 Score: 176.022 bits (445), Expect = 6.599e-45
Identity = 162/625 (25.92%), Postives = 272/625 (43.52%), Query Frame = 3
Query:  291 NYIKQLALNGIRKDVTQSLFDQAKYK-------LEIKDGMEIVKDISEQLGSYLFNRKKAALRIANAAVEIYDMNKRRKGNFSYEFLKDLPTNEVMDSDNPKSLP---PMTFNSYFKQ-NVTEKHSTIKIADEVPRSLNTTIFTVHWTYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREWSSNFVGFYTDYDPRVRAWYITATSGPKDVIILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVICARNSHWDEIGKWHLYKSHALSCRPDSLVAATIAHRKDLIESIDNLVPGGTSELETGFELAFDLLKSVPRTG----CQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTNMGLTVPARIFSYLVKDDGEMLPGS--IACGHGGSMRKIVYGENIISQLSNYFEFLAK---VTQKKEGLWTSPYIDSLGTGLLI--THAVPAISTED-----GTLLGVAGVDVTLEEIEMLIARYQWGSMTSFFIN-NKGNVIFHPLLKASTTLEDDPIFIHIQSLEQNKAGNPKDFSKV----VDDMINMTAGNRRIIDGRRGTPKGDFKAGVKYDK----MPLEYYYAPLKHSNVYSIAIVLAD 2057
            N+ KQL     R    Q L  Q KYK       +E  DG+++VK+ +E++ + L  + K+  R+A  A E  D          +++   +  N + +  N   L    P+  N +F    V  + S +++   V       +  V  +  L +I   N ++D  + WQYFGS+ G  RL+PG +W+ +  G  T +D R R WYI A + PKD+II +D S SM G + +IAK     I+ TL ++D++NVI   +           Y  +   C   +LV A + +R+     +  L   G  +++   + +F +L      G    C   I+ +TDG   D + V                  ++NW                  R+F+YL+  +         IAC + G    I    ++   +  Y   L++   +    + +WT  Y+DS+   LL+  + A+P  S ++     G LLGV G DV L+E+  L  RY+ G     F+N N G ++ HP L+        P++   + L+     N  D S+V     +D +        ++ G  GT   D +A V+  K    +  EY+Y  +  +  +S+ IVL +
Sbjct:    8 NFGKQLMALSNRYSGAQLL--QKKYKEVEPIVKMEEIDGLKMVKEFAEEMENMLGRKMKSVKRMAETA-EDADFYHEFNATLEFDYYNSMLINTLNEDGNNIELGGEFPLEENEHFNNLPVNTQQSVVQVPTNVYNKDPDILNGVFMSEALNDIFISNFEKDPTLTWQYFGSSTGFFRLYPGIKWTPDENGVVT-FDGRNRNWYIQAATSPKDIIIAVDISGSMKGLRLTIAKHTINTILDTLGENDFVNVIAYSD-----------YVQYVEPCFKGTLVQADLDNREHFKLLVQELQVKGEGKVKKAMKESFKILNEAAAEGRGSLCNQAIMLITDGAMEDFQQV----------------FEEFNWPDRK-------------VRVFTYLIGRELTFASNVKWIACNNKGYYTHISTLADVQENVMEYLHVLSRPMVINHDHDIIWTEAYMDSVAESLLLMTSVAMPVFSKKEETLSHGILLGVVGTDVPLKELMRLAPRYKLGVHGYAFLNTNNGYILSHPDLR--------PLYKDGKKLKPKPNYNSVDLSEVEWEDTEDALRTA-----MVKGETGTISLDVRATVEKGKRVVFLKNEYFYTTINETP-FSLGIVLTN 574          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Ensembl Zebrafish
Match: CACNA2D3 (calcium channel, voltage-dependent, alpha 2/delta subunit 3a [Source:NCBI gene;Acc:100535196])

HSP 1 Score: 174.096 bits (440), Expect = 1.610e-43
Identity = 139/543 (25.60%), Postives = 238/543 (43.83%), Query Frame = 3
Query:  252 LYGDIYNWVDMIQNYIKQLALNGIRKDVTQSLFDQAKYKLEIK--DGMEIVKDISEQLGSYLFNRKKAALRIANAAVEIYDMNKRRKGNFSYEFLKDLPTNEVMDSDNPKSL-------PPMTFNSYFKQNVTEKHSTIKIADEVPRSLNTTIFTVHWTYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREWSSNFVGFYTDYDPRVRAWYITATSGPKDVIILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVIC-ARNSHWDEIGKWHLYKSHALSCRPDSLVAATIAHRKDLIESIDNLVPGGTSELETGFELAFDLLKSVPRTG----CQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTNMGLTVPARIFSYLVKDDGEMLPGS--IACGHGGSMRKIVYGENIISQLSNYFEFLAK---VTQKKEGLWTSPYI-----DSLGTGLLITHAVPAISTED-----GTLLGVAGVDVTLEEIEMLIARYQWGSMT-SFFINNKGNVIFHPLLK 1790
            L+  +  W       IK +A       + Q  + + +  + ++  DG+++VK ++ ++      + +A  R+  AA E + +N     +  YE+   +  NE+ +      L       P   FN+    +V    S +++   +    +  +  V+W+  L  +  +N K D  + WQYFGS  G  R +PG +W+ +  G   ++D R R WYI A + PKDV+IL+D S SM G + +IA++   +I+ TL   D+ NVI    + H+ E             C   +LV A I ++    + +D L+  G   L+     AF+LL +  +TG    C   I+ +TDG     + V                   YNW                  R+F YL+  +         +AC + G   +I    ++   +  Y   L++   + ++ + +WT  YI     D+ G  L+ T A+P  ST++     G LLGV G DV + EI   I +Y+ G    +F I N G ++ HP L+
Sbjct:   30 LHSSVKLWASAFGGEIKSIAAKYSGSQLLQKKYKEFERSVRVEEIDGIKLVKKLAAKMEQRFHKKAEAIKRLVEAAEEAH-LNHEEDPDLQYEYFNAVLINELDEEGRSVELGGEFILQPNEHFNNL---SVNLSLSVVQVPTNMYNKDSDIVNGVYWSEALNTVFVDNFKRDPSLLWQYFGSAQGFFRQYPGMKWTPDEHGVL-EFDCRNRKWYIQAATSPKDVVILVDVSGSMKGLRLTIARQTVSSILDTLGDDDFFNVIAYNEDLHYVE------------PCLNGTLVQADITNKDHFRQRLDKLLAKGIGMLDVALTEAFELLSNFNQTGRGSECSQAIMLVTDGAVETYDAV----------------FAVYNWPD-------------RKVRVFPYLIGRESAFADNLKWMACANKGYFTQISTLADVQENVMKYLHVLSRPKVIDREHDMVWTEAYIDNTLEDAQGPVLMTTVAMPVFSTKNETRNKGILLGVVGTDVPVSEILKAIPKYKLGIHGYAFAITNNGYILTHPDLQ 526          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Ensembl Xenopus
Match: cacna2d1 (calcium channel, voltage-dependent, alpha 2/delta subunit 1 [Source:NCBI gene;Acc:100036724])

HSP 1 Score: 186.037 bits (471), Expect = 4.056e-47
Identity = 151/572 (26.40%), Postives = 259/572 (45.28%), Query Frame = 3
Query:  264 IYNWVDMIQNYIKQLALNGIRKDVTQSLF--DQAKYKLEIKDGMEIVKDISEQLGSYLFNRKKAALRIANAAVEIYDMNKRRK----GNFSYEFLKDL---PTNEVMDSDNPKSLPPMTFNSYFKQNVTEKHSTIKIADEVPRSLNTTIFTVHWTYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREW--SSNFVGFYTDYDPRVRAWYITATSGPKDVIILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVICARNSHWDEIGKWHLYKSHALSCRPDSLVAATIAHRKDLIESIDNLVPGGTSELETGFELAFDLL--KSVPRTGCQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTNMGLTVPARIFSYLVK----DDGEMLPGSIACGHGGSMRKIVYGENIISQLSNYFEFLAKVT-----QKKEGLWTSPYIDSLGTGLLITHAVPAIS-------TEDGTLLGVAGVDVTLEEIEMLIARYQWGSMTSFF-INNKGNVIFHPLLKASTTLEDDPIFIHIQSLEQNKAGNPKDFSKVVD 1889
            I  WV+ +QN +  LA      D    ++  ++  Y +E  +  ++V+  +  +   L NR KA + +A  A EI + ++ R      +  Y   KD    P     DS + K  P +  +  F++  + +HS + I  ++       +  ++WT  L+E+ K+N +ED  + WQ FGS  G+ R +P   W   S        YD R R WYI   + PKD++IL+D S S++G    + +     +++TL+  D++NV    N+            +H +SC  + LV A + ++K L E+++N+   GT++ +TGF+ AFD L   +V R  C  II+  TDG    GE+                        K        N   TV  R+F++ V     D G +    +AC + G   +I     I      Y + L +       + K+  WT+ Y+D+L  GL+IT  +P  +        ++  +LGV GVDV+LE+I+ L  R+       +F ++  G V+ HP L+       +P+ +     E       +  +K++D
Sbjct:   33 IKQWVEKMQNDLVTLARTASGVDQLSEIYLKNRHLYTVEANNARQLVQSAATNIEKLLRNRSKALVHLAKKAEEIQESHQWRDQFGTNSIVYYNAKDDQMDPEKNDSDSASQKIKPVLQDDPVFRRQTSYQHSAVHIPTDIYEGSTIVLNELNWTAALDEVFKKNREEDETLLWQVFGSATGLARYYPASPWVDKSRTANKIDLYDVRRRPWYIQGAASPKDMLILVDVSGSVSGLTLKLIRTSVSEMLETLSDDDFVNVAAFNNN------------AHDVSCF-NHLVQANVRNKKKLKEAVNNITAKGTTDYKTGFKFAFDQLLNHNVSRANCNKIIMLFTDG----GED------------------------KAKETFEAYNKDKTV--RVFTFSVGQHNYDKGPI--QWMACQNKGFYYEIPSIGAIRINTQEYLDVLGRPMVLAGDKAKQVQWTNVYLDALELGLVITGTLPVFNLTVDHNGKKNQLILGVMGVDVSLEDIKRLTPRFTLCPNGYYFALDPNGYVLLHPNLQPKDLKSQEPVTLDFLDAELENDHKVEIRTKMID 559          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Ensembl Xenopus
Match: CACNA2D4 (calcium channel, voltage-dependent, alpha 2/delta subunit 4 [Source:NCBI gene;Acc:100488361])

HSP 1 Score: 174.096 bits (440), Expect = 1.962e-43
Identity = 167/626 (26.68%), Postives = 276/626 (44.09%), Query Frame = 3
Query:  258 GDIYNWVDMIQNYIKQLALNGIRKDVTQSLFDQAKYKLEIKDGMEIVKDISEQLGSYLFNRKKAALRIANAAVEIYDMNKRRKGNFSYEFLKDLPTNEVMDSDNPKSLPP---MTFNSYFKQ-NVTEKHSTIKIADEVPRSLNTTIFTVHWTYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREWSSNFVGFYTDYDPRVRAWYITATSGPKDVIILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVICARNSHWDEIGKWHLYKSHALSCRPDSLVAATIAHRKDLIESIDNLVPGGTSELETGFELAFDLLKSVPRTG----CQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTNMGLTVPARIFSYLVKDDGEMLPGS--IACGHGGSMRKIVYGENIISQLSNYFEFLAK---VTQKKEGLWTSPYIDSLGTGLLITH-AVPAISTE-----DGTLLGVAGVDVTLEEIEMLIARYQWGSMTSFFIN-NKGNVIFHPLLKASTTLEDDPIFIHIQSLEQNKAGNPKDFSKVV---DDMINMTAGNRRIIDGRRGTPKGDFKAGVKYDKMPL----EYYYAPLKHSNVYSIAIVLA 2054
            G++Y+   ++  Y   L L    KDV  +L       +E  DG+E+VK  SE++ + L  + +A  ++  AA E  D++     +  +E+   +  NE  ++DN   L     +  N +F    V    S I++   V     + +  V+ +  L  I  +N + D  + WQYFGS++G  RL+PG +W  +  G  + +D R R WYI A + PKD++I++D S SM G + +IAK     ++ TL ++D++N+I   +           Y  +   C    LV A   +R+   + +D L   G   +      AF +LK     G    C   I+ +TDG   + E V                  KYN+                  R+F+YL+  +         IAC + G   +I    ++   +  Y   L++   +    + +WT  Y+DS  + LL+T  A+P  S +     +G LLGV G DV L E+  L  RY+ G     F+N N G ++ HP L+        P++   + L      N  D S+V     D I  TA    +I+G  G+   D K  V   K  L    +Y+Y  +  +  +S+ +VL+
Sbjct:   60 GEVYS---LVTRYSGSLLLQKKYKDVEPTL------SIEEVDGLELVKKFSEEMENMLRRKVEAVEKLVEAA-EDADLHHEFNTSLEFEYYNSVRINEKDENDNYVELGSEFILETNEHFNNLMVNTSLSNIQLPTNVYNKDPSILNGVYMSEALNPIFVDNFQRDPTLTWQYFGSSSGFFRLYPGIKWVPDENGVIS-FDCRNRGWYIQAATSPKDIVIVVDISGSMKGLRMTIAKHTISTLLDTLGENDFVNIIAYND-----------YVHYIEPCFKGILVQADRDNREHFKQLVDELHAKGVGTVNKALIEAFKILKEFREAGQGGLCNQAIMLITDGAVEEYEPV----------------FEKYNFPDRK-------------VRLFTYLIGREVTFSSNVKWIACNNKGYYTQISTLADVQENVMEYLHVLSRPMVINHDHDIIWTEAYMDSAQSLLLMTTVAMPVFSKKNETRSEGILLGVVGSDVPLRELLKLAPRYKLGVHGYAFLNTNNGYILSHPDLR--------PLYKEGKKLRPKPNYNSVDLSEVEWEDKDEILRTA----MINGETGSLTMDVKVPVDKGKRVLFLTSDYFYTHIDDTP-FSLGVVLS 621          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Ensembl Xenopus
Match: CACNA2D2 (calcium voltage-gated channel auxiliary subunit alpha2delta 2 [Source:NCBI gene;Acc:100038148])

HSP 1 Score: 171.4 bits (433), Expect = 1.446e-42
Identity = 201/811 (24.78%), Postives = 337/811 (41.55%), Query Frame = 3
Query:  339 QSLFDQAKYKLEIKDGM--EIVKDISEQLGSYLFNRKKAALRIANAAVEIYDMNKRRKGNFS------YEFLKDLPTNEVMDSDNPKSLPPMTF------NSYFKQNVTEKHSTIKIADEVPRSLNTTIFTVHWTYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREWSSNFVGFYTDYDPRVRAWYITATSGPKDVIILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVICARNSHWDEIGKWHLYKSHALSCRPDSLVAATIAHRKDLIESIDNLVPGGTSELETGFELAFDLLK--SVPRTGCQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTNMGLTVPARIFSYLV-KDDGEMLPGS-IACGHGGSMRKIVYGENIISQLSNYFEFLAKV-----TQKKEGLWTSPYIDSLGTGLLITHAVPAIS-TEDG-------TLLGVAGVDVTLEEIEMLIARYQWGSMTSFF-INNKGNVIFHPLLKASTTLEDDPIFIHIQSLEQNKAGNPKDFSKVVDDMINMTAGNRRIIDGRRGTPKGDFKAGVK------YDKMPLEYYYAPLKHSNVYSIAIVLADTDKVFRRLEEPSNISQPVPSFFNLLIEYNSTKVLKEYPNIFKELDVRFNETKYPMLRVTYNYSSIFFAPSVHCDPSKYFFDDDLAQKTLDAHRYMNELTHNSDPGCD--VPEGKYAQGTRAYVLVTES-IENQWKSRNFESIDEVTW----TYVGMRSGVFRTYPGHRS---TRLYDPTKRPWYRRTLANPTKISISTPY 2627
            + L++  +   E+K+ +  ++V+ ++  + S L  + +A  R+A AA E +    R + N        Y+   D    ++   + PK  P  +       +  FK  V   ++ ++I  ++ +     +  ++WT  LE++  +N  ED  + WQ FGS  GV R +P   W +        YD R R WYI   S PKD++I++D S S++G    + K     ++ TL+  DY+ V             +H  K+  +SC    LV A + ++K + E++  +V  GT++ + GFE AF  L+  S+ R  C  +I+  TDG +   ++V                  KYNW       NKT        R+F++ V + + ++ P   +AC + G   +I     I      Y + L +       + K+  WT+ Y D+LG GL++T  +P  + TED         +LGV G+DV L++I  L+ RY  G+    F I+  G V+ HP LK       +P+ +              DF     +  N     R++IDG  G  +   +  VK       D+    Y +AP+ HS  YS+ +VL      + R      I Q V  F +LL            PN F EL+ R                 +F AP  +C             K L+      E   N     +   P+ K+      + L+ ++ I      R ++  D +T+     +     G+ R +P   +       +P    +YRR+L N   I    PY
Sbjct:   65 RGLYNDKRNLFEVKENVPRKLVEKVAGDIESLLAKKVRALRRLAEAA-EKFQKAHRWQDNIREEDIEYYDSKADTEYEDLEGEEEPKE-PTHSLKIDFADDPNFKAKVNYNYTAVQIPTDIYKGSTVILNELNWTDALEDVFIQNRLEDPTLLWQVFGSATGVTRYYPATPWRAP--SKIDLYDVRRRPWYIQGASSPKDMVIIVDVSGSVSGLTLKLMKTSVMEMLDTLSDDDYVTV-----------ASFH-EKADPVSCF-RQLVQANVRNKKVIKEAVQEMVARGTTDYKAGFEYAFSQLQNTSITRANCNKMIMMFTDGGEDRVQDV----------------FEKYNWP------NKT-------VRVFTFSVGQHNYDVTPLQWMACANKGYYFEIPSIGAIRINTQEYLDVLGRPMVLAGNEAKQVQWTNVYQDALGLGLVVTGTLPVFNLTEDSGSAGKNQLILGVMGIDVALDDIRKLMPRYSLGANGYMFAIDLNGYVLLHPNLKPQIINFQEPVTL--------------DFLDAELEDENKEEIRRKMIDGLEG--QKTIRTLVKSLDERYIDEAERTYTWAPI-HSTNYSLGLVLPPYSSYYLRANLIDQILQ-VQYFESLL------------PNNF-ELEGR-----------------VFLAPRQYC-------------KELEQSDNNTEFLENFISLMEKVTPDSKHCDSFLLHNLILDTGITRDLADRVWKDKDLLTYGLLAVFAATDGGITRVFPNKAADDWIEDLEPHNATYYRRSLDNKGYI-FRAPY 767          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Ensembl Xenopus
Match: CACNA2D4 (calcium channel, voltage-dependent, alpha 2/delta subunit 4 [Source:NCBI gene;Acc:100488361])

HSP 1 Score: 168.703 bits (426), Expect = 9.435e-42
Identity = 166/632 (26.27%), Postives = 274/632 (43.35%), Query Frame = 3
Query:  258 GDIYNWVDMIQNYIKQLALNGIRKDVTQSLFDQAKYKLEIKDGMEIVKDISEQLGSYLFNRKKAALRIANAAVEIYDMNKRRKGNFSYEFLKDLPTNEVMDSDNPKSLPP---MTFNSYFKQ-NVTEKHSTIKIADEVPRSLNTTIFTVHWTYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREWSSNFVGFYTDYDPRVRAWYITATSGPKDVIILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVICARNSHWDEIGKWHLYKSHALSCRPDSLVAATIAHRKDLIESIDNLVPGGTSELETGFELAFDLLKSVPRTG----CQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTNMGLTVPARIFSYLVKDDGEMLPGS--IACGHGGSMRKIVYGENIISQLSNYFEFLAK---VTQKKEGLWTSPYIDSL-------GTGLLITHAVPAISTE-----DGTLLGVAGVDVTLEEIEMLIARYQWGSMTSFFIN-NKGNVIFHPLLKASTTLEDDPIFIHIQSLEQNKAGNPKDFSKVV---DDMINMTAGNRRIIDGRRGTPKGDFKAGVKYDKMPL----EYYYAPLKHSNVYSIAIVLA 2054
            G++Y+   ++  Y   L L    KDV  +L       +E  DG+E+VK  SE++ + L  + +A  ++  AA E  D++     +  +E+   +  NE  ++DN   L     +  N +F    V    S I++   V     + +  V+ +  L  I  +N + D  + WQYFGS++G  RL+PG +W  +  G  + +D R R WYI A + PKD++I++D S SM G + +IAK     ++ TL ++D++N+I   +           Y  +   C    LV A   +R+   + +D L   G   +      AF +LK     G    C   I+ +TDG   + E V                  KYN+                  R+F+YL+  +         IAC + G   +I    ++   +  Y   L++   +    + +WT  Y+DS           L+ T A+P  S +     +G LLGV G DV L E+  L  RY+ G     F+N N G ++ HP L+        P++   + L      N  D S+V     D I  TA    +I+G  G+   D K  V   K  L    +Y+Y  +  +  +S+ +VL+
Sbjct:   61 GEVYS---LVTRYSGSLLLQKKYKDVEPTL------SIEEVDGLELVKKFSEEMENMLRRKVEAVEKLVEAA-EDADLHHEFNTSLEFEYYNSVRINEKDENDNYVELGSEFILETNEHFNNLMVNTSLSNIQLPTNVYNKDPSILNGVYMSEALNPIFVDNFQRDPTLTWQYFGSSSGFFRLYPGIKWVPDENGVIS-FDCRNRGWYIQAATSPKDIVIVVDISGSMKGLRMTIAKHTISTLLDTLGENDFVNIIAYND-----------YVHYIEPCFKGILVQADRDNREHFKQLVDELHAKGVGTVNKALIEAFKILKEFREAGQGGLCNQAIMLITDGAVEEYEPV----------------FEKYNFPDRK-------------VRLFTYLIGREVTFSSNVKWIACNNKGYYTQISTLADVQENVMEYLHVLSRPMVINHDHDIIWTEAYMDSALFASQAQSLLLMTTVAMPVFSKKNETRSEGILLGVVGSDVPLRELLKLAPRYKLGVHGYAFLNTNNGYILSHPDLR--------PLYKEGKKLRPKPNYNSVDLSEVEWEDKDEILRTA----MINGETGSLTMDVKVPVDKGKRVLFLTSDYFYTHIDDTP-FSLGVVLS 628          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Ensembl Xenopus
Match: CACNA2D3 (calcium channel, voltage-dependent, alpha 2/delta subunit 3 [Source:NCBI gene;Acc:101732520])

HSP 1 Score: 155.606 bits (392), Expect = 6.196e-40
Identity = 110/387 (28.42%), Postives = 176/387 (45.48%), Query Frame = 3
Query:  690 VHWTYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREWSSNFVGFYTDYDPRVRAWYITATSGPKDVIILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVICARNSHWDEIGKWHLYKSHALSCRPDSLVAATIAHRKDLIESIDNLVPGGTSELETGFELAFDLLKSVPRTG----CQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTNMGLTVPARIFSYLVKDDGEMLPGS--IACGHGGSMRKIVYGENIISQLSNYFEFLAK---VTQKKEGLWTSPYIDSL-----GTGLLITHAVPAISTED-----GTLLGVAGVDVTLEEIEMLIARYQWGSMT-SFFINNKGNVIFHPLLK 1790
            ++W+  L ++  +N   D  + WQYFGS  G  R +PG +W  +  G    +D R R WYI A + PKDV+IL+D S SM G + +IAK+   +I+ TL   D+ N+I    ++ +EI        +   C   +LV A   +++   E +D L   G   L+     AFDLL     +G    C   I+ + DG     +N+                  KYNW                  R+F+YL+  +         +AC + G   +I    ++   +  Y   L++   + Q+ + +WT  Y+DS      G  L+ T A+P  S ++     G LLGV G DV ++E+   I +Y+ G    +F I N G ++ HP L+
Sbjct:   79 IYWSEALNKVFVDNFDRDPSLIWQYFGSAKGFFRQYPGIKWEPDENGVIA-FDCRNRKWYIQAATSPKDVVILVDVSGSMKGLRLTIAKQTVSSILDTLGDDDFFNII----AYNEEI-------QYVEPCLNGTLVQADRNNKEHFREHLDKLYAKGIGMLDIALNEAFDLLSEFNHSGEGSVCSQAIMLIADGAVDTYDNI----------------FAKYNWPDRK-------------VRMFTYLIGREAAFADNMKWMACANKGFFTQISTLADVQENVMAYLHVLSRPKVIDQEHDVVWTEAYVDSTLADDQGLVLMTTVAMPVFSRQNETRSKGVLLGVVGTDVPVKELMKAIPKYKLGIHGYAFAITNNGYILTHPELR 424          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Ensembl Mouse
Match: Cacna2d1 (calcium channel, voltage-dependent, alpha2/delta subunit 1 [Source:MGI Symbol;Acc:MGI:88295])

HSP 1 Score: 190.66 bits (483), Expect = 1.075e-48
Identity = 209/859 (24.33%), Postives = 364/859 (42.37%), Query Frame = 3
Query:  264 IYNWVDMIQNYIKQLALNGIRKDVTQSLFD--QAKYKLEIKDGMEIVKDISEQLGSYLFNRKKAALRIANAAVEIYDMNKRRKGNFSYEFL-----KDL-PTNEVMDSDNPKSLPPMTFNSYFKQNVTEKHSTIKIADEVPRSLNTTIFTVHWTYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREW--SSNFVGFYTDYDPRVRAWYITATSGPKDVIILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVICARNSHWDEIGKWHLYKSHALSCRPDSLVAATIAHRKDLIESIDNLVPGGTSELETGFELAFDLLK--SVPRTGCQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTNMGLTVPARIFSYLVK----DDGEMLPGSIACGHGGSMRKIVYGENIISQLSNYFEFLAKVT-----QKKEGLWTSPYIDSLGTGLLITHAVPAIS----TEDGT------LLGVAGVDVTLEEIEMLIARYQWGSMTSFF-INNKGNVIFHPLLKASTTLEDDPIFIHIQSLEQNK----AGNPKDFSKVVDDMINMTAGNR-------RIIDGRRGTPKGDFKAGVK------YDKMPLEYYYAPLKHSNVYSIAIVLADTDKVFRRLEEPSNISQPVPSFFNLLIEYNSTKVLKEYPNIFKELDVRFNETKYPMLRVTYNYSSIFFAPSVHCDPSKYFFDDDLAQKTLDAHRYMNELTHNSDPGCDVPEGKYAQGTRAYVLVTESIENQWKSRNFESIDEVTWTYVGMRSGVFRTYP---GHRSTRLYDPTKRPWYRRTLANPTKISISTPYFDAAGSGKI---ITISQAV 2675
            I +WVD +Q  +  LA           +++  Q  Y +E  +  ++V+  +  +   L NR KA +R+A  A ++   ++ R+   S E +      DL P     +  + +  P    ++ F + ++ +H+ + I  ++       +  ++WT  L+E+ K N  ED  + WQ FGS  G+ R +P   W  +S        YD R R WYI   + PKD++IL+D S S++G    + +     +++TL+  D++NV    ++  D            +SC    LV A + ++K L ++++N+   G ++ + GF  AF+ L   +V R  C  II+  TDG +   + +                  KYN  K                R+F++ V     D G +    +AC + G   +I     I      Y + L +       + K+  WT+ Y+D+L  GL+IT  +P  +    +E+ T      +LGV GVDV+LE+I+ L  R+       +F I+  G V+ HP       L+  PI + I ++   K      NPK    V  D ++    N        ++IDG  G  +  F+  VK       DK    Y + P+  ++ YS+A+VL                  P  SF+ +  +   T     Y    K  +  F E+ Y            F AP  +C+  K    D+  +  L+ + +++  T N +P C+            +    E ++N W  +  ++I  V   +V    G+ R YP   G       +  +  +Y+R+L N   +  + PYF+ +G G     I +S+AV
Sbjct:   33 IKSWVDKMQEDLVTLAKTASGVTQLADIYEKYQDLYTVEPNNARQLVEIAARDIEKLLSNRSKALVRLAMEAEKVQAAHQWREDFASNEVVYYNAKDDLDPERNESEPGSQRIKPVFIEDANFGRQISYQHAAVHIPTDIYEGSTIVLNELNWTSALDEVFKRNRDEDPTLLWQVFGSATGLARYYPASPWVDNSRTPNKIDLYDVRRRPWYIQGAASPKDMLILVDVSGSVSGLTLKLIRTSVSEMLETLSDDDFVNVASFNSNAQD------------VSCF-QHLVQANVRNKKVLKDAVNNITAKGITDYKKGFSFAFEQLLNYNVSRANCNKIIMLFTDGGEERAQEI----------------FAKYNKDK--------------KVRVFTFSVGQHNYDRGPI--QWMACENKGYYYEIPSIGAIRINTQEYLDVLGRPMVLAGDKAKQVQWTNVYLDALELGLVITGTLPVFNVTGQSENKTNLKNQLILGVMGVDVSLEDIKRLTPRFTLCPNGYYFAIDPNGYVLLHP------NLQPKPIGVGIPTINLRKRRPNVQNPKSQEPVTLDFLDAELENEIKVEIRNKMIDGESG--EKTFRTLVKSQDERYIDKGNRTYTWTPVNGTD-YSLALVL------------------PTYSFYYIKAKLEETITQARYSETLKPDN--FEESGY-----------TFIAPREYCNDLKP--SDNNTEFLLNFNEFIDRKTPN-NPSCNTDLINRILLDAGF--TNELVQNYWSKQ--KNIKGVKARFVVTDGGITRVYPKEAGENWQENPETYEDSFYKRSLDNDNYV-FTAPYFNKSGPGAYESGIMVSKAV 798          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Ensembl Mouse
Match: Cacna2d1 (calcium channel, voltage-dependent, alpha2/delta subunit 1 [Source:MGI Symbol;Acc:MGI:88295])

HSP 1 Score: 186.037 bits (471), Expect = 2.806e-47
Identity = 203/848 (23.94%), Postives = 360/848 (42.45%), Query Frame = 3
Query:  264 IYNWVDMIQNYIKQLALNGIRKDVTQSLFD--QAKYKLEIKDGMEIVKDISEQLGSYLFNRKKAALRIANAAVEIYDMNKRRKGNFSYEFL-----KDL-PTNEVMDSDNPKSLPPMTFNSYFKQNVTEKHSTIKIADEVPRSLNTTIFTVHWTYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREW--SSNFVGFYTDYDPRVRAWYITATSGPKDVIILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVICARNSHWDEIGKWHLYKSHALSCRPDSLVAATIAHRKDLIESIDNLVPGGTSELETGFELAFDLLK--SVPRTGCQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTNMGLTVPARIFSYLVK----DDGEMLPGSIACGHGGSMRKIVYGENIISQLSNYFEFLAKVT-----QKKEGLWTSPYIDSLGTGLLITHAVPAIS----TEDGT------LLGVAGVDVTLEEIEMLIARYQWGSMTSFF-INNKGNVIFHPLLKASTTLEDDPIFIHIQSLEQNKAGNPKDFSKVVDDMINMTAGNRRIIDGRRGTPKGDFKAGVK------YDKMPLEYYYAPLKHSNVYSIAIVLADTDKVFRRLEEPSNISQPVPSFFNLLIEYNSTKVLKEYPNIFKELDVRFNETKYPMLRVTYNYSSIFFAPSVHCDPSKYFFDDDLAQKTLDAHRYMNELTHNSDPGCDVPEGKYAQGTRAYVLVTESIENQWKSRNFESIDEVTWTYVGMRSGVFRTYP---GHRSTRLYDPTKRPWYRRTLANPTKISISTPYFDAAGSGKI---ITISQAV 2675
            I +WVD +Q  +  LA           +++  Q  Y +E  +  ++V+  +  +   L NR KA +R+A  A ++   ++ R+   S E +      DL P     +  + +  P    ++ F + ++ +H+ + I  ++       +  ++WT  L+E+ K N  ED  + WQ FGS  G+ R +P   W  +S        YD R R WYI   + PKD++IL+D S S++G    + +     +++TL+  D++NV    ++  D            +SC    LV A + ++K L ++++N+   G ++ + GF  AF+ L   +V R  C  II+  TDG +   + +                  KYN  K                R+F++ V     D G +    +AC + G   +I     I      Y + L +       + K+  WT+ Y+D+L  GL+IT  +P  +    +E+ T      +LGV GVDV+LE+I+ L  R+       +F I+  G V+ HP L+       +P+ +     E             +++ I +   N ++IDG  G  +  F+  VK       DK    Y + P+  ++ YS+A+VL                  P  SF+ +  +   T     Y    K  +  F E+ Y            F AP  +C+  K    D+  +  L+ + +++  T N +P C+            +    E ++N W  +  ++I  V   +V    G+ R YP   G       +  +  +Y+R+L N   +  + PYF+ +G G     I +S+AV
Sbjct:   33 IKSWVDKMQEDLVTLAKTASGVTQLADIYEKYQDLYTVEPNNARQLVEIAARDIEKLLSNRSKALVRLAMEAEKVQAAHQWREDFASNEVVYYNAKDDLDPERNESEPGSQRIKPVFIEDANFGRQISYQHAAVHIPTDIYEGSTIVLNELNWTSALDEVFKRNRDEDPTLLWQVFGSATGLARYYPASPWVDNSRTPNKIDLYDVRRRPWYIQGAASPKDMLILVDVSGSVSGLTLKLIRTSVSEMLETLSDDDFVNVASFNSNAQD------------VSCF-QHLVQANVRNKKVLKDAVNNITAKGITDYKKGFSFAFEQLLNYNVSRANCNKIIMLFTDGGEERAQEI----------------FAKYNKDK--------------KVRVFTFSVGQHNYDRGPI--QWMACENKGYYYEIPSIGAIRINTQEYLDVLGRPMVLAGDKAKQVQWTNVYLDALELGLVITGTLPVFNVTGQSENKTNLKNQLILGVMGVDVSLEDIKRLTPRFTLCPNGYYFAIDPNGYVLLHPNLQPKNPKSQEPVTLDFLDAE-------------LENEIKVEIRN-KMIDGESG--EKTFRTLVKSQDERYIDKGNRTYTWTPVNGTD-YSLALVL------------------PTYSFYYIKAKLEETITQARYSETLKPDN--FEESGY-----------TFIAPREYCNDLKP--SDNNTEFLLNFNEFIDRKTPN-NPSCNTDLINRILLDAGF--TNELVQNYWSKQ--KNIKGVKARFVVTDGGITRVYPKEAGENWQENPETYEDSFYKRSLDNDNYV-FTAPYFNKSGPGAYESGIMVSKAV 779          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Ensembl Mouse
Match: Cacna2d1 (calcium channel, voltage-dependent, alpha2/delta subunit 1 [Source:MGI Symbol;Acc:MGI:88295])

HSP 1 Score: 184.882 bits (468), Expect = 6.297e-47
Identity = 205/848 (24.17%), Postives = 368/848 (43.40%), Query Frame = 3
Query:  264 IYNWVDMIQNYIKQLALNGIRKDVTQSLFD--QAKYKLEIKDGMEIVKDISEQLGSYLFNRKKAALRIANAAVEIYDMNKRRKGNFSYEFL-----KDL-PTNEVMDSDNPKSLPPMTFNSYFKQNVTEKHSTIKIADEVPRSLNTTIFTVHWTYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREW--SSNFVGFYTDYDPRVRAWYITATSGPKDVIILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVICARNSHWDEIGKWHLYKSHALSCRPDSLVAATIAHRKDLIESIDNLVPGGTSELETGFELAFDLLK--SVPRTGCQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTNMGLTVPARIFSYLVK----DDGEMLPGSIACGHGGSMRKIVYGENIISQLSNYFEFLAKVT-----QKKEGLWTSPYIDSLGTGLLITHAVPAIS----TEDGT------LLGVAGVDVTLEEIEMLIARYQWGSMTSFF-INNKGNVIFHPLLKASTTLEDDPIFIHIQSLEQNKAGNPKDFSKVVDDMINMTAGNRRIIDGRRGTPKGDFKAGVK------YDKMPLEYYYAPLKHSNVYSIAIVLADTDKVFRRLEEPSNISQPVPSFFNLLIEYNSTKVLKEYPNIFKELDVRFNETKYPMLRVTYNYSSIFFAPSVHCDPSKYFFDDDLAQKTLDAHRYMNELTHNSDPGCDVPEGKYAQGTRAYVLVTESIENQWKSRNFESIDEVTWTYVGMRSGVFRTYP---GHRSTRLYDPTKRPWYRRTLANPTKISISTPYFDAAGSGKI---ITISQAV 2675
            I +WVD +Q  +  LA           +++  Q  Y +E  +  ++V+  +  +   L NR KA +R+A  A ++   ++ R+   S E +      DL P     +  + +  P    ++ F + ++ +H+ + I  ++       +  ++WT  L+E+ K N  ED  + WQ FGS  G+ R +P   W  +S        YD R R WYI   + PKD++IL+D S S++G    + +     +++TL+  D++NV    ++  D            +SC    LV A + ++K L ++++N+   G ++ + GF  AF+ L   +V R  C  II+  TDG +   + +                  KYN  K                R+F++ V     D G +    +AC + G   +I     I      Y + L +       + K+  WT+ Y+D+L  GL+IT  +P  +    +E+ T      +LGV GVDV+LE+I+ L  R+       +F I+  G V+ HP L+       +P+ +     E             +++ I +   N ++IDG  G  +  F+  VK       DK    Y + P+  ++ YS+A+VL      + + +    I+Q   +  NL I ++ ++ LK  P+        F E+ Y            F AP  +C+  K    D+  +  L+ + +++  T N +P C+            +    E ++N W  +  ++I  V   +V    G+ R YP   G       +  +  +Y+R+L N   +  + PYF+ +G G     I +S+AV
Sbjct:   33 IKSWVDKMQEDLVTLAKTASGVTQLADIYEKYQDLYTVEPNNARQLVEIAARDIEKLLSNRSKALVRLAMEAEKVQAAHQWREDFASNEVVYYNAKDDLDPERNESEPGSQRIKPVFIEDANFGRQISYQHAAVHIPTDIYEGSTIVLNELNWTSALDEVFKRNRDEDPTLLWQVFGSATGLARYYPASPWVDNSRTPNKIDLYDVRRRPWYIQGAASPKDMLILVDVSGSVSGLTLKLIRTSVSEMLETLSDDDFVNVASFNSNAQD------------VSCF-QHLVQANVRNKKVLKDAVNNITAKGITDYKKGFSFAFEQLLNYNVSRANCNKIIMLFTDGGEERAQEI----------------FAKYNKDK--------------KVRVFTFSVGQHNYDRGPI--QWMACENKGYYYEIPSIGAIRINTQEYLDVLGRPMVLAGDKAKQVQWTNVYLDALELGLVITGTLPVFNVTGQSENKTNLKNQLILGVMGVDVSLEDIKRLTPRFTLCPNGYYFAIDPNGYVLLHPNLQPKNPKSQEPVTLDFLDAE-------------LENEIKVEIRN-KMIDGESG--EKTFRTLVKSQDERYIDKGNRTYTWTPVNGTD-YSLALVLPTYSFYYIKAKLEETITQ---ARCNLGI-FSDSETLK--PD-------NFEESGY-----------TFIAPREYCNDLKP--SDNNTEFLLNFNEFIDRKTPN-NPSCNTDLINRILLDAGF--TNELVQNYWSKQ--KNIKGVKARFVVTDGGITRVYPKEAGENWQENPETYEDSFYKRSLDNDNYV-FTAPYFNKSGPGAYESGIMVSKAV 786          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Ensembl Mouse
Match: Cacna2d1 (calcium channel, voltage-dependent, alpha2/delta subunit 1 [Source:MGI Symbol;Acc:MGI:88295])

HSP 1 Score: 182.185 bits (461), Expect = 4.926e-46
Identity = 203/848 (23.94%), Postives = 360/848 (42.45%), Query Frame = 3
Query:  264 IYNWVDMIQNYIKQLALNGIRKDVTQSLFD--QAKYKLEIKDGMEIVKDISEQLGSYLFNRKKAALRIANAAVEIYDMNKRRKGNFSYEFL-----KDL-PTNEVMDSDNPKSLPPMTFNSYFKQNVTEKHSTIKIADEVPRSLNTTIFTVHWTYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREW--SSNFVGFYTDYDPRVRAWYITATSGPKDVIILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVICARNSHWDEIGKWHLYKSHALSCRPDSLVAATIAHRKDLIESIDNLVPGGTSELETGFELAFDLLK--SVPRTGCQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTNMGLTVPARIFSYLVK----DDGEMLPGSIACGHGGSMRKIVYGENIISQLSNYFEFLAKVT-----QKKEGLWTSPYIDSLGTGLLITHAVPAIS----TEDGT------LLGVAGVDVTLEEIEMLIARYQWGSMTSFF-INNKGNVIFHPLLKASTTLEDDPIFIHIQSLEQNKAGNPKDFSKVVDDMINMTAGNRRIIDGRRGTPKGDFKAGVK------YDKMPLEYYYAPLKHSNVYSIAIVLADTDKVFRRLEEPSNISQPVPSFFNLLIEYNSTKVLKEYPNIFKELDVRFNETKYPMLRVTYNYSSIFFAPSVHCDPSKYFFDDDLAQKTLDAHRYMNELTHNSDPGCDVPEGKYAQGTRAYVLVTESIENQWKSRNFESIDEVTWTYVGMRSGVFRTYP---GHRSTRLYDPTKRPWYRRTLANPTKISISTPYFDAAGSGKI---ITISQAV 2675
            I +WVD +Q  +  LA           +++  Q  Y +E  +  ++V+  +  +   L NR KA +R+A  A ++   ++ R+   S E +      DL P     +  + +  P    ++ F + ++ +H+ + I  ++       +  ++WT  L+E+ K N  ED  + WQ FGS  G+ R +P   W  +S        YD R R WYI   + PKD++IL+D S S++G    + +     +++TL+  D++NV    ++  D            +SC    LV A + ++K L ++++N+   G ++ + GF  AF+ L   +V R  C  II+  TDG +   + +                  KYN  K                R+F++ V     D G +    +AC + G   +I     I      Y + L +       + K+  WT+ Y+D+L  GL+IT  +P  +    +E+ T      +LGV GVDV+LE+I+ L  R+       +F I+  G V+ HP L+       +P+ +     E             +++ I +   N ++IDG  G  +  F+  VK       DK    Y + P+  ++ YS+A+VL                  P  SF+ +  +   T     Y    K  +  F E+ Y            F AP  +C+  K    D+  +  L+ + +++  T N +P C+            +    E ++N W  +  ++I  V   +V    G+ R YP   G       +  +  +Y+R+L N   +  + PYF+ +G G     I +S+AV
Sbjct:   33 IKSWVDKMQEDLVTLAKTASGVTQLADIYEKYQDLYTVEPNNARQLVEIAARDIEKLLSNRSKALVRLAMEAEKVQAAHQWREDFASNEVVYYNAKDDLDPERNESEPGSQRIKPVFIEDANFGRQISYQHAAVHIPTDIYEGSTIVLNELNWTSALDEVFKRNRDEDPTLLWQVFGSATGLARYYPASPWVDNSRTPNKIDLYDVRRRPWYIQGAASPKDMLILVDVSGSVSGLTLKLIRTSVSEMLETLSDDDFVNVASFNSNAQD------------VSCF-QHLVQANVRNKKVLKDAVNNITAKGITDYKKGFSFAFEQLLNYNVSRANCNKIIMLFTDGGEERAQEI----------------FAKYNKDK--------------KVRVFTFSVGQHNYDRGPI--QWMACENKGYYYEIPSIGAIRINTQEYLDVLGRPMVLAGDKAKQVQWTNVYLDALELGLVITGTLPVFNVTGQSENKTNLKNQLILGVMGVDVSLEDIKRLTPRFTLCPNGYYFAIDPNGYVLLHPNLQPK-----EPVTLDFLDAE-------------LENEIKVEIRN-KMIDGESG--EKTFRTLVKSQDERYIDKGNRTYTWTPVNGTD-YSLALVL------------------PTYSFYYIKAKLEETITQARYSETLKPDN--FEESGY-----------TFIAPREYCNDLKP--SDNNTEFLLNFNEFIDRKTPN-NPSCNTDLINRILLDAGF--TNELVQNYWSKQ--KNIKGVKARFVVTDGGITRVYPKEAGENWQENPETYEDSFYKRSLDNDNYV-FTAPYFNKSGPGAYESGIMVSKAV 774          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Ensembl Mouse
Match: Cacna2d1 (calcium channel, voltage-dependent, alpha2/delta subunit 1 [Source:MGI Symbol;Acc:MGI:88295])

HSP 1 Score: 181.8 bits (460), Expect = 5.989e-46
Identity = 203/848 (23.94%), Postives = 363/848 (42.81%), Query Frame = 3
Query:  264 IYNWVDMIQNYIKQLALNGIRKDVTQSLFD--QAKYKLEIKDGMEIVKDISEQLGSYLFNRKKAALRIANAAVEIYDMNKRRKGNFSYEFL-----KDL-PTNEVMDSDNPKSLPPMTFNSYFKQNVTEKHSTIKIADEVPRSLNTTIFTVHWTYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREW--SSNFVGFYTDYDPRVRAWYITATSGPKDVIILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVICARNSHWDEIGKWHLYKSHALSCRPDSLVAATIAHRKDLIESIDNLVPGGTSELETGFELAFDLLK--SVPRTGCQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTNMGLTVPARIFSYLVK----DDGEMLPGSIACGHGGSMRKIVYGENIISQLSNYFEFLAKVT-----QKKEGLWTSPYIDSLGTGLLITHAVPAIS----TEDGT------LLGVAGVDVTLEEIEMLIARYQWGSMTSFF-INNKGNVIFHPLLKASTTLEDDPIFIHIQSLEQNKAGNPKDFSKVVDDMINMTAGNRRIIDGRRGTPKGDFKAGVK------YDKMPLEYYYAPLKHSNVYSIAIVLADTDKVFRRLEEPSNISQPVPSFFNLLIEYNSTKVLKEYPNIFKELDVRFNETKYPMLRVTYNYSSIFFAPSVHCDPSKYFFDDDLAQKTLDAHRYMNELTHNSDPGCDVPEGKYAQGTRAYVLVTESIENQWKSRNFESIDEVTWTYVGMRSGVFRTYP---GHRSTRLYDPTKRPWYRRTLANPTKISISTPYFDAAGSGKI---ITISQAV 2675
            I +WVD +Q  +  LA           +++  Q  Y +E  +  ++V+  +  +   L NR KA +R+A  A ++   ++ R+   S E +      DL P     +  + +  P    ++ F + ++ +H+ + I  ++       +  ++WT  L+E+ K N  ED  + WQ FGS  G+ R +P   W  +S        YD R R WYI   + PKD++IL+D S S++G    + +     +++TL+  D++NV    ++  D            +SC    LV A + ++K L ++++N+   G ++ + GF  AF+ L   +V R  C  II+  TDG +   + +                  KYN  K                R+F++ V     D G +    +AC + G   +I     I      Y + L +       + K+  WT+ Y+D+L  GL+IT  +P  +    +E+ T      +LGV GVDV+LE+I+ L  R+       +F I+  G V+ HP L+       +P+ +     E             +++ I +   N ++IDG  G  +  F+  VK       DK    Y + P+  ++ YS+A+VL                  P  SF+ +  +   T          K+  ++ +ET  P       Y+  F AP  +C+  K    D+  +  L+ + +++  T N +P C+            +    E ++N W  +  ++I  V   +V    G+ R YP   G       +  +  +Y+R+L N   +  + PYF+ +G G     I +S+AV
Sbjct:   33 IKSWVDKMQEDLVTLAKTASGVTQLADIYEKYQDLYTVEPNNARQLVEIAARDIEKLLSNRSKALVRLAMEAEKVQAAHQWREDFASNEVVYYNAKDDLDPERNESEPGSQRIKPVFIEDANFGRQISYQHAAVHIPTDIYEGSTIVLNELNWTSALDEVFKRNRDEDPTLLWQVFGSATGLARYYPASPWVDNSRTPNKIDLYDVRRRPWYIQGAASPKDMLILVDVSGSVSGLTLKLIRTSVSEMLETLSDDDFVNVASFNSNAQD------------VSCF-QHLVQANVRNKKVLKDAVNNITAKGITDYKKGFSFAFEQLLNYNVSRANCNKIIMLFTDGGEERAQEI----------------FAKYNKDK--------------KVRVFTFSVGQHNYDRGPI--QWMACENKGYYYEIPSIGAIRINTQEYLDVLGRPMVLAGDKAKQVQWTNVYLDALELGLVITGTLPVFNVTGQSENKTNLKNQLILGVMGVDVSLEDIKRLTPRFTLCPNGYYFAIDPNGYVLLHPNLQPKNPKSQEPVTLDFLDAE-------------LENEIKVEIRN-KMIDGESG--EKTFRTLVKSQDERYIDKGNRTYTWTPVNGTD-YSLALVL------------------PTYSFYYIKAKLEETITQARS----KKGKMKDSETLKPDNFEESGYT--FIAPREYCNDLKP--SDNNTEFLLNFNEFIDRKTPN-NPSCNTDLINRILLDAGF--TNELVQNYWSKQ--KNIKGVKARFVVTDGGITRVYPKEAGENWQENPETYEDSFYKRSLDNDNYV-FTAPYFNKSGPGAYESGIMVSKAV 786          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. UniProt/SwissProt
Match: sp|P54289|CA2D1_HUMAN (Voltage-dependent calcium channel subunit alpha-2/delta-1 OS=Homo sapiens OX=9606 GN=CACNA2D1 PE=1 SV=3)

HSP 1 Score: 194.126 bits (492), Expect = 5.999e-49
Identity = 214/859 (24.91%), Postives = 369/859 (42.96%), Query Frame = 3
Query:  264 IYNWVDMIQNYIKQLA--LNGIRKDVTQSLFDQAKYKLEIKDGMEIVKDISEQLGSYLFNRKKAALRIANAAVEIYDMNKRRKGNFSYEFL----KDLPTNEVMDSD--NPKSLPPMTFNSYFKQNVTEKHSTIKIADEVPRSLNTTIFTVHWTYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREW--SSNFVGFYTDYDPRVRAWYITATSGPKDVIILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVICARNSHWDEIGKWHLYKSHALSCRPDSLVAATIAHRKDLIESIDNLVPGGTSELETGFELAFDLLKS--VPRTGCQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTNMGLTVPARIFSYLVK----DDGEMLPGSIACGHGGSMRKIVYGENIISQLSNYFEFLAKVT-----QKKEGLWTSPYIDSLGTGLLITHAVPAIST----------EDGTLLGVAGVDVTLEEIEMLIARYQWGSMTSFF-INNKGNVIFHPLLKASTTLEDDPIFIHIQSLEQNK----AGNPKDFSKVVDDMINMTAGN-------RRIIDGRRGTPKGDFKAGVK------YDKMPLEYYYAPLKHSNVYSIAIVLADTDKVFRRLEEPSNISQPVPSFFNLLIEYNSTKVLKEYPNIFKELDVRFNETKYPMLRVTYNYSSIFFAPSVHCDPSKYFFDDDLAQKTLDAHRYMNELTHNSDPGCDVPEGKYAQGTRAYVLVTESIENQWKSRNFESIDEVTWTYVGMRSGVFRTYP---GHRSTRLYDPTKRPWYRRTLANPTKISISTPYFDAAGSGKI---ITISQAV 2675
            I +WVD +Q  +  LA   +G+ + V      Q  Y +E  +  ++V+  +  +   L NR KA +R+A  A ++   ++ R+   S E +    KD    E  DS+  + +  P    ++ F + ++ +H+ + I  ++       +  ++WT  L+E+ K+N +ED  + WQ FGS  G+ R +P   W  +S        YD R R WYI   + PKD++IL+D S S++G    + +     +++TL+  D++NV    ++  D            +SC    LV A + ++K L ++++N+   G ++ + GF  AF+ L +  V R  C  II+  TDG    GE                         +   I NK N    V  R+F++ V     D G +    +AC + G   +I     I      Y + L +       + K+  WT+ Y+D+L  GL+IT  +P  +           ++  +LGV GVDV+LE+I+ L  R+       +F I+  G V+ HP       L+  PI + I ++   K      NPK    V  D ++    N        ++IDG  G  +  F+  VK       DK    Y + P+  ++ YS+A+VL                  P  SF+ +  +   T     Y    K  +  F E+ Y            F AP  +C+  K    D+  +  L+ + +++  T N +P C+            +    E ++N W  +  ++I  V   +V    G+ R YP   G       +  +  +Y+R+L N   +  + PYF+ +G G     I +S+AV
Sbjct:   33 IKSWVDKMQEDLVTLAKTASGVNQLVDIYEKYQDLYTVEPNNARQLVEIAARDIEKLLSNRSKALVRLALEAEKVQAAHQWREDFASNEVVYYNAKDDLDPEKNDSEPGSQRIKPVFIEDANFGRQISYQHAAVHIPTDIYEGSTIVLNELNWTSALDEVFKKNREEDPSLLWQVFGSATGLARYYPASPWVDNSRTPNKIDLYDVRRRPWYIQGAASPKDMLILVDVSGSVSGLTLKLIRTSVSEMLETLSDDDFVNVASFNSNAQD------------VSCF-QHLVQANVRNKKVLKDAVNNITAKGITDYKKGFSFAFEQLLNYNVSRANCNKIIMLFTDG----GEE------------------------RAQEIFNKYNKDKKV--RVFTFSVGQHNYDRGPI--QWMACENKGYYYEIPSIGAIRINTQEYLDVLGRPMVLAGDKAKQVQWTNVYLDALELGLVITGTLPVFNITGQFENKTNLKNQLILGVMGVDVSLEDIKRLTPRFTLCPNGYYFAIDPNGYVLLHP------NLQPKPIGVGIPTINLRKRRPNIQNPKSQEPVTLDFLDAELENDIKVEIRNKMIDGESG--EKTFRTLVKSQDERYIDKGNRTYTWTPVNGTD-YSLALVL------------------PTYSFYYIKAKLEETITQARYSETLKPDN--FEESGY-----------TFIAPRDYCNDLK--ISDNNTEFLLNFNEFIDRKTPN-NPSCNADLINRVLLDAGF--TNELVQNYWSKQ--KNIKGVKARFVVTDGGITRVYPKEAGENWQENPETYEDSFYKRSLDNDNYV-FTAPYFNKSGPGAYESGIMVSKAV 798          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. UniProt/SwissProt
Match: sp|P13806|CA2D1_RABIT (Voltage-dependent calcium channel subunit alpha-2/delta-1 OS=Oryctolagus cuniculus OX=9986 GN=CACNA2D1 PE=1 SV=1)

HSP 1 Score: 192.586 bits (488), Expect = 2.097e-48
Identity = 210/859 (24.45%), Postives = 367/859 (42.72%), Query Frame = 3
Query:  264 IYNWVDMIQNYIKQLA--LNGIRKDVTQSLFDQAKYKLEIKDGMEIVKDISEQLGSYLFNRKKAALRIANAAVEIYDMNKRRKGNFSYEFL----KDLPTNEVMDSD--NPKSLPPMTFNSYFKQNVTEKHSTIKIADEVPRSLNTTIFTVHWTYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREW--SSNFVGFYTDYDPRVRAWYITATSGPKDVIILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVICARNSHWDEIGKWHLYKSHALSCRPDSLVAATIAHRKDLIESIDNLVPGGTSELETGFELAFDLLK--SVPRTGCQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTNMGLTVPARIFSYLVK----DDGEMLPGSIACGHGGSMRKIVYGENIISQLSNYFEFLAKVT-----QKKEGLWTSPYIDSLGTGLLITHAVPAIST----------EDGTLLGVAGVDVTLEEIEMLIARYQWGSMTSFF-INNKGNVIFHPLLKASTTLEDDPIFIHIQSLEQNK----AGNPKDFSKVVDDMINMTAGN-------RRIIDGRRGTPKGDFKAGVK------YDKMPLEYYYAPLKHSNVYSIAIVLADTDKVFRRLEEPSNISQPVPSFFNLLIEYNSTKVLKEYPNIFKELDVRFNETKYPMLRVTYNYSSIFFAPSVHCDPSKYFFDDDLAQKTLDAHRYMNELTHNSDPGCDVPEGKYAQGTRAYVLVTESIENQWKSRNFESIDEVTWTYVGMRSGVFRTYP---GHRSTRLYDPTKRPWYRRTLANPTKISISTPYFDAAGSGKI---ITISQAV 2675
            I +WVD +Q  +  LA   +G+ + V      Q  Y +E  +  ++V+  +  +   L NR KA +R+A  A ++   ++ R+   S E +    KD    E  DS+  + +  P    ++ F++ V+ +H+ + I  ++       +  ++WT  L+++ K+N +ED  + WQ FGS  G+ R +P   W  +S        YD R R WYI   + PKD++IL+D S S++G    + +     +++TL+  D++NV    ++  D            +SC    LV A + ++K L ++++N+   G ++ + GF  AF+ L   +V R  C  II+  TDG +   + +                  KYN  K                R+F++ V     D G +    +AC + G   +I     I      Y + L +       + K+  WT+ Y+D+L  GL+IT  +P  +           ++  +LGV GVDV+LE+I+ L  R+       +F I+  G V+ HP       L+  PI + I ++   K      NPK    V  D ++    N        ++IDG  G  +  F+  VK       DK    Y + P+  ++  S+A+VL                  P  SF+ +  +   T     Y    K  +  F E+ Y            F AP  +C   K    D+  +  L+ + +++  T N +P C+            +    E ++N W  +  ++I  V   +V    G+ R YP   G       +  +  +Y+R+L N   +  + PYF+ +G G     I +S+AV
Sbjct:   35 IKSWVDKMQEDLVTLAKTASGVHQLVDIYEKYQDLYTVEPNNARQLVEIAARDIEKLLSNRSKALVRLALEAEKVQAAHQWREDFASNEVVYYNAKDDLDPEKNDSEPGSQRIKPVFIDDANFRRQVSYQHAAVHIPTDIYEGSTIVLNELNWTSALDDVFKKNREEDPSLLWQVFGSATGLARYYPASPWVDNSRTPNKIDLYDVRRRPWYIQGAASPKDMLILVDVSGSVSGLTLKLIRTSVSEMLETLSDDDFVNVASFNSNAQD------------VSCF-QHLVQANVRNKKVLKDAVNNITAKGITDYKKGFSFAFEQLLNYNVSRANCNKIIMLFTDGGEERAQEI----------------FAKYNKDK--------------KVRVFTFSVGQHNYDRGPI--QWMACENKGYYYEIPSIGAIRINTQEYLDVLGRPMVLAGDKAKQVQWTNVYLDALELGLVITGTLPVFNITGQFENKTNLKNQLILGVMGVDVSLEDIKRLTPRFTLCPNGYYFAIDPNGYVLLHP------NLQPKPIGVGIPTINLRKRRPNVQNPKSQEPVTLDFLDAELENDIKVEIRNKMIDGESG--EKTFRTLVKSQDERYIDKGNRTYTWTPVNGTDYSSLALVL------------------PTYSFYYIKAKIEETITQARYSETLKPDN--FEESGY-----------TFLAPRDYCSDLKP--SDNNTEFLLNFNEFIDRKTPN-NPSCNTDLINRVLLDAGF--TNELVQNYWSKQ--KNIKGVKARFVVTDGGITRVYPKEAGENWQENPETYEDSFYKRSLDNDNYV-FTAPYFNKSGPGAYESGIMVSKAV 801          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. UniProt/SwissProt
Match: sp|O08532|CA2D1_MOUSE (Voltage-dependent calcium channel subunit alpha-2/delta-1 OS=Mus musculus OX=10090 GN=Cacna2d1 PE=1 SV=1)

HSP 1 Score: 190.66 bits (483), Expect = 7.517e-48
Identity = 209/859 (24.33%), Postives = 364/859 (42.37%), Query Frame = 3
Query:  264 IYNWVDMIQNYIKQLALNGIRKDVTQSLFD--QAKYKLEIKDGMEIVKDISEQLGSYLFNRKKAALRIANAAVEIYDMNKRRKGNFSYEFL-----KDL-PTNEVMDSDNPKSLPPMTFNSYFKQNVTEKHSTIKIADEVPRSLNTTIFTVHWTYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREW--SSNFVGFYTDYDPRVRAWYITATSGPKDVIILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVICARNSHWDEIGKWHLYKSHALSCRPDSLVAATIAHRKDLIESIDNLVPGGTSELETGFELAFDLLK--SVPRTGCQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTNMGLTVPARIFSYLVK----DDGEMLPGSIACGHGGSMRKIVYGENIISQLSNYFEFLAKVT-----QKKEGLWTSPYIDSLGTGLLITHAVPAIS----TEDGT------LLGVAGVDVTLEEIEMLIARYQWGSMTSFF-INNKGNVIFHPLLKASTTLEDDPIFIHIQSLEQNK----AGNPKDFSKVVDDMINMTAGNR-------RIIDGRRGTPKGDFKAGVK------YDKMPLEYYYAPLKHSNVYSIAIVLADTDKVFRRLEEPSNISQPVPSFFNLLIEYNSTKVLKEYPNIFKELDVRFNETKYPMLRVTYNYSSIFFAPSVHCDPSKYFFDDDLAQKTLDAHRYMNELTHNSDPGCDVPEGKYAQGTRAYVLVTESIENQWKSRNFESIDEVTWTYVGMRSGVFRTYP---GHRSTRLYDPTKRPWYRRTLANPTKISISTPYFDAAGSGKI---ITISQAV 2675
            I +WVD +Q  +  LA           +++  Q  Y +E  +  ++V+  +  +   L NR KA +R+A  A ++   ++ R+   S E +      DL P     +  + +  P    ++ F + ++ +H+ + I  ++       +  ++WT  L+E+ K N  ED  + WQ FGS  G+ R +P   W  +S        YD R R WYI   + PKD++IL+D S S++G    + +     +++TL+  D++NV    ++  D            +SC    LV A + ++K L ++++N+   G ++ + GF  AF+ L   +V R  C  II+  TDG +   + +                  KYN  K                R+F++ V     D G +    +AC + G   +I     I      Y + L +       + K+  WT+ Y+D+L  GL+IT  +P  +    +E+ T      +LGV GVDV+LE+I+ L  R+       +F I+  G V+ HP       L+  PI + I ++   K      NPK    V  D ++    N        ++IDG  G  +  F+  VK       DK    Y + P+  ++ YS+A+VL                  P  SF+ +  +   T     Y    K  +  F E+ Y            F AP  +C+  K    D+  +  L+ + +++  T N +P C+            +    E ++N W  +  ++I  V   +V    G+ R YP   G       +  +  +Y+R+L N   +  + PYF+ +G G     I +S+AV
Sbjct:   33 IKSWVDKMQEDLVTLAKTASGVTQLADIYEKYQDLYTVEPNNARQLVEIAARDIEKLLSNRSKALVRLAMEAEKVQAAHQWREDFASNEVVYYNAKDDLDPERNESEPGSQRIKPVFIEDANFGRQISYQHAAVHIPTDIYEGSTIVLNELNWTSALDEVFKRNRDEDPTLLWQVFGSATGLARYYPASPWVDNSRTPNKIDLYDVRRRPWYIQGAASPKDMLILVDVSGSVSGLTLKLIRTSVSEMLETLSDDDFVNVASFNSNAQD------------VSCF-QHLVQANVRNKKVLKDAVNNITAKGITDYKKGFSFAFEQLLNYNVSRANCNKIIMLFTDGGEERAQEI----------------FAKYNKDK--------------KVRVFTFSVGQHNYDRGPI--QWMACENKGYYYEIPSIGAIRINTQEYLDVLGRPMVLAGDKAKQVQWTNVYLDALELGLVITGTLPVFNVTGQSENKTNLKNQLILGVMGVDVSLEDIKRLTPRFTLCPNGYYFAIDPNGYVLLHP------NLQPKPIGVGIPTINLRKRRPNVQNPKSQEPVTLDFLDAELENEIKVEIRNKMIDGESG--EKTFRTLVKSQDERYIDKGNRTYTWTPVNGTD-YSLALVL------------------PTYSFYYIKAKLEETITQARYSETLKPDN--FEESGY-----------TFIAPREYCNDLKP--SDNNTEFLLNFNEFIDRKTPN-NPSCNTDLINRILLDAGF--TNELVQNYWSKQ--KNIKGVKARFVVTDGGITRVYPKEAGENWQENPETYEDSFYKRSLDNDNYV-FTAPYFNKSGPGAYESGIMVSKAV 798          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. UniProt/SwissProt
Match: sp|Q9NY47|CA2D2_HUMAN (Voltage-dependent calcium channel subunit alpha-2/delta-2 OS=Homo sapiens OX=9606 GN=CACNA2D2 PE=1 SV=2)

HSP 1 Score: 180.644 bits (457), Expect = 1.193e-44
Identity = 225/1000 (22.50%), Postives = 416/1000 (41.60%), Query Frame = 3
Query:  363 YKLEIKDGMEIVKDISEQLGSYLFNRKKAALRIANAAVEIYDMNKRRKGNFSYEFLK----------DLPTNEVMDSDNPKSLPPMTF--NSYFKQNVTEKHSTIKIADEVPRSLNTTIFTVHWTYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREWSSNFVGFYTDYDPRVRAWYITATSGPKDVIILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVICARNSHWDEIGKWHLYKSHALSCRPDSLVAATIAHRKDLIESIDNLVPGGTSELETGFELAFDLLK--SVPRTGCQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTNMGLTVPARIFSYLV-KDDGEMLPGS-IACGHGGSMRKIVYGENIISQLSNYFEFLAKVT-----QKKEGLWTSPYIDSLGTGLLITHAVPAIS-TEDG-------TLLGVAGVDVTLEEIEMLIARYQWGSMTSFF-INNKGNVIFHPLLKASTTLEDDPIFIHIQSLEQNKAGNPKDFSKVVDDMINMTAGNRRIIDGRRGTPKGDFKAGVK------YDKMPLEYYYAPLKHSNVYSIAIVLADTDKVFRRLEEPSNISQPVPSFFNLLIEYN-STKVLKEYPNIFKELDVRFNETKYPMLRVTYNYSS-IFFAPSVHC------DPSKYFFDD--DLAQK-TLDAHRYMNELTHN--SDPGCDVPEGKYAQGTRAYVLVTESIENQWKSRNFESIDEVTWTYVGMRSGVFRTYPGHRS---TRLYDPTKRPWYRRTLANPTKISISTPYFDAAGSGKIITISQAVFEGMPTLSKEHCKNINSLKPGGCHCVKDSDCLSGYCYISKAPGPDAHETRCATERIEAITSLDIGYDSFHKRLFQIMQAS----DGVKSCNSSYKCPDGYLDCWTK-----CYIFDDRANIIMASEFVAATAFDTNKYLGITVGKKESEIMKDL---IYHHKFFQRSESIDFQGACT 3170
            ++++  +  ++V+ ++  + S L  + +A  R+A+AA E +    R + N   E +           D P +E ++  +  S   + F  +  FK  V   ++ ++I  ++ +     +  ++WT  LE +  EN ++D  + WQ FGS  GV R +P   W +        YD R R WYI   S PKD++I++D S S++G    + K     ++ TL+  DY+NV     + ++E       K+  +SC    LV A + ++K   E++  +V  GT+  + GFE AFD L+  ++ R  C  +I+  TDG +   ++V                  KYNW       N+T        R+F++ V + + ++ P   +AC + G   +I     I      Y + L +       + K+  WT+ Y D+LG GL++T  +P  + T+DG        +LGV G+DV L +I+ L   Y  G+    F I+  G V+ HP LK  TT   +P+ +              DF     +  N     R +IDG +G  +   +  VK       D++   Y + P++ +N YS+ +VL                    P +    ++ N S ++L+    I K  D  F      +L  ++     +F AP  +C      D +  F  +  +L +K T D+ +  N L HN   D G                +  + +E  W+ ++  +   +   +     G+ R +P   +   T   +P    +YRR+L N   +    P+ DA    + + +       + + + E      +L+P                                     A+  + +  +++ ++ F+++ ++    D  + C  +  C    +DC        C + DD   ++++++           +    VG+  SE+  +L   +Y++ F+ R ES D+Q AC 
Sbjct:  105 FEVQENEPQKLVEKVAGDIESLLDRKVQALKRLADAA-ENFQKAHRWQDNIKEEDIVYYDAKADAELDDPESEDVERGSKASTLRLDFIEDPNFKNKVNYSYAAVQIPTDIYKGSTVILNELNWTEALENVFMENRRQDPTLLWQVFGSATGVTRYYPATPWRA--PKKIDLYDVRRRPWYIQGASSPKDMVIIVDVSGSVSGLTLKLMKTSVCEMLDTLSDDDYVNV-----ASFNE-------KAQPVSCF-THLVQANVRNKKVFKEAVQGMVAKGTTGYKAGFEYAFDQLQNSNITRANCNKMIMMFTDGGEDRVQDV----------------FEKYNWP------NRT-------VRVFTFSVGQHNYDVTPLQWMACANKGYYFEIPSIGAIRINTQEYLDVLGRPMVLAGKEAKQVQWTNVYEDALGLGLVVTGTLPVFNLTQDGPGEKKNQLILGVMGIDVALNDIKRLTPNYTLGANGYVFAIDLNGYVLLHPNLKPQTTNFREPVTL--------------DFLDAELEDENKEEIRRSMIDGNKGHKQ--IRTLVKSLDERYIDEVTRNYTWVPIRSTN-YSLGLVL--------------------PPYSTFYLQANLSDQILQVKLPISKLKDFEF------LLPSSFESEGHVFIAPREYCKDLNASDNNTEFLKNFIELMEKVTPDSKQCNNFLLHNLILDTG----------------ITQQLVERVWRDQDLNTYSLLA-VFAATDGGITRVFPNKAAEDWTENPEPFNASFYRRSLDNHGYV-FKPPHQDAL--LRPLELENDTVGILVSTAVELSLGRRTLRP-------------------------------------AVVGVKLDLEAWAEK-FKVLASNRTHQDQPQKCGPNSHCE---MDCEVNNEDLLCVLIDDGGFLVLSNQ----------NHQWDQVGRFFSEVDANLMLALYNNSFYTRKESYDYQAACA 945          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. UniProt/SwissProt
Match: sp|Q6PHS9|CA2D2_MOUSE (Voltage-dependent calcium channel subunit alpha-2/delta-2 OS=Mus musculus OX=10090 GN=Cacna2d2 PE=1 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 7.720e-43
Identity = 196/797 (24.59%), Postives = 343/797 (43.04%), Query Frame = 3
Query:  363 YKLEIKDGMEIVKDISEQLGSYLFNRKKAALRIANAAVEIYDMNKRRKGNFSYEFLK----------DLPTNEVMDSDNPKSLPPMTF--NSYFKQNVTEKHSTIKIADEVPRSLNTTIFTVHWTYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREWSSNFVGFYTDYDPRVRAWYITATSGPKDVIILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVICARNSHWDEIGKWHLYKSHALSCRPDSLVAATIAHRKDLIESIDNLVPGGTSELETGFELAFDLLK--SVPRTGCQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTNMGLTVPARIFSYLV-KDDGEMLPGS-IACGHGGSMRKIVYGENIISQLSNYFEFLAKVT-----QKKEGLWTSPYIDSLGTGLLITHAVPAIS-TEDG-------TLLGVAGVDVTLEEIEMLIARYQWGSMTSFF-INNKGNVIFHPLLKASTTLEDDPIFIHIQSLEQNKAGNPKDFSKVVDDMINMTAGNRRIIDGRRGTPKGDFKAGVK------YDKMPLEYYYAPLKHSNVYSIAIVLADTDKVFRRLEEPSNISQPVPSFFNLLIEYN-STKVLKEYPNIFKELDVRFNETKYPMLRVTYNYSS-IFFAPSVHC------DPSKYFFDD--DLAQK-TLDAHRYMNELTHN--SDPGCDVPEGKYAQGTRAYVLVTESIENQWKSRNFESIDEVTWTYVGMRSGVFRTYPGHRS---TRLYDPTKRPWYRRTLAN 2597
            ++++  +  ++V+ ++  + S L  + +A  R+A+AA E +    R + N   E +           D P +E M+  +  S   + F  +  FK  V   ++ ++I  ++ +     +  ++WT  LE +  EN ++D  + WQ FGS  GV R +P   W +        YD R R WYI   S PKD++I++D S S++G    + K     ++ TL+  DY+NV     + ++E       K+  +SC    LV A + ++K   E++  +V  GT+  + GFE AFD L+  ++ R  C  +I+  TDG +   ++V                  KYNW       N+T        R+F++ V + + ++ P   +AC + G   +I     I      Y + L +         K+  WT+ Y D+LG GL++T  +P  + T+DG        +LGV G+DV L +I+ L   Y  G+    F I+  G V+ HP LK  TT   +P+ +              DF     +  N     R +IDG +G  +   +  VK       D++   Y + P++ +N YS+ +VL                    P +    ++ N S ++L+    I K  D  F      +L  ++     +F AP  +C      D +  F  +  +L +K T D+ +  N L HN   D G                +  + +E  W+ ++  +   +   +     G+ R +P   +   T   +P    +YRR+L N
Sbjct:  108 FEVQENEPQKLVEKVAGDIESLLDRKVQALKRLADAA-ENFQKAHRWQDNIKEEDIMYYDAKADAELDDPESEDMERGSKTSALRLDFIEDPNFKNKVNYSYTAVQIPTDIYKGSTVILNELNWTEALENVFIENRRQDPTLLWQVFGSATGVTRYYPATPWRA--PKKIDLYDVRRRPWYIQGASSPKDMVIIVDVSGSVSGLTLKLMKTSVCEMLDTLSDDDYVNV-----ASFNE-------KAQPVSCF-THLVQANVRNKKVFKEAVQGMVAKGTTGYKAGFEYAFDQLQNSNITRANCNKMIMMFTDGGEDRVQDV----------------FEKYNWP------NRT-------VRVFTFSVGQHNYDVTPLQWMACTNKGYYFEIPSIGAIRINTQEYLDVLGRPMVLAGKDAKQVQWTNVYEDALGLGLVVTGTLPVFNLTQDGPGEKKNQLILGVMGIDVALNDIKRLTPNYTLGANGYVFAIDLNGYVLLHPNLKPQTTNFREPVTL--------------DFLDAELEDENKEEIRRSMIDGDKGHKQ--IRTLVKSLDERYIDEVIRNYTWVPIRSTN-YSLGLVL--------------------PPYSTYYLQANLSDQILQVKLPISKLKDFEF------LLPSSFESEGHVFIAPREYCKDLNASDNNTEFLKNFIELMEKVTPDSKQCNNFLLHNLILDTG----------------ITQQLVERVWRDQDLNTYSLLA-VFAATDGGITRVFPNKAAEDWTENPEPFNASFYRRSLDN 799          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. TrEMBL
Match: A0A267H3L5 (VWFA domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig015658g4 PE=4 SV=1)

HSP 1 Score: 1422.53 bits (3681), Expect = 0.000e+0
Identity = 692/1193 (58.01%), Postives = 868/1193 (72.76%), Query Frame = 3
Query:  243 DGTLYGDIYNWVDMIQNYIKQLALNGIRKDVTQSLFDQAKYKLEIKDGMEIVKDISEQLGSYLFNRKKAALRIANAAVEIYDMNKR--RKGNFSYEF-LKDLPTNEVMDSDNPKSLP--PMTFNSYFKQNVTEKHSTIKIADEVPRSLNTTIFTVHWTYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREWSSNFVGFYTDYDPRVRAWYITATSGPKDVIILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVICARNSHWDEIGKWHLYKSHALSCRPDSLVAATIAHRKDLIESIDNLVPGGTSELETGFELAFDLLKSVPRTGCQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTNMGLTVPARIFSYLVKDDGEMLPGSIACGHGGSMRKIVYGENIISQLSNYFEFLAKVTQKKEGLWTSPYIDSLGTGLLITHAVPAISTEDG---TLLGVAGVDVTLEEIEMLIARYQWGSMTSFFINNKGNVIFHPLLKASTTLEDDPIFIHIQSLEQNKAGNPKDFSKVVDDMINMTAGNRRIIDGRRGTPKGDFKAGVKYDKMPLEYYYAPLKHSNVYSIAIVLADTDKVFRRLEEPS-NISQPVP---SFFNLLIEYNSTKVLKEYPNIFKELDVRFNET-KYPMLRVTYNYSSIFFAPSVHCDPSKYFFDDDLAQKTLDAHRYMNELTHNSDPGCDVPEGK------YAQGTRAYVLVTESIENQWKSRNFESIDEVTWTYVGMRSGVFRTYPGHRSTRLYDPTKRPWYRRTLANPTKISISTPYFDAAGSGKIITISQAVFEGMPTLSKEHCKNINSLKPGGCHCVKDSDCLSGYCYISKAPGPD---AHETRCATERIEAITSLDIGYDSFHKRLFQIMQASDGVKSCNSSYKCPDGYLDCWTKCYIFDDRANIIMASEFVAATAFDTNKYLGITVGKKESEIMKDLIYHHKFFQRSESIDFQGACTYVSSYPQVTLKGIPRTPEDFDNYYKTRGPIPSFINSYSCIQDVVTFSANISALGPSRMIVGNVSGPCTTGFYYVTSMPETNLFLLVVESRYDRSDSFFYNFNCEISRKIVASGAYRIINGTCAHKETNKQT--------------LAEKG-----TCPEIVKVNITCEYSTA--MNFQPNYKLLVINILYLVHNL 3692
            DGT+YGD+YNW DMIQNYI+Q+A +GI++D TQ LFDQA+Y  E K+G  +   + ++L +Y   +K  A RIA AA E Y+ + R  R G       L DL  +   DSD P  L    MT   +F+Q++T   STIKI D+VPR LN TIFTV WTY+LE I  E  + D+ IRW YFGS+ GV RL+PGREWSSNFVGFYTDYDPR+R WYI ATSGPKDV+I+IDCS SM GEKF IA+ V+KA+I+TLTK DY+NV+CAR SHWDE+GKWH +KS  LSC+   +V ATI  RKDL+E ID L PGGTSELE GF++ F+LL S PRTGC SI+VF+TDG+DTDGE VRCGPGYYTRSGYVPGPVCKYNWTKV S++N TN     PARIFSYL+KDDG+M PG++AC H GS+RK+  GEN+IS++ NYF+FLA+V Q  +GLWTSPYID+ G G ++THAVP IST D      +GV GVD TLEEIE  + R QWGS+TSF I+ +G  I+HPLLK S +L+DDPIFIHIQ +EQNK   PK+F+KV   MIN   G   I +GRRG  KGD++AGVKY+ MPLEYY+  ++ S  YS+A VL+ TDKV+R+L EP     + VP   S+FNLLIEYNS+ VLK YP++FK L+V++N + K+  LR+T  +SSIFFAP  +C+P +Y FDDDLA+KTLDAH YMN  T   D GC  P+ K      +  G+RAYVLVT+ IE +W+ R F  IDEV WTYVGMRSGVFRTYPGHRS R YDPTKRPWY RT ++PTK SISTPY+D+AGSGKIITISQAVFEGM   +        + KPGGC C +  +C SGYCYIS A           RCATERIEAITSLD+GY++FH++++ +MQASDGVKSCN+ YKCPDG  +C T CY+FD+RAN+IMA++F+ AT  D  +Y G+T+G+KE E+M +L++  K FQR ES+DFQG C++ +  P+VT+ GIP TPE+ DN YKTRGPIP F NSY CIQDV++F  N +ALG SRM+VGNVSGPC  GFYYVTS+ +TNLFLLV+E+  DRS + F NFNC ++RK+VASGA RIINGTCAH ++ + +               ++ G      CP +  V I C+++ A  +  +   KLL+  I+ +  +L
Sbjct:   51 DGTMYGDVYNWADMIQNYIQQVAADGIQRDQTQMLFDQAEYLYEKKNGTNVTMQVKQELSAYFRKKKATAHRIAEAAAEAYNRHYRQVRSGQRKIAASLSDLSVDIYRDSDIPHRLANSGMTLVPFFRQHITYNFSTIKIPDDVPRDLNETIFTVEWTYELERIFNETYQNDSSIRWLYFGSSTGVTRLYPGREWSSNFVGFYTDYDPRIRPWYIAATSGPKDVVIIIDCSASMEGEKFGIARSVAKAVIRTLTKQDYMNVVCARASHWDEVGKWHYFKSEVLSCQETKMVPATIEFRKDLMEKIDGLKPGGTSELEHGFQMGFELLNSQPRTGCLSILVFITDGKDTDGETVRCGPGYYTRSGYVPGPVCKYNWTKVWSVVNATNADSKPPARIFSYLIKDDGQMFPGALACNHSGSLRKLEDGENLISRMDNYFDFLARVAQNSKGLWTSPYIDAFGLGTMVTHAVPVISTIDTGKPRTIGVVGVDATLEEIETYVTRRQWGSVTSFLIDKEGQTIYHPLLKGSASLKDDPIFIHIQRMEQNKKSIPKEFNKVTQKMINGETGMIAIENGRRGISKGDYRAGVKYETMPLEYYFTNIEDSE-YSVAFVLSKTDKVYRKLIEPKIEFEELVPRNRSYFNLLIEYNSSTVLKHYPDVFKYLNVKYNMSKKFQKLRITELHSSIFFAPKCYCEPLRYLFDDDLARKTLDAHEYMN--TGKPDTGCHSPDSKATDQAIFEAGSRAYVLVTQPIEERWRERKFSWIDEVIWTYVGMRSGVFRTYPGHRSVRPYDPTKRPWYSRTKSSPTKTSISTPYYDSAGSGKIITISQAVFEGMDNKTDGCNVTGKTKKPGGCPCEEGDECTSGYCYISAAKATTKEIQQGKRCATERIEAITSLDLGYNNFHRKVYNLMQASDGVKSCNAEYKCPDGSPNCKTVCYVFDNRANVIMAADFIEATDLDEGRYKGVTLGQKEGEVMMNLVFRQKLFQRDESVDFQGTCSFTAGAPRVTMNGIPTTPEESDNLYKTRGPIPGFSNSYGCIQDVISFEVNETALGRSRMLVGNVSGPCMQGFYYVTSLKDTNLFLLVIENWRDRSKTPF-NFNCLLTRKLVASGASRIINGTCAHDQSGEVSDTGGASGGSGGASSSSDNGQDADRNCPALNNVTIPCDFNRANVLQMEQVIKLLLGWIILVTVHL 1239          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. TrEMBL
Match: A0A267EZH1 (VWFA domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig015658g3 PE=4 SV=1)

HSP 1 Score: 1422.14 bits (3680), Expect = 0.000e+0
Identity = 691/1193 (57.92%), Postives = 866/1193 (72.59%), Query Frame = 3
Query:  243 DGTLYGDIYNWVDMIQNYIKQLALNGIRKDVTQSLFDQAKYKLEIKDGMEIVKDISEQLGSYLFNRKKAALRIANAAVEIYDMNKR--RKGNFSYEF-LKDLPTNEVMDSDNPKSLP--PMTFNSYFKQNVTEKHSTIKIADEVPRSLNTTIFTVHWTYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREWSSNFVGFYTDYDPRVRAWYITATSGPKDVIILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVICARNSHWDEIGKWHLYKSHALSCRPDSLVAATIAHRKDLIESIDNLVPGGTSELETGFELAFDLLKSVPRTGCQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTNMGLTVPARIFSYLVKDDGEMLPGSIACGHGGSMRKIVYGENIISQLSNYFEFLAKVTQKKEGLWTSPYIDSLGTGLLITHAVPAISTEDG---TLLGVAGVDVTLEEIEMLIARYQWGSMTSFFINNKGNVIFHPLLKASTTLEDDPIFIHIQSLEQNKAGNPKDFSKVVDDMINMTAGNRRIIDGRRGTPKGDFKAGVKYDKMPLEYYYAPLKHSNVYSIAIVLADTDKVFRRLEEPS-NISQPVP---SFFNLLIEYNSTKVLKEYPNIFKELDVRFNET-KYPMLRVTYNYSSIFFAPSVHCDPSKYFFDDDLAQKTLDAHRYMNELTHNSDPGCDVPEGK------YAQGTRAYVLVTESIENQWKSRNFESIDEVTWTYVGMRSGVFRTYPGHRSTRLYDPTKRPWYRRTLANPTKISISTPYFDAAGSGKIITISQAVFEGMPTLSKEHCKNINSLKPGGCHCVKDSDCLSGYCYISKAPGPD---AHETRCATERIEAITSLDIGYDSFHKRLFQIMQASDGVKSCNSSYKCPDGYLDCWTKCYIFDDRANIIMASEFVAATAFDTNKYLGITVGKKESEIMKDLIYHHKFFQRSESIDFQGACTYVSSYPQVTLKGIPRTPEDFDNYYKTRGPIPSFINSYSCIQDVVTFSANISALGPSRMIVGNVSGPCTTGFYYVTSMPETNLFLLVVESRYDRSDSFFYNFNCEISRKIVASGAYRIINGTCAHKETNKQT-------------------LAEKGTCPEIVKVNITCEYSTA--MNFQPNYKLLVINILYLVHNL 3692
            DGT+YGD+YNW DMIQNYI+Q+A +GI++D TQ LFDQA+Y  E K+G  +   + ++L +Y   +K  A RIA AA E Y+ + R  R G       L DL  +   DSD P  L    MT   +F+Q++T   STIKI D+VPR LN TIFTV WTY+LE I  E  + D+ IRW YFGS+ GV RL+PGREWSSNFVGFYTDYDPR+R WYI ATSGPKDV+I+IDCS SM GEKF IA+ V+KA+I+TLTK DY+NV+CAR SHWDE+GKWH +KS  LSC+   +V ATI  RKDL+E ID L PGGTSELE GF++ F+LL S PRTGC SI+VF+TDG+DTDGE VRCGPGYYTRSGYVPGPVCKYNWTKV S++N TN     PARIFSYL+KDDG+M PG++AC H GS+RK+  GEN+IS++ NYF+FLA+V Q  +GLWTSPYID+ G G ++THAVP IST D      +GV GVD TLEEIE  + R QWGS+TSF I+ +G  I+HPLLK S +L+DDPIFIHIQ +EQNK   PK+F+KV   MIN   G   I +GRRG  KGD++AGVKY+ MPLEYY+  ++ S  YS+A VL+ TDKV+R+L EP     + VP   S+FNLLIEYNS+ VLK YP++FK L+V++N + K+  LR+T  +SSIFFAP  +C+P +Y FDDDLA+KTLDAH YMN  T   D GC  P+ K      +  G+RAYVLVT+ IE +W+ R F  IDEV WTYVGMRSGVFRTYPGHRS R YDPTKRPWY RT ++PTK SISTPY+D+AGSGKIITISQAVFEGM   +        + KPGGC C +  +C SGYCYIS A           RCATERIEAITSLD+GY++FH++++ +MQASDGVKSCN+ +KCPDG  +C T CY+FD+RAN+IMA++F+ AT  D  +Y G+T+G+KE E+M +L++  K FQR ES+DFQG C++ +  P+VT+ GIP TPE+ DN YKTRGPIP F NSY CIQDV++F  N +ALG SRM+VGNVSGPC  GFYYVTS+ +TNLFLLV+E+  DRS + F NFNC ++RK+VASGA RIINGTCAH ++ + +                   L     CP +  V I C+++ A  +  +   KLL+  I+ +  +L
Sbjct:   58 DGTMYGDVYNWADMIQNYIQQVAADGIQRDQTQMLFDQAEYLYEKKNGTNVTMQVKQELSAYFRKKKATAHRIAEAAAEAYNRHYRQVRSGQRKIAASLSDLSVDIYRDSDIPHRLANSGMTLVPFFRQHITYNFSTIKIPDDVPRDLNETIFTVEWTYELERIFNETYQNDSSIRWLYFGSSTGVTRLYPGREWSSNFVGFYTDYDPRIRPWYIAATSGPKDVVIIIDCSASMEGEKFGIARSVAKAVIRTLTKQDYMNVVCARASHWDEVGKWHYFKSEVLSCQETKMVPATIEFRKDLMEKIDGLKPGGTSELEHGFQMGFELLNSQPRTGCLSILVFITDGKDTDGETVRCGPGYYTRSGYVPGPVCKYNWTKVWSVVNATNADSWPPARIFSYLIKDDGQMFPGALACNHSGSLRKLEDGENLISRMDNYFDFLARVAQNSKGLWTSPYIDAFGLGTMVTHAVPVISTIDTGKPRTIGVVGVDATLEEIETYVTRRQWGSVTSFLIDKEGQTIYHPLLKGSASLKDDPIFIHIQRMEQNKKSIPKEFNKVTQKMINGETGMIAIENGRRGISKGDYRAGVKYETMPLEYYFTNIEDSE-YSVAFVLSKTDKVYRKLIEPKIEFEELVPRNRSYFNLLIEYNSSTVLKHYPDVFKYLNVKYNMSKKFQKLRITELHSSIFFAPKCYCEPLRYLFDDDLARKTLDAHEYMN--TGKPDTGCHSPDSKTTDQAIFEAGSRAYVLVTQPIEERWRERKFSWIDEVIWTYVGMRSGVFRTYPGHRSVRPYDPTKRPWYSRTKSSPTKTSISTPYYDSAGSGKIITISQAVFEGMDNKTDGCNVTGKTKKPGGCPCEEGDECTSGYCYISAAKATTKEIQQGKRCATERIEAITSLDLGYNNFHRKVYNLMQASDGVKSCNAEHKCPDGSPNCKTVCYVFDNRANVIMAADFIEATDLDEGRYKGVTLGQKEGEVMMNLVFRQKLFQRDESVDFQGTCSFTAGAPRVTMNGIPTTPEESDNLYKTRGPIPGFSNSYGCIQDVISFEVNETALGRSRMLVGNVSGPCMQGFYYVTSLKDTNLFLLVIENWRDRSKTPF-NFNCLLTRKLVASGASRIINGTCAHDQSGEVSDTGGASGGSGGASSSSDNGLDADRNCPALNNVTIPCDFNRANVLQMEQVIKLLLGWIILVTVHL 1246          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. TrEMBL
Match: A0A1S3HMX0 (voltage-dependent calcium channel subunit alpha-2/delta-2 OS=Lingula unguis OX=7574 GN=LOC106156238 PE=4 SV=1)

HSP 1 Score: 1412.13 bits (3654), Expect = 0.000e+0
Identity = 670/1155 (58.01%), Postives = 860/1155 (74.46%), Query Frame = 3
Query:  258 GDIYNWVDMIQNYIKQLALNGIRKDVTQSLFDQAKYKLEIKDGMEIVKDISEQLGSYLFNRKKAALRIANAAVEIYDMNKRRKGNFSYEFLKDLPTNEVMDSDNPKSLPP-MTFNSYFKQNVTEKHSTIKIADEVPRSLNTTIFTVHWTYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREWSSNFVGFYTDYDPRVRAWYITATSGPKDVIILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVICARNSHWDEIGKWHLYKSHALSCRPDSLVAATIAHRKDLIESIDNLVPGGTSELETGFELAFDLLKSVPRTGCQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTNMGLTVPARIFSYLVKDDGEMLPGSIACGHGGSMRKIVYGENIISQLSNYFEFLAKVTQKKEGLWTSPYIDSLGTGLLITHAVPAISTEDGTLLGVAGVDVTLEEIEMLIARYQWGSMTSFFINNKGNVIFHPLLKASTTLEDDPIFIHIQSLEQNKAGNPKDFSKVVDDMINMTAGNRRIIDGRRGTPKGDFKAGVKYDKMPLEYYYAPLKHSNVYSIAIVLADTDKVFRRLEEPSNISQ---PV-PSFFNLLIEYNSTKVLKEYPNIFKELDVRFNETKYPMLRVTYNYSSIFFAPSVHCDPSKYFFDDDLAQKTLDAHRYMNELTHNSDPGCDVPE-GKYAQGTRAYVLVTESIENQWKSRNFESIDEVTWTYVGMRSGVFRTYPGHRSTRLYDPTKRPWYRRTLANPTKISISTPYFDAAGSGKIITISQAVFEGMPTLSKEHCKNINSLK--PGGCHCVKDSDCLSGYCYISKAPGPDAHETRCATERIEAITSLDIGYDSFHKRLFQIMQASDGVKSCNSSYKCPDGYLDCWTKCYIFDDRANIIMASEFVAATAFDTNKYLGITVGKKESEIMKDLIYHHKFFQRSESIDFQGACTYVSSYPQVTLKGIPRTPEDFDNYYKTRGPIPSFINSYSCIQDVVTFSANISALGPSRMIVGNVSGPCTTGFYYVTSMPETNLFLLVVESRYDRSDSFFYNFNCEISRKIVASGAYRIINGTCAHKETNKQTLAEKGTCPEIVKVNITCEYSTAMNFQPN---YKLLVINILYLVHN 3689
            GD+ NW  +IQNYI QLA +GI++DVTQSLFD A Y LE KDG E+V+ +SE+LG Y   +K+AA  +A+   +++D    R  + + + L  L T+   DSD P  LP  + F++YFKQ V+  HST+KI+DEVPR     I TV++T  LEE+ KENAK+D  +RWQYFGS AG++RL+PGREW +NF GFY DYDPRVR WYI ATSGPKDV+I++DCS SM GEKF I K ++KA+I TLT+ DY+NV+CAR SHWDE+GKWH +++  LSC+ + +V AT AHRKDLIE I  L  GGTSELE GFE+AFDLL    RTGCQSI+VF+TDG+DTDGENVRCGPGYYTRSGYVPGP+CKYNWTKV   +   N  +T  ARIFSYL K+DGE+ PG +AC H GSM++I  GEN+IS++SNYF FL+      +GLWTSPY+D+ G GLL+++ +P +S   G  +GV GVD T+E++E ++ RYQWGS+ SF IN +G  IFHP LK ST L DDPIFI I  LEQ+K G+P +FSKV+ +M+    G+ RI +GRRG+PKGDF+AG+KY+ MP  YYY  L  S  YS A  LADTD+ FRR +EP + ++   PV  S+FNLLIEYNST   +E P  F+ L+V++NE KYP LRVTY +SSIF AP  +CDP+KYF++DDLAQKT+DAH +MN +     PGC+  E GKY +G RA VL+T+ IE  W++R+F+S++EV WTYVGMR+GVFRTYPGHRSTR YDP++RPW+ R  + P K SISTPY DAAG GKI+TISQAVFEGM   + E+C+N +     PGGC C  DSDC+ G CY+SKAPG +    RCATER+EAIT LDI Y+ FHK    IMQASDG+KSC   Y CPDG  DC T+CY+FDDRAN+I   +F+ A++ DT+KY G+T+GKK+ EIM++LIY H FFQR ES+DFQG+C+     P+VTL+G P  PE+ DNYYK +GPIP F N+Y CIQDVV+F AN SALGPS MI GNVSGPC +GFYYVT +P+TNLFLLV+E   + +++ F+NFNC+I+R +V SGAYRIINGTCAH++  + TLA++G CP +  + I C Y+TA + Q +     LL++  +Y++ +
Sbjct:   32 GDVQNWATLIQNYILQLASDGIKRDVTQSLFDTATYVLEKKDGNEVVRQVSERLGDYFSVKKQAAQDLADKVRDLHDSWLLRNRSVA-DKLTQLGTDVFRDSDIPSRLPQDLEFSAYFKQPVSFNHSTVKISDEVPRDDYLVINTVNFTNGLEELFKENAKKDRFLRWQYFGSYAGLVRLYPGREWGTNFAGFYNDYDPRVRPWYIAATSGPKDVVIILDCSKSMDGEKFRITKSIAKAVINTLTRQDYVNVVCARASHWDEVGKWHHFRTQVLSCQANRMVPATNAHRKDLIEKIYALEAGGTSELEKGFEMAFDLLNGKARTGCQSILVFVTDGKDTDGENVRCGPGYYTRSGYVPGPICKYNWTKVWDTVKNENQQMTPKARIFSYLTKEDGEIFPGKLACEHRGSMKRIDSGENLISKMSNYFNFLSSNAMNTKGLWTSPYLDAWGLGLLVSYVIPVVSNITGNTIGVVGVDATIEDLENVLKRYQWGSVYSFLINKEGETIFHPFLKPSTNLLDDPIFIPISQLEQDKEGHPTEFSKVLSEMVQGETGHLRIENGRRGSPKGDFRAGIKYEIMPSTYYYGALNDSE-YSFAFSLADTDQEFRRSQEPVDKTRFHAPVNKSYFNLLIEYNSTVARREVPGAFEYLEVKYNEPKYPGLRVTYLHSSIFLAPKCYCDPNKYFYNDDLAQKTVDAHLWMNSVDEEM-PGCENMENGKYEKGLRADVLITQPIEAHWRNRSFDSLNEVKWTYVGMRTGVFRTYPGHRSTRTYDPSQRPWFFRAKSTPDKTSISTPYMDAAGVGKIVTISQAVFEGMTPRTTENCQNYSKTGPWPGGCVCDSDSDCIVGRCYLSKAPGHNRERRRCATERVEAITCLDILYNDFHKNTMAIMQASDGIKSCGMKYDCPDGEPDCETRCYLFDDRANLIADPDFLNASSLDTSKYKGVTMGKKQGEIMRELIYKHGFFQRKESLDFQGSCSISPYAPKVTLEGTPTNPEEQDNYYKNKGPIPKFSNTYGCIQDVVSFEANSSALGPSHMITGNVSGPCMSGFYYVTELPKTNLFLLVIEDFKEYTETIFFNFNCKIARSVVNSGAYRIINGTCAHQDAAETTLADQGVCPALRDIEIPCTYTTATHTQVSSCVMTLLLVVAVYVIQH 1183          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. TrEMBL
Match: R7USR9 (VWFA domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_215114 PE=4 SV=1)

HSP 1 Score: 1327 bits (3433), Expect = 0.000e+0
Identity = 635/1151 (55.17%), Postives = 818/1151 (71.07%), Query Frame = 3
Query:  246 GTLYGDIYNWVDMIQNYIKQLALNGIRKDVTQSLFDQAKYKLEIKDGMEIVKDISEQLGSYLFNRKKAALRIANAAVEIYDMNKRRKGNFSYEFLKDLPTNEVMDSDNPKSLPP-MTFNSYFKQNVTEKHSTIKIADEVPRSLNTTIFTVHWTYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREWSSNFVGFYTDYDPRVRAWYITATSGPKDVIILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVICARNSHWDEIGKWHLYKSHALSCRPDSLVAATIAHRKDLIESIDNLVPGGTSELETGFELAFDLLKSVPRTGCQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTNMGLTVPARIFSYLVKDDGEMLPGSIACGHGGSMRKIVYGENIISQLSNYFEFLAKVTQKKEGLWTSPYIDSLGTGLLITHAVPAISTEDGTLLGVAGVDVTLEEIEMLIARYQWGSMTSFFINNKGNVIFHPLLKASTTLEDDPIFIHIQSLEQNKAGNPKDFSKVVDDMINMTAGNRRIIDGRRGTPKGDFKAGVKYDKMPLEYYYAPLKHSNVYSIAIVLADTDKVFRRLEEPSNISQPVPSFFNLLIEYNSTKVLKEYPNIFKELDVRFNETKYPMLRVTYNYSSIFFAPSVHCDPSKYFFDDDLAQKTLDAHRYMNELTHNSDPGCDVPEGKYAQGTRAYVLVTESIENQWKSRNFESIDEVTWTYVGMRSGVFRTYPGHRSTRLYDPTKRPWYRRTLANPTKISISTPYFDAAGSGKIITISQAVFEGMPTLSKEHCKNINSLKPGGCHCVKDSDCLSGYCYISKAPGPDAHETRCATERIEAITSLDIGYDSFHKRLFQIMQASDGVKSCNSSYKCPDGYLDCWTKCYIFDDRANIIMASEFVAATAFDTNKYLGITVGKKESEIMKDLIYHHKFFQRSESIDFQGACTYVSSYPQVTLKGIPRTPEDFDNYYKTRGPIPSFINSYSCIQDVVTFSANISALGPSRMIVGNVSGPCTTGFYYVTSMPETNLFLLVVESRYDRSDSFFYNFNCEISRKIVASGAYRIINGTCAHKETNKQTLAEKGTCPEIVKVNITCEYSTAMNFQPNYKLLVINILYLVHNLL 3695
            GTL GD+ NW  +IQNYI QLA  GI++D TQ+LFD A Y LE+KDG+E+V  + E L  +  ++K+AA +IA   V+IYD N +   N  Y  L  +  +   DSD P  LP  +TF+ YFKQNV+ K ST+KI+DEVPR+ +  I TV +T KLE+++K+N+KED  +RWQYFGST G+ RL+PGREW++NF GFY DYDPR R WYI ATSGPKDV+I++DCS SM GEKFSI++ V+K +I TLTK DY+NVICAR SHW+E+GKWH + +  LSC+ + LV ATI+HRKD+IE I  L PGGTSELE GFELAF LL+S  RTGCQSIIVF+TDG+DTDGENVRCGPGYYTRSGYVPGP+CKYNWTKV  + ++ N  +T  ARIFSYL  D+GE  PG ++C H GS++K+ +GEN+ISQ+ NYF+FL++  +  +GLWT+PY+D  G GL++T+A+P IS  D + +GV G+D TLE++E L++  QWG++ SF IN  G  IFHP LK ST L +DPIFI I+ LEQ K G PK+F++VV  M     G++ +   R                    YYYA L  S  YS A  L++ DKVFRR ++P ++S    S+FNLL+EY+S    +E P +F+ L V +NE KYP LRV+Y +SSIF AP  HCDP+ YF+DDDLAQKT+DAH+Y+N    ++D GCD    KY  G RAY L+T+ +E  W+ R F+ +D+V WTYVGMRSGVFRTYP HRS R YDP+KR W+  + ++P K +IST Y DAAG GKIITISQA+FEGM       C ++    P GC C   SDC+SGYCY+S APG +  +TRCATERIEA+TSLDI YD FH    + M+ASD  KSC S Y CPDG   C T+CY+FD  AN+I   +F+ A   D  KY G+T+GKKE E+MKDLIY H+FF+R+ES+DFQG+C      P+VTL+GIP+ PE+ D+YYK +GPIP F N Y CI DVV +  N SALG S MI+GNVSGPC +GFYYVT++P+TNLFLLV+E+      S FYNFNC+I++ IV SGAYRIINGTC H ++  +TL E+G CP ++ ++I C + T       + LL I +L   H LL
Sbjct:   48 GTLTGDVQNWAMLIQNYILQLASEGIKRDFTQTLFDAANYTLEVKDGIELVTRMKEDLTDFFTSKKRAAQKIAKQVVKIYDTNLKEGWNSGYTALPKISRDVYRDSDIPSLLPDDLTFSPYFKQNVSSKWSTVKISDEVPRNSSAVIDTVVFTSKLEDVLKQNSKEDHYLRWQYFGSTVGLARLYPGREWNTNFAGFYNDYDPRTRPWYIAATSGPKDVVIILDCSMSMKGEKFSISQAVAKTVIDTLTKQDYVNVICARASHWNEVGKWHFFTTRVLSCQEEQLVQATISHRKDMIEKIYKLEPGGTSELEKGFELAFQLLESKTRTGCQSIIVFVTDGKDTDGENVRCGPGYYTRSGYVPGPICKYNWTKVWDVADQQNRRMTPQARIFSYLTVDEGEQFPGHLSCHHRGSLKKLNHGENLISQMGNYFDFLSRNARNSKGLWTAPYLDDWGLGLMVTYAMPCISHVDNSTIGVVGIDATLEDLENLLSSQQWGTVYSFLINKHGQTIFHPRLKPSTALVEDPIFIPIEQLEQ-KGGIPKEFTEVVAAMKAGLTGHKDVFISR-------------------TYYYAGLTGSE-YSFAFSLSEADKVFRRAQQPQDLSSYGKSYFNLLVEYDSEVARRELPGVFEYLKVFYNEKKYPSLRVSYLHSSIFLAPKCHCDPNAYFYDDDLAQKTVDAHKYIN--GADADDGCD-KGAKYNTGIRAYALITQPVELLWRVREFDGVDDVKWTYVGMRSGVFRTYPAHRSRRTYDPSKRSWFLTSASSPLKTTISTAYMDAAGVGKIITISQALFEGMIPRKPNQCAHLTPPFPSGCPCRGSSDCISGYCYVSVAPGANKEKTRCATERIEAVTSLDILYDRFHMITMRTMEASDLQKSCGSKYNCPDGEYGCQTRCYLFDGSANLITDPDFITANPLDDRKYKGVTMGKKEGEVMKDLIYKHRFFRRTESVDFQGSCGLSPYRPKVTLEGIPKNPEEQDDYYKNKGPIPKFSNEYGCITDVVKYVVNESALGISGMIMGNVSGPCMSGFYYVTALPKTNLFLLVIENWRHYKMSTFYNFNCKIAQSIVNSGAYRIINGTCDHTDSTTETLDEQGKCPLLLDIDIPCMFQTGCQHHTPW-LLFICLLLFSHILL 1173          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. TrEMBL
Match: A0A2C9JBX7 (VWFA domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106065960 PE=4 SV=1)

HSP 1 Score: 1268.06 bits (3280), Expect = 0.000e+0
Identity = 620/1155 (53.68%), Postives = 805/1155 (69.70%), Query Frame = 3
Query:  246 GTLYGDIYNWVDMIQNYIKQLALNGIRKDVTQSLFDQAKYKLEIKDGMEIVKDISEQLGSYLFNRKKAALRIANAAVEIYDMNKRRKGNFSYEFLKDLPTNEVMDSDNPKSLPP-MTFNSYFKQNVTEKHSTIKIADEVPRSLNTTIFTVHWTYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREWSSNFVGFYTDYDPRVRAWYITATSGPKDVIILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVICARNSHWDEIGKWHLYKSHALSCRPDSLVAATIAHRKDLIESIDNLVPGGTSELETGFELAFDLLKSVPRTGCQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTNMGLTVPARIFSYLVKDDGEMLPGSIACGHGGSMRKIVYGENIISQLSNYFEFLAKVTQKKEGLWTSPYIDSLGTGLLITHAVPAISTEDGTLLGVAGVDVTLEEIEMLIARYQWGSMTSFFINNKGNVIFHPLLKASTTLEDDPIFIHIQSLEQNKAGNPKDFSKVVDDMINMTAGNRRIIDGRRGTPKGDFKAGVKYDKMPLEYYYAPLKHSNVYSIAIVLADTDKVFRRLEEPSNISQPVPSFFNLLIEYNSTKVLKEYPNIFKELDVRFNETKYPMLRVTYNYSSIFFAPSVHCDPSKYFFDDDLAQKTLDAHRYMNELTHNSDPGC--DVPEGKYAQGTRAYVLVTESIENQWKSRNFESIDEVTWTYVGMRSGVFRTYPGHRSTRLYDPTKRPWYRRTLANPTKISISTPYFDAAGSGKIITISQAVFEGMPTLSKEHCKNINSLK-PGGCHCVKDSDCLSGYCYISKAPGPDAHETRCATERIEAITSLDIGYDSFHKRLFQIMQASDGVKSCNSSYKCPDGYLDCWTKCYIFDDRANIIMASEFVAATAFDTNKYLGITVGKKESEIMKDLIYHHKFFQRSESIDFQGACTYVSSYPQVTLKGIPRTPEDFDNYYKTRGPIPSFINSYSCIQDVVTFSANISALGPSRMIVGNVSGPCTTGFYYVTSMPETNLFLLVVESRYDRSDSFFYNFNCEISRKIVASGAYRIINGTCAHKETNKQTLAEKGTCPEIVKVNITCEYSTAMNFQPN-YKLLVINILYLVHNLL 3695
            G+L GD+ NW  +IQNY+ QLA +GI++D+TQS FD+A Y  E K+G E+VK +++ L  Y   +  AA+ +      +YD         +   L +LP +   +SD P  LP  + F+ YF+Q V++ +ST+KIADEVPR     I TV +T  LEE   +NA +D  +RWQYFGS  GV RLFPGREWS+NF GFY DYDPRVR WYI ATSGPKDVII++DCS SM GEKFSIAK V+K +I TLTK DY+NVICARNSHW+E+GKWH Y +  LSC+   +V  T A RKDLIE I+ L  GGT+ELE GF+ AF LL+SVPRTGCQSIIVF TDG+DTDGE+VRCGPGYYTRSGYVPGP+CKYN+T V+++  + N  L   ARIFSYL+ +D EM PG++AC H GS+ K++ GEN+I+Q+SNYFEFL+ ++     LWTSPYIDS G GL+ITHAVP IS   G ++GV GVD TL+EIE  + ++QWGS+ SF +N+K  VIFHP LK ST L +DPI I I  LEQ+K G P +FS++ + M+   +G + I   R G  +               YYY  +K ++ Y  A  LA+ D  FRR +EP N S    S++NLL  YNST + ++    F+ +DVR N+ KYP LRVTYN+S+IF AP  HCDP +Y ++D LA+KTLDAH ++N   +  D GC  D  E  + +G RA VL+T  IE  WK+RNFES+D+V WT VG+RSGVFRTYPGHRSTR YDPT+RPWY+RT +NP K S+STPY D+AG GKI TISQAVFEGM   S + C      +  GGC C  DSDC    CY+SKAPGP++   RCATER+EA+T LDI YD F K+  + MQASD  KSC   Y C +G  +C T+CY+FD  A ++M  +F+ A A D ++Y  +T+G+KE E+MK L+Y+HKF  R ESIDFQG+C   +  P+VTL G+P+TPED D+YYK RG IP F N + CIQDVV++  + +ALGPS MI GNVSGPC +G YYVT++P+TNL+LLV+E       S FYNF+C+I+R +V SGAYRIINGTCAH++T+ +T+ E+G CP + +V + C+++ A     N   +L + I +L+H  L
Sbjct:   41 GSLAGDVQNWAMLIQNYLLQLANDGIKRDMTQSFFDEATYLSEKKNGSELVKLVNDTLSEYFRKKTSAAMALVEKVRLLYDEYYLANDTTTARTLNELPADLYYESDIPDKLPKDLMFSPYFRQKVSKLNSTVKIADEVPRDDPFVIDTVLFTKNLEETFLQNADKDPLLRWQYFGSVTGVTRLFPGREWSTNFAGFYDDYDPRVRPWYIQATSGPKDVIIILDCSLSMKGEKFSIAKAVAKTVINTLTKQDYVNVICARNSHWNEVGKWHYYDTQVLSCQEQRMVQGTNAFRKDLIEKIEKLKAGGTTELEKGFDRAFSLLRSVPRTGCQSIIVFATDGKDTDGEDVRCGPGYYTRSGYVPGPICKYNFTSVYNVAMEKNKYLP-NARIFSYLIVEDAEMFPGTLACDHNGSLLKLLTGENLITQMSNYFEFLSAISVSGTTLWTSPYIDSWGLGLMITHAVPVISNRTGKIIGVVGVDATLDEIENFLTKHQWGSVYSFLVNSKSGVIFHPRLKPSTKLLEDPISIPISQLEQDKDGKPSEFSEIEEAMLEGRSGMKVIPKARGGKMR--------------TYYYGSIKGTD-YCFAYSLANEDMEFRRSQEPKNRSHIGVSYYNLLKMYNSTLLREKLKGTFEAIDVRENDEKYPGLRVTYNHSTIFLAPQSHCDPIRYSYNDSLAEKTLDAHLWIN--GNEPDRGCDDDDSEQMFNKGIRADVLITFPIEEIWKTRNFESLDQVKWTNVGLRSGVFRTYPGHRSTRNYDPTQRPWYKRTSSNPHKTSVSTPYMDSAGVGKINTISQAVFEGMTPKSDQDCAEFPKGQLMGGCRCEVDSDCYIKVCYMSKAPGPNSDHRRCATERVEAVTGLDILYDDFQKKSLESMQASDFRKSCGQKYTCRNGEPNCETRCYLFDSSAYLVMDPDFLTANALDESQYQSVTLGRKEGEVMKHLVYYHKFIIREESIDFQGSCRISADEPKVTLDGLPQTPEDTDDYYKNRGKIPKFYNDFGCIQDVVSYRTDDAALGPSGMITGNVSGPCMSGLYYVTALPQTNLYLLVIEDWLVYKQSMFYNFHCKITRSVVNSGAYRIINGTCAHEDTSARTMKEEGKCPALNEVPLKCQFNRATLVVLNTLSILPVLIYFLLHRTL 1177          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Ensembl Cavefish
Match: CACNA2D3 (calcium voltage-gated channel auxiliary subunit alpha2delta 3 [Source:NCBI gene;Acc:103032408])

HSP 1 Score: 182.185 bits (461), Expect = 3.572e-46
Identity = 141/542 (26.01%), Postives = 238/542 (43.91%), Query Frame = 3
Query:  246 GTLYGDIYNWVDMIQNYIKQLALNGIRKDVTQSLFDQAKYKLEIK--DGMEIVKDISEQLGSYLFNRKKAALRIANAAVEIYDMNKRRKGNFSYEFLKDLPTNEVMDSDNPKSLPP---MTFNSYFKQ-NVTEKHSTIKIADEVPRSLNTTIFTVHWTYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREWSSNFVGFYTDYDPRVRAWYITATSGPKDVIILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVICARNS-HWDEIGKWHLYKSHALSCRPDSLVAATIAHRKDLIESIDNLVPGGTSELETGFELAFDLLKSVPRTG----CQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTNMGLTVPARIFSYLVKDDGEMLPGS--IACGHGGSMRKIVYGENIISQLSNYFEFLAK---VTQKKEGLWTSPYIDSL-----GTGLLITHAVPAISTED-----GTLLGVAGVDVTLEEIEMLIARYQWGSMT-SFFINNKGNVIFHPLLK 1790
            G    D+  W       +K +A       + Q  + + ++ + ++  DG+++V+ +++ +      + +A  R+  AA E + +      N  YE+   +  NE+ D  N   L     +  N +F   +V    S +++   +    +  +  V+W+  L ++  +N + D  + WQYFGS  G  R +PG +W+ +  G    +D R R WYI A + PKDV+IL+D S SM G + +IAK+   +I+ TL   D+ N+I      H+ E             C   +LV A + ++    E +D L   G   L+     AF+LL    +TG    C   I+ +TDG     + V                  KYNW                  RIF YL+  +         +AC + G   +I    ++   +  Y   L++   + Q+ + +WT  YID+      G GL+ T A+P  ST++     G LLGV G DV + E+   I +Y+ G    +F I N G ++ HP L+
Sbjct:   36 GIPLSDVKLWASAFGGEMKSIAAKYSGSQLLQKKYKEYEHSVRVEEIDGLKLVERLAKNMEEMFHKKAEAMKRLVEAAEEAH-LQHEEDPNLQYEYFNAVLINELDDVGNNVELGGEFILQPNDHFNNLSVNLSLSVVQVPTNMYNKDSAIVNGVYWSEALNKVFVDNFERDPSLIWQYFGSAKGFFRQYPGIKWTPDEHGVIA-FDCRNRKWYIQAATSPKDVVILVDVSGSMKGLRLTIAKQTVSSILDTLGDDDFFNIIAYNEELHYVE------------PCLNGTLVQADVTNKDHFREHLDKLFAKGIGMLDVALTEAFELLTDFNQTGRGSVCSQAIMLVTDGAVDTYDTV----------------FAKYNWPDRK-------------VRIFPYLIGRESAFADNLKWMACANKGYFTQISTLADVQENVMEYLHVLSRPKVIDQEHDVVWTEAYIDNTMEDNQGPGLMTTVAMPVFSTKNETKNKGILLGVVGTDVPVSELLKTIPKYKLGIHGYAFAITNNGYILTHPDLR 534          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Ensembl Cavefish
Match: CACNA2D3 (calcium voltage-gated channel auxiliary subunit alpha2delta 3 [Source:NCBI gene;Acc:103032408])

HSP 1 Score: 181.415 bits (459), Expect = 6.567e-46
Identity = 141/543 (25.97%), Postives = 238/543 (43.83%), Query Frame = 3
Query:  246 GTLYGDIYNWVDMIQNYIKQLALNGIRKDVTQSLFDQAKYKLEIK--DGMEIVKDISEQLGSYLFNRKKAALRIANAAVEIYDMNKRRKGNFSYEFLKDLPTNEVMDSDNPKSLPP---MTFNSYFKQ-NVTEKHSTIKIADEVPRSLNTTIFTVHWTYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREWSSNFVGFYTDYDPRVRAWYITATSGPKDVIILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVICARNS-HWDEIGKWHLYKSHALSCRPDSLVAATIAHRKDLIESIDNLVPGGTSELETGFELAFDLLKSVPRTG----CQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTNMGLTVPARIFSYLVKDDGEMLPGS--IACGHGGSMRKIVYGENIISQLSNYFEFLAK---VTQKKEGLWTSPYIDSL------GTGLLITHAVPAISTED-----GTLLGVAGVDVTLEEIEMLIARYQWGSMT-SFFINNKGNVIFHPLLK 1790
            G    D+  W       +K +A       + Q  + + ++ + ++  DG+++V+ +++ +      + +A  R+  AA E + +      N  YE+   +  NE+ D  N   L     +  N +F   +V    S +++   +    +  +  V+W+  L ++  +N + D  + WQYFGS  G  R +PG +W+ +  G    +D R R WYI A + PKDV+IL+D S SM G + +IAK+   +I+ TL   D+ N+I      H+ E             C   +LV A + ++    E +D L   G   L+     AF+LL    +TG    C   I+ +TDG     + V                  KYNW                  RIF YL+  +         +AC + G   +I    ++   +  Y   L++   + Q+ + +WT  YID+       G GL+ T A+P  ST++     G LLGV G DV + E+   I +Y+ G    +F I N G ++ HP L+
Sbjct:   36 GIPLSDVKLWASAFGGEMKSIAAKYSGSQLLQKKYKEYEHSVRVEEIDGLKLVERLAKNMEEMFHKKAEAMKRLVEAAEEAH-LQHEEDPNLQYEYFNAVLINELDDVGNNVELGGEFILQPNDHFNNLSVNLSLSVVQVPTNMYNKDSAIVNGVYWSEALNKVFVDNFERDPSLIWQYFGSAKGFFRQYPGIKWTPDEHGVIA-FDCRNRKWYIQAATSPKDVVILVDVSGSMKGLRLTIAKQTVSSILDTLGDDDFFNIIAYNEELHYVE------------PCLNGTLVQADVTNKDHFREHLDKLFAKGIGMLDVALTEAFELLTDFNQTGRGSVCSQAIMLVTDGAVDTYDTV----------------FAKYNWPDRK-------------VRIFPYLIGRESAFADNLKWMACANKGYFTQISTLADVQENVMEYLHVLSRPKVIDQEHDVVWTEAYIDNTQMEDNQGPGLMTTVAMPVFSTKNETKNKGILLGVVGTDVPVSELLKTIPKYKLGIHGYAFAITNNGYILTHPDLR 535          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Ensembl Cavefish
Match: CACNA2D3 (calcium voltage-gated channel auxiliary subunit alpha2delta 3 [Source:NCBI gene;Acc:103032408])

HSP 1 Score: 179.489 bits (454), Expect = 2.640e-45
Identity = 140/512 (27.34%), Postives = 227/512 (44.34%), Query Frame = 3
Query:  354 QAKYK-------LEIKDGMEIVKDISEQLGSYLFNRKKAALRIANAAVEIYDMNKRRKGNFSYEFLKDLPTNEVMDSDNPKSLPP---MTFNSYFKQ-NVTEKHSTIKIADEVPRSLNTTIFTVHWTYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREWSSNFVGFYTDYDPRVRAWYITATSGPKDVIILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVICARNS-HWDEIGKWHLYKSHALSCRPDSLVAATIAHRKDLIESIDNLVPGGTSELETGFELAFDLLKSVPRTG----CQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTNMGLTVPARIFSYLVKDDGEMLPGS--IACGHGGSMRKIVYGENIISQLSNYFEFLAK---VTQKKEGLWTSPYIDSL------GTGLLITHAVPAISTED-----GTLLGVAGVDVTLEEIEMLIARYQWGSMT-SFFINNKGNVIFHPLLK 1790
            Q KYK       +E  DG+++V+ +++ +      + +A  R+  AA E + +      N  YE+   +  NE+ D  N   L     +  N +F   +V    S +++   +    +  +  V+W+  L ++  +N + D  + WQYFGS  G  R +PG +W+ +  G    +D R R WYI A + PKDV+IL+D S SM G + +IAK+   +I+ TL   D+ N+I      H+ E             C   +LV A + ++    E +D L   G   L+     AF+LL    +TG    C   I+ +TDG     + V                  KYNW                  RIF YL+  +         +AC + G   +I    ++   +  Y   L++   + Q+ + +WT  YID+       G GL+ T A+P  ST++     G LLGV G DV + E+   I +Y+ G    +F I N G ++ HP L+
Sbjct:   15 QKKYKEYEHSVRVEEIDGLKLVERLAKNMEEMFHKKAEAMKRLVEAAEEAH-LQHEEDPNLQYEYFNAVLINELDDVGNNVELGGEFILQPNDHFNNLSVNLSLSVVQVPTNMYNKDSAIVNGVYWSEALNKVFVDNFERDPSLIWQYFGSAKGFFRQYPGIKWTPDEHGVIA-FDCRNRKWYIQAATSPKDVVILVDVSGSMKGLRLTIAKQTVSSILDTLGDDDFFNIIAYNEELHYVE------------PCLNGTLVQADVTNKDHFREHLDKLFAKGIGMLDVALTEAFELLTDFNQTGRGSVCSQAIMLVTDGAVDTYDTV----------------FAKYNWPDRK-------------VRIFPYLIGRESAFADNLKWMACANKGYFTQISTLADVQENVMEYLHVLSRPKVIDQEHDVVWTEAYIDNTQMEDNQGPGLMTTVAMPVFSTKNETKNKGILLGVVGTDVPVSELLKTIPKYKLGIHGYAFAITNNGYILTHPDLR 483          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Ensembl Cavefish
Match: CACNA2D3 (calcium voltage-gated channel auxiliary subunit alpha2delta 3 [Source:NCBI gene;Acc:103032408])

HSP 1 Score: 179.104 bits (453), Expect = 3.860e-45
Identity = 141/549 (25.68%), Postives = 238/549 (43.35%), Query Frame = 3
Query:  246 GTLYGDIYNWVDMIQNYIKQLALNGIRKDVTQSLFDQAKYKLEIK--DGMEIVKDISEQLGSYLFNRKKAALRIANAAVEIYDMNKRRKGNFSYEFLKDLPTNEVMDSDNPKSLPP---MTFNSYFKQ-NVTEKHSTIKIADEVPRSLNTTIFTVHWTYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREWSSNFVGFYTDYDPRVRAWYITATSGPKDVIILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVICARNS-HWDEIGKWHLYKSHALSCRPDSLVAATIAHRKDLIESIDNLVPGGTSELETGFELAFDLLKSVPRTG----CQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTNMGLTVPARIFSYLVKDDGEMLPGS--IACGHGGSMRKIVYGENIISQLSNYFEFLAK---VTQKKEGLWTSPYIDSL------------GTGLLITHAVPAISTED-----GTLLGVAGVDVTLEEIEMLIARYQWGSMT-SFFINNKGNVIFHPLLK 1790
            G    D+  W       +K +A       + Q  + + ++ + ++  DG+++V+ +++ +      + +A  R+  AA E + +      N  YE+   +  NE+ D  N   L     +  N +F   +V    S +++   +    +  +  V+W+  L ++  +N + D  + WQYFGS  G  R +PG +W+ +  G    +D R R WYI A + PKDV+IL+D S SM G + +IAK+   +I+ TL   D+ N+I      H+ E             C   +LV A + ++    E +D L   G   L+     AF+LL    +TG    C   I+ +TDG     + V                  KYNW                  RIF YL+  +         +AC + G   +I    ++   +  Y   L++   + Q+ + +WT  YID+             G GL+ T A+P  ST++     G LLGV G DV + E+   I +Y+ G    +F I N G ++ HP L+
Sbjct:   36 GIPLSDVKLWASAFGGEMKSIAAKYSGSQLLQKKYKEYEHSVRVEEIDGLKLVERLAKNMEEMFHKKAEAMKRLVEAAEEAH-LQHEEDPNLQYEYFNAVLINELDDVGNNVELGGEFILQPNDHFNNLSVNLSLSVVQVPTNMYNKDSAIVNGVYWSEALNKVFVDNFERDPSLIWQYFGSAKGFFRQYPGIKWTPDEHGVIA-FDCRNRKWYIQAATSPKDVVILVDVSGSMKGLRLTIAKQTVSSILDTLGDDDFFNIIAYNEELHYVE------------PCLNGTLVQADVTNKDHFREHLDKLFAKGIGMLDVALTEAFELLTDFNQTGRGSVCSQAIMLVTDGAVDTYDTV----------------FAKYNWPDRK-------------VRIFPYLIGRESAFADNLKWMACANKGYFTQISTLADVQENVMEYLHVLSRPKVIDQEHDVVWTEAYIDNTLPQAQKQMEDNQGPGLMTTVAMPVFSTKNETKNKGILLGVVGTDVPVSELLKTIPKYKLGIHGYAFAITNNGYILTHPDLR 541          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Ensembl Cavefish
Match: cacna2d2b (calcium channel, voltage-dependent, alpha 2/delta subunit 2b [Source:ZFIN;Acc:ZDB-GENE-060503-99])

HSP 1 Score: 172.17 bits (435), Expect = 4.336e-43
Identity = 145/546 (26.56%), Postives = 251/546 (45.97%), Query Frame = 3
Query:  360 KYKLEIKDGMEIVKDISEQLGSYLFNRKKAALRIANAAVEIYDMNKRRKGNFSYEFLKDLPTNEVMDSDNPKSLPPMTFNSYFKQNVTEKHSTIKIADEVPRSLNTTIFTVHWTYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREWSS-NFVGFYTDYDPRVRAWYITATSGPKDVIILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVICARNSHWDEIGKWHLYKSHALSCRPDSLVAATIAHRKDLIESIDNLVPGGTSELETGFELAFDLL---KSVPRTGCQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTNMGLTVPARIFSYLV-KDDGEMLPGS-IACGHGGSMRKIVYGENIISQLSNYFEFLAKVT-----QKKEGLWTSPYIDSLGTGLLITHAVPAIS-TEDGT-----LLGVAGVDVTLEEIEMLIARYQWGSMTSFF-INNKGNVIFHPLLKASTTLEDDPIFIHIQSLEQNKAGNPKDFSKVVDDMINMTAGNRRIIDGRRG 1943
            +Y L   +  EIV+ ++  +   L  +K+A  ++A+ A  +      +K +   + +KD    E   S   +      ++  FK NV   ++ ++I  ++ +     +  ++WT  LE +  EN++ED  + WQ FGS  GV R +P   W + + +     YD R R WYI   S PKD++IL+D S S++G    + K     ++ TL+  DY+NV     + ++E       K+ A+      LV A + +++   E +  +   GT++ ++GF  AF+ L    +VPR  C  II+  TDG +   +++                  ++NW       NKT        R+F++ V + + ++ P   IAC + G   +I     I      Y + L +         K+  WT+ Y D+LG GL++T  +P  + + DG      +LGV GVDV L+E++ L  RY  G+    F I+  G ++ HP L+A      +P+ +              DF     + I+     R++IDGR G
Sbjct:   34 QYSLVRNNPREIVEKVASDIEKLLAKKKRALEKLASEAERV------QKAHRWQDSIKDGDEFEAQMSLKLE----FVYDPNFKNNVNYSYTAVQIPTDIYKGAPVILNELNWTQALERVFMENSREDPSLLWQAFGSATGVTRYYPATPWRAPDKIDL---YDVRRRPWYIQGASSPKDMVILVDVSGSVSGLTLKLIKASVTEMLDTLSDDDYVNV-----ARFNE-------KAEAVVPCFKHLVQANVRNKRIFKEHVSQMQAKGTTDYKSGFRFAFNQLLNNTNVPRANCNKIIMLFTDGGEDRAQDI----------------FEQHNWP------NKT-------VRVFTFSVGQHNYDVTPLQWIACANKGYYFEIRSICAIRINTQEYLDVLGRPMVLAGRSAKQVQWTNVYQDALGLGLVVTGTMPVFNLSMDGNFQNQLILGVMGVDVHLDELKRLAPRYNLGANGYIFAIDPNGYLLLHPNLQAKVVDLPEPVTL--------------DFLDAEVEDISKQEIRRQMIDGRAG 511          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Ensembl Sea Lamprey
Match: cacna2d1a (calcium channel, voltage-dependent, alpha 2/delta subunit 1a [Source:ZFIN;Acc:ZDB-GENE-041210-215])

HSP 1 Score: 149.828 bits (377), Expect = 6.352e-37
Identity = 114/399 (28.57%), Postives = 184/399 (46.12%), Query Frame = 3
Query:  690 VHWTYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREWSSNFVGFYTDYDPRVRAWYITATSGPKDVIILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVICARNSHWDEIGKWHLYKSHALSCRPDSLVAATIAHRKDLIESIDNLVPGGTSELETGFELAFDLL--KSVPRTGCQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTNMGLTVPARIFSYLV-KDDGEMLPGS-IACGHGGSMRKIVYGENIISQLSNYFEFLAKVT-----QKKEGLWTSPYIDSLGTGLLITHAVPA----------ISTEDGTLLGVAGVDVTLEEIEMLIARYQWGSMTSFF-INNKGNVIFHPLLKASTTLEDDPIFI 1826
            ++WT  L+E+ K N +ED  + WQ FGS  G+ R +P   W +   G    +D R R WYI   S PKD++I+ID S S++G    + K+    +++TL+  DY+NV    N            ++  +SC  + LV A + +++ L ES++ L   G +  +  F  AF+ L   +V R  C  +I+  TDG +   ++V                   YNW K                R+F++ V + +  + P   +AC + G   +I     I     +Y + L +       + K+  WT+ Y D+L  GL+IT  +P           I  ++  LLGV GVD++L++I+ L  +Y  G    FF I+  G V+ HP LK        P+ I
Sbjct:   25 LNWTAGLDEVFKLNKEEDPTLLWQVFGSATGLTRFYPATPWVAP--GDVDLFDVRRRPWYIQGASSPKDMVIIIDVSGSVSGLTLKLMKKSVSEMLETLSDDDYVNVASFHN------------EAVPVSCF-NHLVQANVRNKQMLSESVEKLTAKGMTNYKAAFTYAFEQLLNTNVTRANCNKMIMMFTDGGEDRAQDV----------------FENYNWPKKE-------------VRVFTFSVGQHNYNVAPIQWMACANKGFYFEIPSIGAIRINTQDYLDVLGRPMVLAGPKAKKVQWTNVYKDALNLGLVITGTMPVFNISKNAGNKIHLKNQLLLGVMGVDISLDDIKKLTTQYNLGPNGYFFAIDPNGYVLLHPNLKPKVLSLAVPLII 379          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Ensembl Sea Lamprey
Match: cacna2d4b (calcium channel, voltage-dependent, alpha 2/delta subunit 4b [Source:ZFIN;Acc:ZDB-GENE-100422-18])

HSP 1 Score: 132.109 bits (331), Expect = 1.811e-32
Identity = 122/485 (25.15%), Postives = 210/485 (43.30%), Query Frame = 3
Query:  369 LEIKDGMEIVKDISEQLGSYLFNRKKAALRIANAAVEIYDMNKRRKGNFSYEFLKDLPTNEVMDSDNPKSLPP---MTFNSYFKQ-NVTEKHSTIKIADEVPRSLNTTIFTVHWTYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREWSSNFVGFYTDYDPRVRAWYITATSGPKDVIILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVICARNS-HWDEIGKWHLYKSHALSCRPDSLVAATIAHRKDLIESIDNLVPGGTSELETGFELAFDLLKSVPRTG----CQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTNMGLTVPARIFSYLVKDDGEMLPGS-----IACGHGGSMRKIVYGE---NIISQLSNYFEFLAKVTQ--------KKEGLWTSPYIDSLGTGLLITHAVPAISTED-----GTLLGVAGVDVTLEEIEMLIARYQWGS 1733
            +E   G+++V+ ++  +   L  + +A ++    A E  D+         Y++   +  N+V +  N   L     +  N++F    V    S +++   V       +    W+  L  + ++N + D  + WQY+GS+ G  R +PG +W+ +  G  + +D R R WYI A + PKD++IL+D S SM G + +IAK+    I+ TL  +D++NVI      H+ E             C    +V A   +R+   + ++++   G ++L    E  F +L     TG    C   ++ +TDG     E V                     + K +S   K         RIF+YL+   G  L  +     +AC +     +I+  +   N +  L  YF  L K T+        KK  L+++    S G  L+ T A+P  S ++     G LLGV G DV L+E+  +  RY+  S
Sbjct:   12 IEEMHGLKMVRKLARLMEDMLSRKTEAEIQRLVEAAEEADLKHEFNSEMQYDYYNAVFINDVDEEGNYIELAREFILEPNAHFNNLAVNTSLSNVQVPTNVYNKEPNIVNGAFWSEALNPVFEDNFERDATLTWQYYGSSTGFFRQYPGIKWTPDENGVIS-FDCRNRGWYIQAATSPKDIVILVDVSGSMKGLRLTIAKQTISTILDTLGDNDFVNVIAYNEQLHYIE------------PCFEGGMVQANRDNREHFKQLLEDMHAQGVADLANALEEGFVILDQFNATGQGSSCNQALMVVTDGAVETFEEV---------------------FEKYNSPDKKV--------RIFTYLI---GRELAFANPIKWMACANKAHFTRIIVLKDTTNNVVCLIIYFVMLLKHTRPLCHFCAMKKSFLYST---SSQGLLLMTTVAMPVFSKKNETRSHGILLGVVGTDVPLKELLKMAPRYKVCS 448          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Ensembl Nematostella
Match: EDO44603 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV93])

HSP 1 Score: 1003.43 bits (2593), Expect = 0.000e+0
Identity = 493/1129 (43.67%), Postives = 709/1129 (62.80%), Query Frame = 3
Query:  264 IYNWVDMIQNYIKQLALNGIRKDVTQSLFDQAKYKLEIKDGMEIVKDISEQLGSYLFNRKKAALRIANAAVEIYD---MNKRRKGNFSYEFLKDLPTNEVMDSDNPKSLPPMTFNSYFKQNVTEKHSTIKIADEVPRSLNTTIFTVHWTYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREWSSNFVGFYTDYDPRVRAWYITATSGPKDVIILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVICARNSHWDEIGKWHLYKSHALSCRPDSLVAATIAHRKDLIESIDNLVPGGTSELETGFELAFDLLKSVPRTGCQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTNMGLTVPARIFSYLVKDDGEMLPGSIACGHGGSMRKIVYGENIISQLSNYFEFLAKVTQKKEGL-WTSPYIDSLGTGLLITHAVPAISTEDGTLLGVAGVDVTLEEIEMLIARYQWGSMTSFFINNKGNVIFHPLLKASTTLEDDPIFIHIQSLEQNKAGNPKDFSKVVDDMINMTAGNRRIIDGRRGTPKGDFKAGVKYDKMPLEYYYAPLKHSNVYSIAIVLADTDKVFRRLEEPSNISQPVPSFFNLLIEYNSTKVLKEYPNIFKELDVRFNETKYPMLRVTYNYSSIFFAPSVHCDPSKYFFDDDLAQKTLDAHRYMNELTHNSDPGCDVPEGKYAQGTRAYVLVTESIENQWKSRNFESIDEVTWTYVGMRSGVFRTYPGHRSTRLYDPTKRPWYRRTLANPTKISISTPYFDAAGSGKIITISQAVFEGMPTLSKEHCKNINSLKPGGCHCVKDSDCLSGYCYISKAPGPDAHETRCATERIEAITSLDIGYDSFHKRLFQIMQASDGVKSCNSSYKCPDGYLDCWTKCYIFDDRANIIMASEFVAATAFDTNKYLGITVGKKESEIMKDLIYHHKFFQRSESIDFQGACTYVSSYPQVTLKGIPRTPEDFDNYYKTRGPIPSFINSYSCIQDVVTFSANISALGPSRMIVGNVSGPCTTGFYYVTSMPETNLFLLVVESRYDRSDSFFYNFNCEISRKIVASGAYRIINGTCAHKETNKQTLAEKGTCPEIVKVNITCEYSTAMNF 3638
            + +W   ++ Y+ +LA  G++    Q  +D+A Y +E KDG+E +K + + LG+Y   +++AA ++A    E++D    N + + N     LKDL  +   D D  K+LP + F++ FK  V++  S IKI+D+V R+    I TV+W+ KL+E+ K+N  +D  +RWQ FGS  GVLR +P  EW +NF GF+ DYDPR+R WYI ATSGPKD++I++DCS SM G++  +AKE++K ++ TLTK D++NVIC   S+WDE+GK                                             F+ AF+LLK   +TGCQSII+F+TDG D DG+ VRCG GYYTRSGYVPG +CKY+W KV + +   N  +    RIFSYL  D GE  PG ++C + G M+++V  ENIISQ+  Y+ FLA  T     + WT+PY+D+ G GL++T A+P  S      +GV G+D TLEEIE ++   QWGS+ +F IN++G  IFHPLL+ ST L DDPIFI I  LEQ + G PK+FSKV + M++   G+ RI +  R  PKGDF+ GV     P  Y+Y  +K S VY+ A  LAD+D  FRR   P N S     +++ L  YN + V KE   ++ +LDV++N   YP + ++ +  S+  AP  +C P+ Y F  +++   ++AHR +N +T+++  GC  P   +    R  V+VT  +E+ W  RN E++ +V WTYVG RSGVF   PGHR+ R YDPT+RPWY+RTL NP K ++S  Y D +G GK+ITISQAVF+G+PT  K +C  +++L+ GGC CV    CLSG C         A+ T CA +R+EA+T+LD+ Y  FH+R++++M A DG +SC ++Y CPDG   C TKCY+ D+ AN++    F+  +  D  +Y  +++G+KE ++MK LI     FQ++  IDFQG C+     P+VTL+G+ +TPE  D+YYK +GPIP F N Y CIQDVV +SA+ SALG   +I G+V GPC +G Y++T++P+TNL+LLV+E+  +   S+FYNFNC IS ++  +GA+RI+NGTCAH ET K  L  K  CP +  V + C Y++ + F
Sbjct:   28 VESWAQKVEGYLLKLAEEGLKTKELQREYDKAVYTVENKDGLETIKSVKDLLGNYFVKKEQAAKKLAEEVAELHDKFYTNSKLQHNAKVTNLKDLGVDHYTDKDIVKTLPDLEFDTLFKMRVSKSKSAIKISDQVVRNDKNLIETVYWSSKLDEMFKKNLADDPELRWQNFGSVEGVLRQYPSSEWQTNFAGFHIDYDPRMRPWYIGATSGPKDIVIILDCSLSMKGKRLRMAKEIAKTVLNTLTKQDFVNVICGHASNWDEVGK-------------------------------------------AAFKKAFELLKGRAKTGCQSIIIFVTDGEDNDGDPVRCGQGYYTRSGYVPGQLCKYDWAKVWNEVEAINKYMNPRTRIFSYLTNDRGEEFPGKLSCDNNGYMKRLVDNENIISQMQEYYSFLASNTISINNVTWTAPYLDASGLGLMVTVAMPVTSKLTNRTIGVVGIDATLEEIENILQNDQWGSVYAFLINDEGETIFHPLLRPSTELVDDPIFIQISDLEQ-RDGEPKEFSKVQEAMMDGKTGSYRIENAIRSIPKGDFQDGVVLVTSPSTYFYTSIKDS-VYAFAFNLADSDVDFRRPLRPKNQSDGQILYYSYLEAYNLSSVRKELGGLYDKLDVKYNLPAYPNIYISLDRPSVMLAPKTYCHPNDYLFHYNISTIAVEAHRIINGITNST--GC--PNSMFNAAVRPDVMVTSKMESIWLKRNHETLKDVRWTYVGTRSGVFIALPGHRTRRNYDPTRRPWYQRTLVNPAKTAVSNAYMDDSGIGKVITISQAVFQGIPT-EKPNCSGVHNLR-GGCRCVSHRQCLSGKCR-----SYSANRTLCAGDRVEAVTALDVLYRDFHRRVYELMTAPDGERSCGANYTCPDGIHTCQTKCYLVDNLANLVTDPSFLTVSTTDEREYKRVSLGRKEGDVMKRLI-QRGIFQQNLRIDFQGVCSVSPYAPKVTLEGLLKTPEQEDDYYKNKGPIPPFRNEYGCIQDVVGYSADDSALGADGIISGSVEGPCRSGNYFITALPQTNLYLLVIENWSEHRQSYFYNFNCHISNRVYDAGAFRIVNGTCAHIET-KVPLNTKKKCPGLRNVKLKCSYNSGITF 1098          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Ensembl Nematostella
Match: EDO28538 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T671])

HSP 1 Score: 459.144 bits (1180), Expect = 4.438e-146
Identity = 232/520 (44.62%), Postives = 330/520 (63.46%), Query Frame = 3
Query: 1770 IFHPLLKASTTLEDDPIFIHIQSLEQNKAGNPKDFSKVVDDMINMTAGNRRIIDGRRGTPKGDFKAGVKYDKMPLEYYYAPLKHSNVYSIAIVLADTDKVFRRLEEPSNISQPVPSFFNLLIEYNSTKVLKEYPNIFKELDVRFNETKYPMLRVTYNYSSIFFAPSVHCDPSKYFFDDDLAQKTLDAHRYMNELTHNSDPGCDVPEGKYAQGTRAYVLVTESIENQWKSRNFESIDEVTWTYVGMRSGVFRTYPGHRSTRLYDPTKRPWYRRTLANPTKISISTPYFDAAGSGKIITISQAVFEGMPTLSKEHCKNINSLKPGGCHCVKDSDCLSGYCYISKAPGPDAHETRCATERIEAITSLDIGYDSFHKRLFQIMQASDGVKSCNSSYKCPDGYLDCWTKCYIFDDRANIIMASEFVAATAFDTNKYLGITVGKKESEIMKDLIYHHKFFQRSESIDFQGACTYVSSYPQVTLKGIPRTPEDFDNYYKTRGPIPSFINSYSCIQDVVTFSANISAL 3329
            IF PLL+ ST L DDPIFI I  LEQ + G PK+FSKV + M++   G+ RI +  R  PKGDF+ GV     P  Y+Y  +K S VY+ A  LAD+D  FRR   P N S     +++ L  YN + V KE   ++ +LDV++N   YP + ++ +  S+  AP  +C P+ Y F  +++   ++AHR +N +T+++  GC  P   +    R  V+VT  +E+ W  RN E++ +V WTYVG RSGVF   PGHR+ R YDPT+RPWY+RTL NP K ++S  Y D +G GK+ITISQAVF+G+PT  K +C  +++L+ GGC CV    CLSG C         A+ T CA +R+EA+T+LD+ Y  FH+R++++M A DG +SC ++Y CPDG   C TKCY+ D+ AN++    F+  +  D  +Y  +++G+KE ++MK LI     FQ++  IDFQG C+     P+VTL+G+ +TPE  D+YYK +GPIP F N Y CIQDVV +SA+ SAL
Sbjct:  213 IFQPLLRPSTELVDDPIFIQISDLEQ-RDGEPKEFSKVQEAMMDGKTGSYRIENAIRSIPKGDFQDGVVLVTSPSTYFYTSIKDS-VYAFAFNLADSDVDFRRPLRPKNQSDGQILYYSYLEAYNLSSVRKELGGLYDKLDVKYNLPAYPNIYISLDRPSVMLAPKTYCHPNDYLFHYNISTIAVEAHRIINGITNST--GC--PNSMFNAAVRPDVMVTSKMESIWLKRNHETLKDVRWTYVGTRSGVFIALPGHRTRRNYDPTRRPWYQRTLVNPAKTAVSNAYMDDSGIGKVITISQAVFQGIPT-EKPNCSGVHNLR-GGCRCVSHRQCLSGKCR-----SYSANRTLCAGDRVEAVTALDVLYRDFHRRVYELMTAPDGERSCGANYTCPDGIHTCQTKCYLVDNLANLVTDPSFLTVSTTDEREYKRVSLGRKEGDVMKRLI-QRGIFQQNLRIDFQGVCSVSPYAPKVTLEGLLKTPEQEDDYYKNKGPIPPFRNEYGCIQDVVGYSADDSAL 718          

HSP 2 Score: 194.512 bits (493), Expect = 1.988e-51
Identity = 85/146 (58.22%), Postives = 111/146 (76.03%), Query Frame = 3
Query:  948 IAKEVSKAIIQTLTKHDYLNVICARNSHWDEIGKWHLYKSHALSCRPDSLVAATIAHRKDLIESIDNLVPGGTSELETGFELAFDLLKSVPRTGCQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTN 1385
            +AKE++K ++ TLTK D++NVIC   S+WDE+GKW+ Y +  LSC+ D LV A+ +HRKDL E I+NL  GGTSEL+  F+ AF+LLK   +TGCQSII+F+TDG D DG+ VRCG GYYTRSGYVPG +CKY+W KV + +   N
Sbjct:    1 MAKEIAKTVLNTLTKQDFVNVICGHASNWDEVGKWYQYDTEVLSCQKDRLVPASTSHRKDLTEKINNLQAGGTSELKAAFKKAFELLKGRAKTGCQSIIIFVTDGEDNDGDPVRCGQGYYTRSGYVPGQLCKYDWAKVWNEVEAIN 146          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Ensembl Nematostella
Match: EDO46979 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNR9])

HSP 1 Score: 184.496 bits (467), Expect = 4.902e-47
Identity = 183/726 (25.21%), Postives = 320/726 (44.08%), Query Frame = 3
Query:  588 MTFNSYFKQNVTEKHSTIKIADEVPRSLNTTIFTVHWTYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREWSSNFVGFYTDYDPRVRAWYITATS-GPKDVIILIDCSFSMTGEK-------FSIAKEVSKAIIQTLTKHDYLNVICAR---NSHWDEIGKWHLYKSHALSCRPDSLVAATIAHRKDLIESIDNLVPGGTSELETGFELAFDLL-KSVPRT--GCQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTNMGLTVPARIFSYL---VKDDGEMLPGSIACGH--GGSMRKIVYGENIISQLSNYFEFL--AKVTQKKEGLWTSPYIDSLGTGLLITHAVPAISTEDGTLLGVAGVDVTLEEIEMLIARYQWGSMT-SFFINNKGNVIFHPLLKASTTLEDDPIFIHIQSLEQNKAGNPKDFSKVVDDMINMTAGNRRIIDGRRGTPKGDFKAGVKYDKMPLEYYYAPLKHSNVYSIAIVLADTDKVFRRLEEPSNIS-QPVPSFFNLLIEYNSTKVLK-EYP-NIFKELDVRFNETKYPMLRVTYNYSSIFFAPSVHCDPSKYFFDDDLAQKTLDAHRYMNELTHN-SDPGCDVPEGKYAQGTRAYVLVTESIENQW-KSRNFESIDEVTWTYVGMRSGVFRTYPGHRSTRLYDPTKRPWYRRTLANPTKISISTPYFDAAGSGKIITISQAVFEG 2684
            +T+++ F+Q V      ++ A     + N T      T ++ + M++N KE   ++WQYFGS  G+  ++P +  +         YD R R WY+ A +  PK+V++++D S SM  +          +A + +KA++ TL   D + V+      N+       W         C  ++L  A   +  ++   +D +   G +        AF LL  S P +   C  +I+FLTD + T+ +              V   + + N    + ++    +   + A  FS+L   V+  G       A G    G  ++I     +  ++  Y+ F   A      E     PY D+ G GL+ T  +P       T +GV G+D+T+ ++   ++ +     + +F I+  G  + HPLL   +  + D   + I++LE      P   + + D M +  +G  R++  RR  P+   KAGV+   +   YY+  +  +N +S+ +VL   D         S++S +P+    +    Y+   +LK E P   F+   V+             + S + F+  V  DP +Y    + +   +    YM + ++   +PG       +  G +  VL +   E+ W KS +    D V W Y+G  SGVFR +PG    + YDPTKR WY+  + NP   ++STPY DA G+G +IT+S  V +G
Sbjct:  115 LTYDTRFRQQVRTTQFCVRKAS---GATNPT----QLTNEVLKAMEDNMKESPYLKWQYFGSVEGLTTIYPMQSQAE-----CGSYDNRARPWYVDAAAPKPKNVVLVVDSSGSMAEKHTANGKTWLQMAIDAAKAVLDTLNPRDKVGVVSLATDANTPGSNDTTW---------CYANTLAEANSVNINNMKIFLDGMRSAGFTMYIPALTKAFALLLNSKPESPDDCDQVIIFLTDAKPTELKES------------VMRTIVESNKLLDNRVVI---LAYGIGAEDFSFLGDMVRQSGYNQTWDPAAGQVTPGIWKQITDIGRLREEMVTYYNFFFSANDPSTAEPRIAVPYHDAWGLGLITTVTLPCY--HGNTFVGVVGIDITMGDLLADVSYFGAEQESYAFVIDGSGRGLVHPLLPMPSNADQDYASLEIRTLE------PDAPNSIFDSMQSGESGEERLLT-RRFLPRAGSKAGVRVRTVNTTYYWQKVDGTN-FSVCLVLVKGD---------SSVSLKPLSPIEDFKFIYHRLDLLKPELPCTQFQRYAVK-------------SSSVVKFSADVFTDPYQYIGLSETSTHVMQYFMYMLDRSNTVENPG-------FRAGIKDDVLASYRAESIWLKSESLN--DYVVWRYIGSGSGVFRLFPGVILAKNYDPTKRTWYQGAIDNPGNNTLSTPYIDAFGAGLVITLSHTVTKG 763          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Ensembl Nematostella
Match: EDO40609 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6T1])

HSP 1 Score: 152.91 bits (385), Expect = 2.306e-37
Identity = 168/685 (24.53%), Postives = 286/685 (41.75%), Query Frame = 3
Query:  720 MKENAKEDTRIRWQYFGSTAGVLRLFPGREWSSNFVGFYTDYDPRVRAWYITAT-SGPKDVIILIDCSFSMTGE---------KFSIAKEVSKAIIQTLTKHDYLNVICARNSHWDEIGKWHLYKSHALSCRPDSLVAATIAHRKDLIESIDNLVPGGTSELETGFELAFDLLKSVPR---TGCQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSII--NKTNMGLTVP-ARIFSYLVKDDGEM--LPGSIACGHGGSMRKIVYGENIISQLSNYFEFLAKVTQK--KEGLWTSPYIDSLGTGLLITHAVPAISTEDGTLLGVAGVDVTLEEIEMLIARY-QWGSMTSFFIN--NKGNVIFHPLLKASTTLEDDPIFIHIQSLEQNKA------GNPKDFSKVVDDMINMTAGNRRIIDGRRGTPKGDFKA-GVKYDKMPLEYYYAPLKHSNVYSIAIVLADTDKVFRRLEEPSNISQPVPSFFNLLIEYNSTKVLKEYPNIFKELDV-RFNETKYPMLRVTYNYSSIF-FAPSVHCDPSKYFFDDDLAQKTLDAHRYMNELTHNSDPGCDVPEGKYAQGTRAYVLVTESIENQW-KSRNFESIDEVTWTYVGMRSGVFRTYPGHRSTRLYDPTKRPWYRRTLANPTKISISTPYFDAAGSGKIITISQAV 2675
            M  N K++ R++WQ+FGS  G+  ++P              YD R+R WY +A     K ++I++D S SM            +  +AK     I+ TL   D + V+   NS     G      S    C    L  A   +   L + I+   PGG ++ +  F+ AF LLKS       G QS ++FLTDG          GP              K +  +V  +I  NK  M  +     I +  +  D  M    G ++   G    ++    ++ S + +Y+  L  +  K  K  + + PY D+ G GL+IT AVP  S   G  +GVAGVD+ + ++   +  + Q GS +  F+   N  N + HPLL    TL  DP  ++I +LEQ +A      G  K   +  +D+  ++   RR+      TPKG  +A GV    +   YY + +     Y + + L +     +                  + E N  ++     ++ +E +V  + +T      ++Y   ++  F+     +P +Y    D+ +      +YMN           +P      G      +++ + N W    + + + ++   + G  +GV R +PG    R YD   R W+ +  A   +++ +TPY D  G+G I+T S ++
Sbjct:  230 MSRNLKQNQRLKWQFFGSKEGLCTIYPAAPLKECHA-----YDNRLRPWYTSAAYPSTKKLVIVLDTSSSMASRVELGTKRRTRLDVAKAALSTILSTLLPQDKVGVVLF-NSKVTLAG-----SSGVDECYSTRLAPAGRFNVNYLKDFINRSRPGGGTQYQNAFKAAFTLLKSAKSGDGGGEQSFLLFLTDG----------GP--------------KDDALEVERLIAQNKKEMEESRERVTIMTIGLGKDEHMKDFLGRLSKNVGSKYSQVDNEAHMYSAIHDYYSHLQAMATKATKNYILSPPYADAWGLGLMITVAVPCFS--KGEFVGVAGVDLIMSDLLSEVQYFNQAGSDSFAFLAHLNTDNALSHPLLPPPETLTKDPSLVNILALEQGEAFKQFFHGTLKHIKE--NDIRTISLPRRRL-----STPKGGLQAEGVAEHVLDYTYYCSRVLE---YVLCVALPEVVTDLK------------------ITENNGDRLYYHRMDLVQEDEVCSYTDT------ISYKDKAVVKFSAKAFLNPPEYL---DVEENPTLIEKYMNHANQGHQDTMFLP------GIVQTAKLSKGLVNYWIHGEHKQYLSQIPRRFFGSANGVLRFFPGEPLPRNYDHCSRHWFNKANAFKGQLTFTTPYRDPLGAGLIVTASHSI 834          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Ensembl Nematostella
Match: EDO48210 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKA1])

HSP 1 Score: 143.28 bits (360), Expect = 1.893e-34
Identity = 181/823 (21.99%), Postives = 315/823 (38.27%), Query Frame = 3
Query:  297 IKQLALNGIRKDVTQSLFDQAKYKLEIKDGMEIVKDISEQLGSYLFNRKKAALRIANAAVEIYDMNKRRKGNFSYEFLKDLPT-NEVMDSDNPKSLPPMTFNSYFKQNVTEKHSTIKI---ADEVPRSLNTTIFTVHWTYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREWSSNFVGFYTDYDPRVRAWYITATS-GPKDVIILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVICARNSHWDEIGKWHLYKSHALSCRPDSLVAATIAHRKDLIESIDNLVPGGTSELETGFELAFDLLKSVPR---TGCQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTNM------GLTVPARI-----FSYLVKDDGEMLPGSIACGH----------GGSMRKIVY---------GENIISQLSNYFEFLAKVTQKKEGLWTSPYIDSLGTGLLITHAVPAISTEDGTLLGVAGVDVTLEEIEMLIARYQWGSMT-SFFINNKGNVIFHPLLKASTTLEDDPIFIHIQSLEQNKAGNPKDFSKVVDDMINMTAGNRRIIDGRRGTPKGDFKAGVKYDKMPLEYYYAPLKHSNVYSIAIVLADTDKVFRRLEEPSNISQPVPSFFNLLIEYNSTKVLKEYPNIFKELDVRFNETKYPMLRVTYNYSSIFFAPSVHCDPSKYFFDDDLAQKTLDAHRYMNELTHNSDPGCDVPEGKYAQGTRAYVLVTESIENQWKSRNFESIDEVTWTYVGMRSGVFRTYPGHRSTRLYDPTKRPWYRRTLANPTKISISTPYFDAAGSG 2648
            + +LA+NG+     Q  +D+  +K    DG  I+ D++ +  + L  +   A +I +A VE+           SY     + +  E   +D       + ++S F+  V      + I   A   P+ L   +          + MK+N + +  + WQYFGS  G+   +P    SS+     + YDPR R WY+ A S  PKDVI+++D S SM G +  IAKE +K ++ TL   D +  + A  S    + K     +    C   SL  A+  +   L + +D     G +     F  AFD+L    +   T  + +I+F+TDG   D                 PG +     T+   +  K ++      G   PA +      +    D G     S+                S RK+V            N+ ++++ Y+   ++    K  +++ PY+D+LG GLL +   P      G  +GVAG DV + E+   +  +  G  + +F  ++ G  + HPLL   +     P F+ I+ LE    GN  D   +   + + T G+  +   R     G    GV    +P  YY+ P+ ++N +++ IV                + + V ++    ++    K +                              + F P    +P +Y  +++  +   +  +Y +  T            K+ +  R  V VT+  E  W   N      V W Y+  +S +                             K+++S PY DAAG+G
Sbjct:   37 LAELAINGLGTSEMQGYYDKLTFKSLDLDGNSILNDLATRFANKLQTKVTIARKIKDA-VEV-----------SYAKSATVTSRTECCKADTRW----LKYDSRFRTKVNLDEMCVIISGAASSNPKQLQDNVL---------QTMKQNIENNPTLTWQYFGSEEGLYTNYPMIRDSSSC----SSYDPRYRPWYVEAASPQPKDVILVVDYSGSMGGSRLPIAKEAAKTVLDTLNPRDRVAFL-AFESGVRRV-KVTSGDAKDEKCFESSLAKASPVNIDILKKFLDGEYASGGTMYAIAFNAAFDILDKYYKEKNTTRRPVILFMTDGAPNDD----------------PGTILNTVKTRNQGLSTKADILTFGMGGGISPAGVDLLQSLAEQTLDGGARFEVSLTTALRDVSRHLLAVARSARKLVQVGRYTPVTDVSNLRNRMATYYSAFSRKEDDKP-IFSVPYVDTLGLGLLTSITFPCY--HQGKFIGVAGTDVVMSELLADVTYFNQGQASYAFVADSSGRTMMHPLLPKPSDPYQAPFFLDIRDLEPE--GNFSDI--IFSGIKSQTPGSLFLTSSRFLARGGSIYDGVTTKAIPSMYYWKPIPNTN-FTLGIV----------------VKKDVKNYITDAVKKPEDKAI------------------------------VKFGPQAFKNPYEYLGNEETDKTVAEYVKYFDGGTSE----------KFKESIRNTVYVTQMAETIWGKSNTGLSQYVVWRYISAQSNI----------------------------DKLALSKPYVDAAGAG 720          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Ensembl Medaka
Match: cacna2d2a (calcium voltage-gated channel auxiliary subunit alpha2delta 2 [Source:NCBI gene;Acc:101155679])

HSP 1 Score: 188.734 bits (478), Expect = 3.319e-48
Identity = 191/825 (23.15%), Postives = 368/825 (44.61%), Query Frame = 3
Query:  264 IYNWVDMIQNYIKQLALNGIRKDVTQSLFDQAKYKLEIK--DGMEIVKDISEQLGSYLFNRKKAALRIANAAVEIYDMNKRRKGNFSYEFLKDLPTNEVMDSDNPKSLPPMTFNSYFKQNVTEKHSTIKIADEVPRSLNTTIFTVHWTYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREWSS-NFVGFYTDYDPRVRAWYITATSGPKDVIILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVICARNSHWDEIGKWHLYKSHALSCRPDSLVAATIAHRKDLIESIDNLVPGGTSELETGFELAFDLL---KSVPRTGCQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTNMGLTVPARIFSYLV-KDDGEMLPGS-IACGHGGSMRKIVYGENIISQLSNYFEFLAKVT-----QKKEGLWTSPYIDSLGTGLLITHAVP-------AISTEDGTLLGVAGVDVTLEEIEMLIARYQWGSMT-SFFINNKGNVIFHPLLKASTTLEDDPIFIHIQSLEQNKAGNPKDFSKVVDDMINMTAGNRRIIDGRRGTPKGDFKAGVK------YDKMPLEYYYAPLKHSNVYSIAIVLADTDKVFRRLEEPSNISQPVPSFFNLLIEYNSTKVLKEYPNIFKELDVRFNETKYPMLRVTYNYSSIFFAPSVHCDPSKYFFDDDLAQKTLDAHRYMNELTHNSDPGCDVPEGKYAQGTRAYVLVTES------IENQWKSRNFESIDEVTWTYVGMRSGVFRTYPGHRSTRLYDPTKRP----WYRRTLANPTKISISTPY 2627
            + +W   I+  ++++  +    +  +S++++ K + EIK  +  ++V+ ++  +   L +++KA  ++A  A ++   +  + G    +  +++PT E+  S   + +P    +  FK  V    S ++I  ++ +     +  ++WT  LE +  EN +ED+ +RWQ FGS  GV R +P   W + N +     YD R R WYI   S PKD++I++D S S++G    + K     ++ TL+  DY+NV     + ++E       K+ A+     +LV A + ++K   E++ ++   GT++ ++GF  AF+ L      PR  C  +I+  TDG +   +++                  KYNW       NKT        R+F++ V + + ++ P   IAC + G   +I     I      Y + L +       + K+  WT+ Y D+LG GL+IT  +P       ++S+++  +LGV GVDV + EI+     Y+ G+   +F I+  G V+ HP L+       +P+ +              DF     +  N     R++IDG+ G  K   +  VK       D++   Y + P++ +N YS+ +VL      +      +NIS  +     L ++Y  + +    PN F+                  +   +F AP  +C+  +    ++  +  L+    M ++T         P+ K       + L+ ++      +E  W++++  +   +   +     G+ R +P +++   ++    P    +YRR+L N   I    PY
Sbjct:   40 MIHWAQRIEKELEKVLQHVTGTEQMKSIYNEKKSQFEIKRNNPKDLVERVARDISKLLNSKRKALEKLAREAEQLQKEHVWQDGVTMEDGEEEIPT-EISSSLELEFVP----DPNFKNKVNYSSSAVQIPTDIYKGSPVILNELNWTQALERVFIENRREDSSLRWQVFGSATGVTRYYPATPWRAPNKIDL---YDVRRRPWYIQGASSPKDMVIIVDVSGSVSGLTLKLMKTSVMEMLDTLSDDDYVNV-----ARFNE-------KADAVVPCFKTLVQANVRNKKIFKEAVMHMQAKGTTDYKSGFTFAFEQLLNETGAPRANCNKMIMMFTDGGEDRAQDI----------------FEKYNWP------NKT-------VRVFTFSVGQHNYDVTPLQWIACANKGYYFEIPSIGAIRINTQEYLDVLGRPMVLAGPKAKQVQWTNVYQDALGLGLVITGTMPVFNLTADSVSSQNQLILGVMGVDVAINEIKKKTPTYRLGANGYTFAIDPNGYVLLHPNLQPKIINFREPVTL--------------DFLDAELEDTNKEEIRRQMIDGKSGQRK--IRTLVKSVDERYIDEVVRTYTWTPVEGTN-YSLGLVLP----TYSENHIKANISDQI-----LQVQYFESLL----PNTFE------------------SEGHVFIAPREYCNELE--LSNNNTEFLLNFISLMEKVT---------PDSKQCDNLLLHNLILDTGIIRQLVEKVWRNKDLNTYGFLA-VFAATDGGITRVFP-NKAAETWEEDPEPFNATYYRRSLDNSGYI-FRAPY 753          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Ensembl Medaka
Match: cacna2d2a (calcium voltage-gated channel auxiliary subunit alpha2delta 2 [Source:NCBI gene;Acc:101155679])

HSP 1 Score: 183.726 bits (465), Expect = 1.485e-46
Identity = 194/840 (23.10%), Postives = 373/840 (44.40%), Query Frame = 3
Query:  264 IYNWVDMIQNYIKQLALNGIRKDVTQSLFDQAKYKLEIK--DGMEIVKDISEQLGSYLFNRKKAALRIANAAVEIYDMNKRRKG----NFSY-------EFLKD----LPTNEVMDSDNPKSLPPMTFNSYFKQNVTEKHSTIKIADEVPRSLNTTIFTVHWTYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREWSS-NFVGFYTDYDPRVRAWYITATSGPKDVIILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVICARNSHWDEIGKWHLYKSHALSCRPDSLVAATIAHRKDLIESIDNLVPGGTSELETGFELAFDLL---KSVPRTGCQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTNMGLTVPARIFSYLV-KDDGEMLPGS-IACGHGGSMRKIVYGENIISQLSNYFEFLAKVT-----QKKEGLWTSPYIDSLGTGLLITHAVP-------AISTEDGTLLGVAGVDVTLEEIEMLIARYQWGSMT-SFFINNKGNVIFHPLLKASTTLEDDPIFIHIQSLEQNKAGNPKDFSKVVDDMINMTAGNRRIIDGRRGTPKGDFKAGVK------YDKMPLEYYYAPLKHSNVYSIAIVLADTDKVFRRLEEPSNISQPVPSFFNLLIEYNSTKVLKEYPNIFKELDVRFNETKYPMLRVTYNYSSIFFAPSVHCDPSKYFFDDDLAQKTLDAHRYMNELTHNSDPGCDVPEGKYAQGTRAYVLVTES------IENQWKSRNFESIDEVTWTYVGMRSGVFRTYPGHRSTRLYDPTKRP----WYRRTLANPTKISISTPY 2627
            + +W   I+  ++++  +    +  +S++++ K + EIK  +  ++V+ ++  +   L +++KA  ++A  A ++   +  + G    + SY       ++++D    +PT E+  S   + +P    +  FK  V    S ++I  ++ +     +  ++WT  LE +  EN +ED+ +RWQ FGS  GV R +P   W + N +     YD R R WYI   S PKD++I++D S S++G    + K     ++ TL+  DY+NV     + ++E       K+ A+     +LV A + ++K   E++ ++   GT++ ++GF  AF+ L      PR  C  +I+  TDG +   +++                  KYNW       NKT        R+F++ V + + ++ P   IAC + G   +I     I      Y + L +       + K+  WT+ Y D+LG GL+IT  +P       ++S+++  +LGV GVDV + EI+     Y+ G+   +F I+  G V+ HP L+       +P+ +              DF     +  N     R++IDG+ G  K   +  VK       D++   Y + P++ +N YS+ +VL      +      +NIS  +     L ++Y  + +    PN F+                  +   +F AP  +C+  +    ++  +  L+    M ++T         P+ K       + L+ ++      +E  W++++  +   +   +     G+ R +P +++   ++    P    +YRR+L N   I    PY
Sbjct:   40 MIHWAQRIEKELEKVLQHVTGTEQMKSIYNEKKSQFEIKRNNPKDLVERVARDISKLLNSKRKALEKLAREAEQLQKEHVWQDGVTENDISYYDSKADSDYMEDGEEEIPT-EISSSLELEFVP----DPNFKNKVNYSSSAVQIPTDIYKGSPVILNELNWTQALERVFIENRREDSSLRWQVFGSATGVTRYYPATPWRAPNKIDL---YDVRRRPWYIQGASSPKDMVIIVDVSGSVSGLTLKLMKTSVMEMLDTLSDDDYVNV-----ARFNE-------KADAVVPCFKTLVQANVRNKKIFKEAVMHMQAKGTTDYKSGFTFAFEQLLNETGAPRANCNKMIMMFTDGGEDRAQDI----------------FEKYNWP------NKT-------VRVFTFSVGQHNYDVTPLQWIACANKGYYFEIPSIGAIRINTQEYLDVLGRPMVLAGPKAKQVQWTNVYQDALGLGLVITGTMPVFNLTADSVSSQNQLILGVMGVDVAINEIKKKTPTYRLGANGYTFAIDPNGYVLLHPNLQPKIINFREPVTL--------------DFLDAELEDTNKEEIRRQMIDGKSGQRK--IRTLVKSVDERYIDEVVRTYTWTPVEGTN-YSLGLVLP----TYSENHIKANISDQI-----LQVQYFESLL----PNTFE------------------SEGHVFIAPREYCNELE--LSNNNTEFLLNFISLMEKVT---------PDSKQCDNLLLHNLILDTGIIRQLVEKVWRNKDLNTYGFLA-VFAATDGGITRVFP-NKAAETWEEDPEPFNATYYRRSLDNSGYI-FRAPY 768          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Ensembl Medaka
Match: cacna2d2a (calcium voltage-gated channel auxiliary subunit alpha2delta 2 [Source:NCBI gene;Acc:101155679])

HSP 1 Score: 183.341 bits (464), Expect = 1.580e-46
Identity = 197/845 (23.31%), Postives = 372/845 (44.02%), Query Frame = 3
Query:  264 IYNWVDMIQNYIKQLALNGIRKDVTQSLFDQAKYKLEIK--DGMEIVKDISEQLGSYLFNRKKAALRIANAAVEIYDMNKRRKG----NFSY-------EFLKD----LPTNEVMDSDNPKSLPPMTFNSYFKQNVTEKHSTIKIADEVPRSLNTTIFTVHWTYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREWSS-NFVGFYTDYDPRVRAWYITATSGPKDVIILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVICARNSHWDEIGKWHLYKSHALSCRPDSLVAATIAHRKDLIESIDNLVPGGTSELETGFELAFDLL---KSVPRTGCQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTNMGLTVPARIFSYLV-KDDGEMLPGS-IACGHGGSMRKIVYGENIISQLSNYFEFLAKVT-----QKKEGLWTSPYIDSLGTGLLITHAVP-------AISTEDGTLLGVAGVDVTLEEIEMLIARYQWGSMT-SFFINNKGNVIFHPLLKASTTLEDDPIFIHIQSLEQNKAGNPKDFSKVVDDMINMTAGNRRIIDGRRGTPKGDFKAGVK------YDKMPLEYYYAPLKHSNVYSIAIVLADTDKVFRRLEEPSNISQPVPSFFNLLIEYNSTKVLKEYPNIFKELDVRFNETKYPMLRVTYNYSSIFFAPSVHCDPSKYF---------FDDDLAQKTLDAHRYMNELTHN--SDPGCDVPEGKYAQGTRAYVLVTESIENQWKSRNFESIDEVTWTYVGMRSGVFRTYPGHRSTRLYDPTKRP----WYRRTLANPTKISISTPY 2627
            + +W   I+  ++++  +    +  +S++++ K + EIK  +  ++V+ ++  +   L +++KA  ++A  A ++   +  + G    + SY       ++++D    +PT E+  S   + +P    +  FK  V    S ++I  ++ +     +  ++WT  LE +  EN +ED+ +RWQ FGS  GV R +P   W + N +     YD R R WYI   S PKD++I++D S S++G    + K     ++ TL+  DY+NV     + ++E       K+ A+     +LV A + ++K   E++ ++   GT++ ++GF  AF+ L      PR  C  +I+  TDG +   +++                  KYNW       NKT        R+F++ V + + ++ P   IAC + G   +I     I      Y + L +       + K+  WT+ Y D+LG GL+IT  +P       ++S+++  +LGV GVDV + EI+     Y+ G+   +F I+  G V+ HP L+       +P+ +              DF     +  N     R++IDG+ G  K   +  VK       D++   Y + P++ +N YS+ +VL      +      +NIS  +     L ++Y  + +    PN F+                  +   +F AP  +C+  +           F   + + T D+ +  N L HN   D G                ++ + +E  W++++  +   +   +     G+ R +P +++   ++    P    +YRR+L N   I    PY
Sbjct:   40 MIHWAQRIEKELEKVLQHVTGTEQMKSIYNEKKSQFEIKRNNPKDLVERVARDISKLLNSKRKALEKLAREAEQLQKEHVWQDGVTENDISYYDSKADSDYMEDGEEEIPT-EISSSLELEFVP----DPNFKNKVNYSSSAVQIPTDIYKGSPVILNELNWTQALERVFIENRREDSSLRWQVFGSATGVTRYYPATPWRAPNKIDL---YDVRRRPWYIQGASSPKDMVIIVDVSGSVSGLTLKLMKTSVMEMLDTLSDDDYVNV-----ARFNE-------KADAVVPCFKTLVQANVRNKKIFKEAVMHMQAKGTTDYKSGFTFAFEQLLNETGAPRANCNKMIMMFTDGGEDRAQDI----------------FEKYNWP------NKT-------VRVFTFSVGQHNYDVTPLQWIACANKGYYFEIPSIGAIRINTQEYLDVLGRPMVLAGPKAKQVQWTNVYQDALGLGLVITGTMPVFNLTADSVSSQNQLILGVMGVDVAINEIKKKTPTYRLGANGYTFAIDPNGYVLLHPNLQPKIINFREPVTL--------------DFLDAELEDTNKEEIRRQMIDGKSGQRK--IRTLVKSVDERYIDEVVRTYTWTPVEGTN-YSLGLVLP----TYSENHIKANISDQI-----LQVQYFESLL----PNTFE------------------SEGHVFIAPREYCNELELSNNNTEFLLNFISLMEKVTPDSKQCDNLLLHNLILDTG----------------IIRQLVEKVWRNKDLNTYGFLA-VFAATDGGITRVFP-NKAAETWEEDPEPFNATYYRRSLDNSGYI-FRAPY 768          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Ensembl Medaka
Match: cacna2d2b (voltage-dependent calcium channel subunit alpha-2/delta-2 [Source:NCBI gene;Acc:101156079])

HSP 1 Score: 177.563 bits (449), Expect = 7.814e-45
Identity = 145/540 (26.85%), Postives = 249/540 (46.11%), Query Frame = 3
Query:  393 IVKDISEQLGSYLFNRKKAALRIANAAVEIYDMNKRRKGNFSYEFLKDLPTNEVMDSD----NPKSLP-PMTFNSYFKQNVTEKHSTIKIADEVPRSLNTTIFTVHWTYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREWSS-NFVGFYTDYDPRVRAWYITATSGPKDVIILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVICARNSHWDEIGKWHLYKSHALSCRPDSLVAATIAHRKDLIESIDNLVPGGTSELETGFELAFDLL---KSVPRTGCQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTNMGLTVPARIFSYLV-KDDGEMLPGS-IACGHGGSMRKIVYGENIISQLSNYFEFLAKV-----TQKKEGLWTSPYIDSLGTGLLITHAVPAI------STEDGTLLGVAGVDVTLEEIEMLIARYQWGSMTSFF-INNKGNVIFHPLLKASTTLEDDPIFIHIQSLEQNKAGNPKDFSKVVDDMINMTAGNRRIIDGRRG 1943
            IV+ ++  +   L  ++KA  R+A+ A  +   +  + G         +  N  MD +    NP  +     ++  FK NV   ++ ++I  ++ +     +  ++WT  LE++  EN++ED  + WQ FGS  GV R +P   W + + +     YD R R WYI   S PKD++IL+D S S++G    + K     ++ TL+  DY+NV     + ++E       K+ A+      LV A + ++K   E++  +   GT++ ++GF  AF+ L    +VPR  C  II+  TDG +   ++V                  +YNW       NKT        R+F++ V + + ++ P   IAC + G   +I     I      Y + L +      ++ K+  WT+ Y D+LG G+++T  +P        +T++  +LGV GVDV L+EI+ L  RY  G+    F I+  G ++ HP L+       +P+ +              DF     +  N     R++IDGR G
Sbjct:   33 IVEKVALDIERLLAKKRKALERLASEAERLQQEHLWQDG---------IKVNYSMDGEGEVENPSHIKLEFVYDPNFKNNVNYSYTAVQIPTDIYKGAPVILNELNWTQALEKVFMENSREDPSLLWQAFGSATGVTRYYPATPWKTPDKIDL---YDVRRRPWYIQGASSPKDMVILVDVSGSVSGLTLKLIKASVMEMLDTLSDDDYVNV-----ARFNE-------KAEAVVPCFKHLVQANVRNKKIFKEAVQQMQAKGTTDYKSGFHFAFNQLLNKTNVPRANCNKIIMLFTDGGEDRAQDV----------------FMQYNWP------NKT-------VRVFTFSVGQHNYDVTPLQWIACANKGYYFEIRSICAIRINTQEYLDVLGRPMVLAGSEAKQVQWTNVYQDALGLGMVVTGTLPVFNLTMNGNTKNQLILGVMGVDVHLDEIKRLTPRYSLGANGYIFAIDPNGYLLLHPNLQPKLVNLPEPVTL--------------DFLDAEVEDNNKEEIRRQMIDGRPG 505          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Ensembl Medaka
Match: cacna2d2b (voltage-dependent calcium channel subunit alpha-2/delta-2 [Source:NCBI gene;Acc:101156079])

HSP 1 Score: 176.022 bits (445), Expect = 3.546e-44
Identity = 192/823 (23.33%), Postives = 360/823 (43.74%), Query Frame = 3
Query:  264 IYNWVDMIQNYIKQL--ALNGIRKDVTQSLFDQAKYKLEIKDG--MEIVKDISEQLGSYLFNRKKAALRIANAAVEIYDMNKRRKG----NFSYEFLKDLPTNEVMDSD----NPKSLP-PMTFNSYFKQNVTEKHSTIKIADEVPRSLNTTIFTVHWTYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREWSS-NFVGFYTDYDPRVRAWYITATSGPKDVIILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVICARNSHWDEIGKWHLYKSHALSCRPDSLVAATIAHRKDLIESIDNLVPGGTSELETGFELAFDLL---KSVPRTGCQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTNMGLTVPARIFSYLV-KDDGEMLPGS-IACGHGGSMRKIVYGENIISQLSNYFEFLAKV-----TQKKEGLWTSPYIDSLGTGLLITHAVPAI------STEDGTLLGVAGVDVTLEEIEMLIARYQWGSMTSFF-INNKGNVIFHPLLKASTTLEDDPIFIHIQSLEQNKAGNPKDFSKVVDDMINMTAGNRRIIDGRRGTPKGDFKAGVK------YDKMPLEYYYAPLKHSNVYSIAIVLADTDKVFRRLEEPSNISQPVPSFFNLLIEYNSTKVLKEYPNIFKELDVRFNETKYPMLRVTYNYSSIFFAPSVHCDPSKYFFDDDLAQKTLDAHRYMNELTHNSDPGCDVPEGKYAQGTRAYVLVTESIENQWKSRNFESIDEVTWTYVGMRS----GVFRTYPGHRSTRLYDPTKRP----WYRRTLAN 2597
            I +W   I+  I ++   + G+++   + ++++ + +  +       IV+ ++  +   L  ++KA  R+A+ A  +   +  + G    + +Y   K       MD +    NP  +     ++  FK NV   ++ ++I  ++ +     +  ++WT  LE++  EN++ED  + WQ FGS  GV R +P   W + + +     YD R R WYI   S PKD++IL+D S S++G    + K     ++ TL+  DY+NV     + ++E       K+ A+      LV A + ++K   E++  +   GT++ ++GF  AF+ L    +VPR  C  II+  TDG +   ++V                  +YNW       NKT        R+F++ V + + ++ P   IAC + G   +I     I      Y + L +      ++ K+  WT+ Y D+LG G+++T  +P        +T++  +LGV GVDV L+EI+ L  RY  G+    F I+  G ++ HP L+       +P+ +              DF     +  N     R++IDGR G  +   K  +K       D++   Y + P+  ++ YS+ +VL                    P +    ++ + + V+ +   +   L   F  + +           +F AP  +C   +    D+  Q   +    M +++  SD  C+       QG    +++   I  Q  SR +++ D   + ++ + +    G+ R +P + +  L+D    P    +YRR+L N
Sbjct:   40 IMHWARRIEQEIDRVFQHITGVQQ--LKGIYNEERRRFSVLKNHPRRIVEKVALDIERLLAKKRKALERLASEAERLQQEHLWQDGIKELDMAYYDSKADLDYYSMDGEGEVENPSHIKLEFVYDPNFKNNVNYSYTAVQIPTDIYKGAPVILNELNWTQALEKVFMENSREDPSLLWQAFGSATGVTRYYPATPWKTPDKIDL---YDVRRRPWYIQGASSPKDMVILVDVSGSVSGLTLKLIKASVMEMLDTLSDDDYVNV-----ARFNE-------KAEAVVPCFKHLVQANVRNKKIFKEAVQQMQAKGTTDYKSGFHFAFNQLLNKTNVPRANCNKIIMLFTDGGEDRAQDV----------------FMQYNWP------NKT-------VRVFTFSVGQHNYDVTPLQWIACANKGYYFEIRSICAIRINTQEYLDVLGRPMVLAGSEAKQVQWTNVYQDALGLGMVVTGTLPVFNLTMNGNTKNQLILGVMGVDVHLDEIKRLTPRYSLGANGYIFAIDPNGYLLLHPNLQPKLVNLPEPVTL--------------DFLDAEVEDNNKEEIRRQMIDGRPGEMQ--VKTFIKSIDEQYMDEVYRGYTWTPINDTD-YSLGLVL--------------------PLYNEYYMQADLSDVMLQLQYMQSLLPSSFESSGH-----------VFLAPREYC--KRLQLSDNNTQFLQNFLSLMLDISPESDE-CE-------QGLIYNLILDSRIIGQLASRVWKNKDLNAYGFLAVFASTDGGITRVFP-NIAAELWDEDPEPFNSNFYRRSLDN 757          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Planmine SMEST
Match: SMESG000019491.1 (SMESG000019491.1)

HSP 1 Score: 2461.8 bits (6379), Expect = 0.000e+0
Identity = 1178/1179 (99.92%), Postives = 1179/1179 (100.00%), Query Frame = 3
Query:  168 WIIYFPTSIKSNHYNSYSENIPKNLDGTLYGDIYNWVDMIQNYIKQLALNGIRKDVTQSLFDQAKYKLEIKDGMEIVKDISEQLGSYLFNRKKAALRIANAAVEIYDMNKRRKGNFSYEFLKDLPTNEVMDSDNPKSLPPMTFNSYFKQNVTEKHSTIKIADEVPRSLNTTIFTVHWTYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREWSSNFVGFYTDYDPRVRAWYITATSGPKDVIILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVICARNSHWDEIGKWHLYKSHALSCRPDSLVAATIAHRKDLIESIDNLVPGGTSELETGFELAFDLLKSVPRTGCQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTNMGLTVPARIFSYLVKDDGEMLPGSIACGHGGSMRKIVYGENIISQLSNYFEFLAKVTQKKEGLWTSPYIDSLGTGLLITHAVPAISTEDGTLLGVAGVDVTLEEIEMLIARYQWGSMTSFFINNKGNVIFHPLLKASTTLEDDPIFIHIQSLEQNKAGNPKDFSKVVDDMINMTAGNRRIIDGRRGTPKGDFKAGVKYDKMPLEYYYAPLKHSNVYSIAIVLADTDKVFRRLEEPSNISQPVPSFFNLLIEYNSTKVLKEYPNIFKELDVRFNETKYPMLRVTYNYSSIFFAPSVHCDPSKYFFDDDLAQKTLDAHRYMNELTHNSDPGCDVPEGKYAQGTRAYVLVTESIENQWKSRNFESIDEVTWTYVGMRSGVFRTYPGHRSTRLYDPTKRPWYRRTLANPTKISISTPYFDAAGSGKIITISQAVFEGMPTLSKEHCKNINSLKPGGCHCVKDSDCLSGYCYISKAPGPDAHETRCATERIEAITSLDIGYDSFHKRLFQIMQASDGVKSCNSSYKCPDGYLDCWTKCYIFDDRANIIMASEFVAATAFDTNKYLGITVGKKESEIMKDLIYHHKFFQRSESIDFQGACTYVSSYPQVTLKGIPRTPEDFDNYYKTRGPIPSFINSYSCIQDVVTFSANISALGPSRMIVGNVSGPCTTGFYYVTSMPETNLFLLVVESRYDRSDSFFYNFNCEISRKIVASGAYRIINGTCAHKETNKQTLAEKGTCPEIVKVNITCEYSTAMNFQPNYKLLVINILYLVHNLLNWS 3704
            WIIYFPTSIKSNHYNSYSENIPKNLDGTLYGDIYNWVDMIQNYIKQLALNGIRKDVTQSLFDQAKYKLEIKDGMEIVKDISEQLGSYLFNRKKAALRIANAAVEIYDMNKRRKGNFSYEFLKDLPTNEVMDSDNPKSLPPMTFNSYFKQNVTEKHSTIKIADEVPRSLNTTIFTVHWTYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREWSSNFVGFYTDYDPRVRAWYITATSGPKDVIILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVICARNSHWDEIGKWHLYKSHALSCRPDSLVAATIAHRKDLIESIDNLVPGGTSELETGFELAFDLLKSVPRTGCQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTNMGLTVPARIFSYLVKDDGEMLPGSIACGHGGSMRKIVYGENIISQLSNYFEFLAKVTQKKEGLWTSPYIDSLGTGLLITHAVPAISTEDGTLLGVAGVDVTLEEIEMLIARYQWGSMTSFFINNKGNVIFHPLLKASTTLEDDPIFIHIQSLEQNKAGNPKDFSKVVDDMINMTAGNRRIIDGRRGTPKGDFKAGVKYDKMPLEYYYAPLKHSNVYSIAIVLADTDKVFRRLEEPSNISQPVPSFFNLLIEYNSTKVLKEYPNIFKELDVRFNETKYPMLRVTYNYSSIFFAPSVHCDPSKYFFDDDLAQKTLDAHRYMNELTHNSDPGCDVPEGKYAQGTRAYVLVTESIENQWKSRNFESIDEVTWTYVGMRSGVFRTYPGHRSTRLYDPTKRPWYRRTLANPTKISISTPYFDAAGSGKIITISQAVFEGMPTLSKEHCKNINSLKPGGCHCVKDSDCLSGYCYISKAPGPDAHETRCATERIEAITSLDIGYDSFHKRLFQIMQASDGVKSCNSSYKCPDGYLDCWTKCYIFDDRANIIMASEFVAATAFDTNKYLGITVGKKESEIMKDLIYHHKFFQRSESIDFQGACTYVSSYPQVTLKGIPRTPEDFDNYYKTRGPIPSFINSYSCIQDVVTFSANISALGPSRMIVGNVSGPCTTGFYYVTSMPETNLFLLVVESRYDRSDSFFYNFNCEISRKIVASGAYRIINGTCAHKETNKQTLAEKGTCPEIVKVN+TCEYSTAMNFQPNYKLLVINILYLVHNLLNWS
Sbjct:    6 WIIYFPTSIKSNHYNSYSENIPKNLDGTLYGDIYNWVDMIQNYIKQLALNGIRKDVTQSLFDQAKYKLEIKDGMEIVKDISEQLGSYLFNRKKAALRIANAAVEIYDMNKRRKGNFSYEFLKDLPTNEVMDSDNPKSLPPMTFNSYFKQNVTEKHSTIKIADEVPRSLNTTIFTVHWTYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREWSSNFVGFYTDYDPRVRAWYITATSGPKDVIILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVICARNSHWDEIGKWHLYKSHALSCRPDSLVAATIAHRKDLIESIDNLVPGGTSELETGFELAFDLLKSVPRTGCQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTNMGLTVPARIFSYLVKDDGEMLPGSIACGHGGSMRKIVYGENIISQLSNYFEFLAKVTQKKEGLWTSPYIDSLGTGLLITHAVPAISTEDGTLLGVAGVDVTLEEIEMLIARYQWGSMTSFFINNKGNVIFHPLLKASTTLEDDPIFIHIQSLEQNKAGNPKDFSKVVDDMINMTAGNRRIIDGRRGTPKGDFKAGVKYDKMPLEYYYAPLKHSNVYSIAIVLADTDKVFRRLEEPSNISQPVPSFFNLLIEYNSTKVLKEYPNIFKELDVRFNETKYPMLRVTYNYSSIFFAPSVHCDPSKYFFDDDLAQKTLDAHRYMNELTHNSDPGCDVPEGKYAQGTRAYVLVTESIENQWKSRNFESIDEVTWTYVGMRSGVFRTYPGHRSTRLYDPTKRPWYRRTLANPTKISISTPYFDAAGSGKIITISQAVFEGMPTLSKEHCKNINSLKPGGCHCVKDSDCLSGYCYISKAPGPDAHETRCATERIEAITSLDIGYDSFHKRLFQIMQASDGVKSCNSSYKCPDGYLDCWTKCYIFDDRANIIMASEFVAATAFDTNKYLGITVGKKESEIMKDLIYHHKFFQRSESIDFQGACTYVSSYPQVTLKGIPRTPEDFDNYYKTRGPIPSFINSYSCIQDVVTFSANISALGPSRMIVGNVSGPCTTGFYYVTSMPETNLFLLVVESRYDRSDSFFYNFNCEISRKIVASGAYRIINGTCAHKETNKQTLAEKGTCPEIVKVNMTCEYSTAMNFQPNYKLLVINILYLVHNLLNWS 1184          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Planmine SMEST
Match: SMESG000021966.1 (SMESG000021966.1)

HSP 1 Score: 132.494 bits (332), Expect = 7.309e-31
Identity = 136/550 (24.73%), Postives = 227/550 (41.27%), Query Frame = 3
Query:  387 MEIVKDISEQLGSYLFNRKKAALRIANAAVE-----IYDMNKRRKGNFSYEFLKDLPTNEVMDSDNPKSLPPMTFNSYFKQNVTEKHSTIKIADEVPRSLNTTIFTVHWTYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREWSSNFVGFYTDYDPRVRAWYITATSGPKDVIILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVIC---ARNSHWDEIGKWHLYKSHALSCRPDSLVAATIAHRKDLIESIDNLVPGGTSELETGFELAFDLL--------KSVPRTGCQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTNMGLTVPARIFSYLVKDDGEMLPGSI----AC---GHGGSMRKIVYGENIISQLSNYFEF---------------LAKVTQKKEGLWTSPYIDSLGTGLLITHAVPAIS-TEDGTLLGVAGVDVTLEEIEMLIARYQWG-SMTSFFINNKGNVIFHPLLKASTTLEDDPIFIHIQSLEQNKAGNPKDFSKVVDDMINMTAGN 1916
            +EI KD S +L +    + ++  R  + A E      YD + + +    Y   KDLP N  +  D+P           FK  V    S++ I  E+ +  +  + T+ WT KL  I     +    +R+QYF S  G++  +PG  W       +   D R R WY+   S PKDV++LID S SM G    + K   + +I T+ ++DY+ V      +N     I  +   ++        + V A+  ++  L + I  L   G + L+T  E A +          K      C  +IV  TD  D                        +Y+  K+ S++N++N   T   RIF Y V +  E+ P  +     C   G+ G +  +    NII + S    +               +  V+  ++G         +G GL+ +  +P  + + +G+ LG+ G D+T+  ++ L+   + G +  +F IN  G +IFHP LK       DP  + +  +E +     K  SK+    IN  A N
Sbjct:   53 LEIAKDFSNKLANEFRKKMESLKRAVDFAEEEATKYQYDPHIKPE-EVQYINSKDLPENSELLVDHP----------LFKTRVIANQSSVHIPTEIYKEDSFILNTLKWTQKLNNIF---IRASNNLRYQYFASFTGIVLQYPGMRWRKKGTDMF---DVRRRQWYVQGASSPKDVMVLIDTSGSMHGIAIKLTKSAVEKLIDTMGENDYIAVTHFPPGKNQAMQLIKDYPFIQTKPCFA---TFVQASKRNKDRLFKQIFQLRAQGIANLDTALEFAINEFHKFDNRTEKGNEGANCNRLIVVFTDSGD------------------------EYDKEKIRSLMNRSNT--TKNLRIFIYYVGE--EITPIDVLENRTCEYRGYFGHIHAMGAVSNIIDKYSKTVHYHTIHRENQMEDNEFRIDLVSVNEDGFHNPEDFPPMGLGLMTSLTMPVYNRSGNGSFLGLLGTDMTVAFMDELVPHDKLGRNGYAFAINTNGYIIFHPELKNQLGWMRDPPNVDLTEIEFDSDEKTKIRSKI----INCAASN 550          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Planmine SMEST
Match: SMESG000021966.1 (SMESG000021966.1)

HSP 1 Score: 132.109 bits (331), Expect = 9.749e-31
Identity = 136/550 (24.73%), Postives = 227/550 (41.27%), Query Frame = 3
Query:  387 MEIVKDISEQLGSYLFNRKKAALRIANAAVE-----IYDMNKRRKGNFSYEFLKDLPTNEVMDSDNPKSLPPMTFNSYFKQNVTEKHSTIKIADEVPRSLNTTIFTVHWTYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREWSSNFVGFYTDYDPRVRAWYITATSGPKDVIILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVIC---ARNSHWDEIGKWHLYKSHALSCRPDSLVAATIAHRKDLIESIDNLVPGGTSELETGFELAFDLL--------KSVPRTGCQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTNMGLTVPARIFSYLVKDDGEMLPGSI----AC---GHGGSMRKIVYGENIISQLSNYFEF---------------LAKVTQKKEGLWTSPYIDSLGTGLLITHAVPAIS-TEDGTLLGVAGVDVTLEEIEMLIARYQWG-SMTSFFINNKGNVIFHPLLKASTTLEDDPIFIHIQSLEQNKAGNPKDFSKVVDDMINMTAGN 1916
            +EI KD S +L +    + ++  R  + A E      YD + + +    Y   KDLP N  +  D+P           FK  V    S++ I  E+ +  +  + T+ WT KL  I     +    +R+QYF S  G++  +PG  W       +   D R R WY+   S PKDV++LID S SM G    + K   + +I T+ ++DY+ V      +N     I  +   ++        + V A+  ++  L + I  L   G + L+T  E A +          K      C  +IV  TD  D                        +Y+  K+ S++N++N   T   RIF Y V +  E+ P  +     C   G+ G +  +    NII + S    +               +  V+  ++G         +G GL+ +  +P  + + +G+ LG+ G D+T+  ++ L+   + G +  +F IN  G +IFHP LK       DP  + +  +E +     K  SK+    IN  A N
Sbjct:   71 LEIAKDFSNKLANEFRKKMESLKRAVDFAEEEATKYQYDPHIKPE-EVQYINSKDLPENSELLVDHP----------LFKTRVIANQSSVHIPTEIYKEDSFILNTLKWTQKLNNIF---IRASNNLRYQYFASFTGIVLQYPGMRWRKKGTDMF---DVRRRQWYVQGASSPKDVMVLIDTSGSMHGIAIKLTKSAVEKLIDTMGENDYIAVTHFPPGKNQAMQLIKDYPFIQTKPCFA---TFVQASKRNKDRLFKQIFQLRAQGIANLDTALEFAINEFHKFDNRTEKGNEGANCNRLIVVFTDSGD------------------------EYDKEKIRSLMNRSNT--TKNLRIFIYYVGE--EITPIDVLENRTCEYRGYFGHIHAMGAVSNIIDKYSKTVHYHTIHRENQMEDNEFRIDLVSVNEDGFHNPEDFPPMGLGLMTSLTMPVYNRSGNGSFLGLLGTDMTVAFMDELVPHDKLGRNGYAFAINTNGYIIFHPELKNQLGWMRDPPNVDLTEIEFDSDEKTKIRSKI----INCAASN 568          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Planmine SMEST
Match: SMESG000020648.1 (SMESG000020648.1)

HSP 1 Score: 87.0409 bits (214), Expect = 7.461e-17
Identity = 73/309 (23.62%), Postives = 141/309 (45.63%), Query Frame = 3
Query:  693 HWTYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREWS---------SNFVGFYTDYDPRVRAWYITATSGPKDVIILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVICARNSHWDEIGKWHLYKSHALSCRPDS-----LVAATIAHRKDLIESIDNL-VPGGTSELETGFELAFDLLKSVPRTGCQS-----IIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTNMGLTVPARIFSYLV---KDDGEMLPGSIACGHGGSMRKIVYGENIISQLSNYFEFLAK 1550
            +WT  L++  +   K+D++++WQ+F S  G+ +++PG  W+         S+ V F+   D R   WY+ ATS PK ++I++D S SM G +  IA      I+ TLT++D+ N++     +                C  D+     L+ AT  ++K +++ +  + +P G +E + G   +F +L++       S     +++ +TDG   D + +                +  YN           ++G    ARIF+YL+     + EM+  ++AC + G   +I    ++   +  Y   +A+
Sbjct:  184 NWTADLDQTFQMR-KDDSQLKWQFFCSNTGLFKIYPGIRWNLQIEDSDRDSSLVDFF---DCRSEQWYLEATSYPKKMMIMVDKSGSMKGRRKIIANHTIYEILNTLTENDFFNILLFTKEY----------------CFADNYTSGILMQATDKNKKYILDQLATVFIPDGIAEYDFGLTESFKVLRNDKMNDTDSKYYNYLLMIITDGSPLDYQQL----------------IENYN----------KDLG----ARIFTYLIGQGTTEREMV-TNMACKNQGYAVEIATLADVKENVQKYLNVVAR 441          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Planmine SMEST
Match: SMESG000020648.1 (SMESG000020648.1)

HSP 1 Score: 86.6557 bits (213), Expect = 8.538e-17
Identity = 80/341 (23.46%), Postives = 154/341 (45.16%), Query Frame = 3
Query:  585 PMTFNSYFKQNVTEKH-STIKIADEVPRSLNTTIFTVHWTYKLEEIMKENAKEDTRIRWQYFGSTAGVLRLFPGREWS---------SNFVGFYTDYDPRVRAWYITATSGPKDVIILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVICARNSHWDEIGKWHLYKSHALSCRPDSLVAATIAHRKDLIESIDNL-VPGGTSELETGFELAFDLLKSVPRTGCQS-----IIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNWTKVHSIINKTNMGLTVPARIFSYLVKD---DGEMLPGSIACGHGGSMRKIVYGENIISQLSNYFEFLAK 1550
            P+  + Y    VT +  ST  +   V  +        +WT  L++  +   K+D++++WQ+F S  G+ +++PG  W+         S+ V F+   D R   WY+ ATS PK ++I++D S SM G +  IA      I+ TLT++D+ N++           K + +  +  S     L+ AT  ++K +++ +  + +P G +E + G   +F +L++       S     +++ +TDG   D + +                +  YN           ++G    ARIF+YL+     + EM+  ++AC + G   +I    ++   +  Y   +A+
Sbjct:  147 PLDKDPYLGNIVTNREMSTTHVPTNVYDASQEIQSVANWTADLDQTFQMR-KDDSQLKWQFFCSNTGLFKIYPGIRWNLQIEDSDRDSSLVDFF---DCRSEQWYLEATSYPKKMMIMVDKSGSMKGRRKIIANHTIYEILNTLTENDFFNILL--------FTKEYCFADNYTS---GILMQATDKNKKYILDQLATVFIPDGIAEYDFGLTESFKVLRNDKMNDTDSKYYNYLLMIITDGSPLDYQQL----------------IENYN----------KDLG----ARIFTYLIGQGTTEREMV-TNMACKNQGYAVEIATLADVKENVQKYLNVVAR 441          
The following BLAST results are available for this feature:
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CACNA2D11.249e-4924.91calcium voltage-gated channel auxiliary subunit al... [more]
CACNA2D14.389e-4724.53calcium voltage-gated channel auxiliary subunit al... [more]
CACNA2D22.483e-4522.50calcium voltage-gated channel auxiliary subunit al... [more]
CACNA2D23.651e-4522.79calcium voltage-gated channel auxiliary subunit al... [more]
CACNA2D21.092e-4326.38calcium voltage-gated channel auxiliary subunit al... [more]
back to top
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
tag-1808.638e-2524.06pep chromosome:WBcel235:II:11323051:11329429:-1 ge... [more]
tag-1809.650e-2524.06pep chromosome:WBcel235:II:11323051:11329147:-1 ge... [more]
unc-363.278e-2122.88Voltage-dependent calcium channel unc-36 [Source:... [more]
unc-366.506e-1628.00Voltage-dependent calcium channel unc-36 [Source:... [more]
back to top
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ca-Ma2d2.575e-3525.18gene:FBgn0261999 transcript:FBtr0303797[more]
Ca-Ma2d2.575e-3525.18gene:FBgn0261999 transcript:FBtr0332356[more]
CG45878.053e-3221.42gene:FBgn0028863 transcript:FBtr0344773[more]
CG45878.053e-3221.42gene:FBgn0028863 transcript:FBtr0344774[more]
CG45871.014e-3121.42gene:FBgn0028863 transcript:FBtr0344775[more]
back to top
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CACNA2D11.563e-4924.38si:dkey-266j7.2 [Source:ZFIN;Acc:ZDB-GENE-060503-1... [more]
cacna2d2b1.278e-4524.55calcium channel, voltage-dependent, alpha 2/delta ... [more]
cacna2d2b1.836e-4524.84calcium channel, voltage-dependent, alpha 2/delta ... [more]
cacna2d4a6.599e-4525.92calcium channel, voltage-dependent, alpha 2/delta ... [more]
CACNA2D31.610e-4325.60calcium channel, voltage-dependent, alpha 2/delta ... [more]
back to top
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cacna2d14.056e-4726.40calcium channel, voltage-dependent, alpha 2/delta ... [more]
CACNA2D41.962e-4326.68calcium channel, voltage-dependent, alpha 2/delta ... [more]
CACNA2D21.446e-4224.78calcium voltage-gated channel auxiliary subunit al... [more]
CACNA2D49.435e-4226.27calcium channel, voltage-dependent, alpha 2/delta ... [more]
CACNA2D36.196e-4028.42calcium channel, voltage-dependent, alpha 2/delta ... [more]
back to top
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cacna2d11.075e-4824.33calcium channel, voltage-dependent, alpha2/delta s... [more]
Cacna2d12.806e-4723.94calcium channel, voltage-dependent, alpha2/delta s... [more]
Cacna2d16.297e-4724.17calcium channel, voltage-dependent, alpha2/delta s... [more]
Cacna2d14.926e-4623.94calcium channel, voltage-dependent, alpha2/delta s... [more]
Cacna2d15.989e-4623.94calcium channel, voltage-dependent, alpha2/delta s... [more]
back to top
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P54289|CA2D1_HUMAN5.999e-4924.91Voltage-dependent calcium channel subunit alpha-2/... [more]
sp|P13806|CA2D1_RABIT2.097e-4824.45Voltage-dependent calcium channel subunit alpha-2/... [more]
sp|O08532|CA2D1_MOUSE7.517e-4824.33Voltage-dependent calcium channel subunit alpha-2/... [more]
sp|Q9NY47|CA2D2_HUMAN1.193e-4422.50Voltage-dependent calcium channel subunit alpha-2/... [more]
sp|Q6PHS9|CA2D2_MOUSE7.720e-4324.59Voltage-dependent calcium channel subunit alpha-2/... [more]
back to top
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267H3L50.000e+058.01VWFA domain-containing protein OS=Macrostomum lign... [more]
A0A267EZH10.000e+057.92VWFA domain-containing protein OS=Macrostomum lign... [more]
A0A1S3HMX00.000e+058.01voltage-dependent calcium channel subunit alpha-2/... [more]
R7USR90.000e+055.17VWFA domain-containing protein OS=Capitella teleta... [more]
A0A2C9JBX70.000e+053.68VWFA domain-containing protein OS=Biomphalaria gla... [more]
back to top
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CACNA2D33.572e-4626.01calcium voltage-gated channel auxiliary subunit al... [more]
CACNA2D36.567e-4625.97calcium voltage-gated channel auxiliary subunit al... [more]
CACNA2D32.640e-4527.34calcium voltage-gated channel auxiliary subunit al... [more]
CACNA2D33.860e-4525.68calcium voltage-gated channel auxiliary subunit al... [more]
cacna2d2b4.336e-4326.56calcium channel, voltage-dependent, alpha 2/delta ... [more]
back to top
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cacna2d1a6.352e-3728.57calcium channel, voltage-dependent, alpha 2/delta ... [more]
cacna2d4b1.811e-3225.15calcium channel, voltage-dependent, alpha 2/delta ... [more]
back to top
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO446030.000e+043.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO285384.438e-14644.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO469794.902e-4725.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO406092.306e-3724.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482101.893e-3421.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cacna2d2a3.319e-4823.15calcium voltage-gated channel auxiliary subunit al... [more]
cacna2d2a1.485e-4623.10calcium voltage-gated channel auxiliary subunit al... [more]
cacna2d2a1.580e-4623.31calcium voltage-gated channel auxiliary subunit al... [more]
cacna2d2b7.814e-4526.85voltage-dependent calcium channel subunit alpha-2/... [more]
cacna2d2b3.546e-4423.33voltage-dependent calcium channel subunit alpha-2/... [more]
back to top
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000019491.10.000e+099.92SMESG000019491.1[more]
SMESG000021966.17.309e-3124.73SMESG000021966.1[more]
SMESG000021966.19.749e-3124.73SMESG000021966.1[more]
SMESG000020648.17.461e-1723.62SMESG000020648.1[more]
SMESG000020648.18.538e-1723.46SMESG000020648.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032130 ID=SMED30032130|Name=Voltage-dependent calcium channel subunit alpha-2/delta-1|organism=Schmidtea mediterranea sexual|type=transcript|length=3764bp
GAAAGTGCTGACGTCATCGATTTCTCTTCTCATGCCTTCACTTGAATGGA
CAAAAAAAGAAATTTTCTTCCTAAACACACAATGCTGCGCATCTCAATTG
TTATCAGTCTACAATTATAGAATTAATCAATAAGTTACTCAATAAGTTAC
CAATGTTATTTTTATTATGGATTATATATTTTCCCACTTCTATTAAATCA
AATCATTATAATAGTTATTCAGAAAATATTCCGAAAAATTTGGATGGCAC
TCTTTATGGAGATATCTACAATTGGGTGGACATGATTCAAAATTATATCA
AACAATTGGCTTTAAATGGAATTAGAAAAGATGTTACCCAATCTTTGTTT
GACCAAGCTAAATACAAACTGGAAATAAAAGATGGAATGGAAATTGTCAA
AGATATTAGTGAACAGCTCGGTTCTTATTTATTCAATCGTAAAAAGGCTG
CTTTACGAATAGCAAATGCTGCTGTAGAAATATATGATATGAATAAAAGA
CGCAAAGGGAATTTCTCATATGAATTCCTAAAAGATCTTCCAACTAATGA
AGTAATGGATTCTGATAATCCAAAATCTTTGCCTCCAATGACATTTAATT
CTTATTTCAAGCAAAATGTCACTGAAAAACATTCTACTATAAAGATTGCT
GATGAAGTGCCTCGTTCATTGAATACTACGATTTTTACGGTTCATTGGAC
CTACAAATTAGAAGAAATAATGAAGGAAAACGCCAAAGAGGATACGAGGA
TTCGGTGGCAATATTTCGGTAGTACAGCAGGTGTTTTGAGATTATTTCCT
GGGCGAGAATGGAGTAGTAATTTTGTAGGTTTTTATACAGATTATGATCC
AAGAGTGAGAGCATGGTATATAACTGCAACAAGTGGACCGAAAGATGTCA
TAATACTTATCGATTGCAGTTTCAGTATGACTGGAGAAAAGTTTTCCATT
GCAAAGGAGGTTTCAAAAGCTATAATACAAACTCTGACTAAGCATGATTA
TTTAAATGTGATATGCGCACGAAATAGTCACTGGGATGAAATCGGAAAGT
GGCACCTGTATAAATCCCATGCTTTAAGTTGTCGACCAGACAGTCTGGTC
GCAGCTACAATTGCTCATAGAAAGGATCTTATTGAAAGTATTGATAATTT
AGTCCCAGGAGGCACAAGTGAATTGGAAACTGGATTTGAATTAGCTTTTG
ATTTGTTAAAAAGTGTTCCTAGAACTGGTTGTCAAAGTATCATTGTATTT
CTTACTGACGGGCGGGATACTGACGGCGAAAATGTTCGGTGTGGTCCCGG
TTACTATACAAGGTCTGGATATGTTCCTGGACCAGTATGTAAGTATAACT
GGACTAAAGTCCATTCGATTATTAATAAAACAAATATGGGTTTGACTGTT
CCAGCAAGAATATTCAGTTATTTAGTAAAGGATGACGGTGAAATGCTACC
AGGGTCAATTGCATGTGGTCATGGAGGAAGTATGCGTAAAATCGTATATG
GAGAAAATATAATATCCCAATTATCCAATTATTTTGAATTCCTAGCCAAA
GTTACACAAAAGAAAGAGGGATTATGGACTTCTCCTTACATTGATTCTTT
AGGTACTGGTTTACTCATTACACATGCAGTACCGGCTATTAGTACTGAAG
ATGGAACTCTTCTTGGTGTTGCTGGAGTCGATGTCACACTGGAAGAGATT
GAAATGTTAATCGCAAGATATCAGTGGGGATCTATGACTTCCTTTTTCAT
AAATAATAAAGGAAATGTTATTTTTCATCCTTTACTAAAAGCAAGTACGA
CTTTAGAAGATGATCCAATATTTATCCATATTCAAAGTCTAGAACAAAAC
AAAGCTGGAAATCCTAAAGATTTCTCAAAGGTTGTAGATGATATGATAAA
TATGACAGCAGGAAACCGACGTATTATTGATGGTAGAAGAGGAACTCCAA
AAGGAGACTTTAAAGCAGGAGTTAAGTATGATAAAATGCCGTTGGAGTAT
TATTATGCACCTTTGAAACATTCAAACGTATATTCTATTGCTATTGTTTT
AGCAGATACAGATAAAGTGTTTCGAAGACTTGAAGAACCATCAAATATTA
GTCAACCCGTTCCAAGTTTCTTTAATTTACTAATCGAATATAACAGTACA
AAAGTTCTTAAAGAATATCCCAATATTTTTAAAGAACTAGACGTTCGATT
TAATGAAACTAAATATCCAATGCTGAGAGTTACTTATAATTATTCAAGCA
TATTTTTTGCTCCTAGCGTCCACTGCGATCCTAGCAAATACTTTTTTGAC
GATGATCTTGCTCAAAAGACTTTAGACGCTCATCGATACATGAATGAATT
GACGCACAATTCTGATCCGGGATGTGATGTCCCAGAAGGAAAATACGCTC
AAGGTACAAGAGCTTATGTACTTGTGACTGAATCTATAGAAAACCAATGG
AAAAGTAGAAATTTTGAATCAATAGATGAGGTTACATGGACCTATGTTGG
TATGAGGTCTGGAGTTTTTCGAACTTATCCTGGACACCGATCAACTAGGC
TTTATGATCCAACAAAGCGTCCTTGGTATAGAAGAACTCTGGCTAATCCA
ACTAAAATTTCTATTTCTACACCATATTTTGACGCTGCTGGAAGTGGGAA
AATCATAACAATATCACAAGCAGTCTTTGAAGGTATGCCTACATTATCAA
AAGAACATTGTAAAAATATAAATTCTTTAAAGCCTGGTGGTTGCCATTGT
GTGAAAGATTCAGATTGTTTAAGTGGGTATTGTTATATCAGTAAGGCACC
GGGTCCAGATGCACATGAAACAAGATGCGCTACAGAAAGAATAGAAGCTA
TTACAAGTCTTGATATAGGATATGACAGTTTTCATAAAAGGTTATTTCAA
ATTATGCAGGCTTCAGATGGTGTAAAATCATGTAATTCTTCCTATAAATG
TCCTGATGGATATCTTGATTGCTGGACAAAATGTTACATTTTCGATGATA
GAGCAAATATTATTATGGCTTCAGAATTTGTTGCTGCGACCGCATTCGAC
ACAAATAAGTATCTTGGGATTACAGTGGGAAAGAAAGAAAGTGAAATAAT
GAAAGATCTAATTTACCATCATAAATTTTTTCAAAGAAGTGAATCCATCG
ACTTTCAAGGAGCATGCACATACGTGTCTAGTTATCCACAAGTAACATTA
AAGGGCATTCCGAGAACTCCGGAAGATTTTGACAACTATTACAAAACGAG
AGGACCTATTCCTAGTTTTATTAATTCATATAGCTGCATTCAAGATGTAG
TGACTTTTTCAGCGAATATATCTGCCTTGGGCCCAAGTAGAATGATTGTG
GGAAATGTGTCTGGTCCATGTACAACTGGCTTTTATTACGTCACCAGCAT
GCCTGAGACAAATCTTTTTCTTTTAGTAGTTGAAAGTCGATATGATAGAA
GTGATTCGTTTTTTTATAATTTTAATTGCGAAATATCAAGAAAGATTGTA
GCAAGCGGAGCATATAGGATTATTAATGGAACTTGTGCTCATAAAGAAAC
AAACAAACAGACCCTTGCTGAAAAGGGTACCTGTCCAGAAATTGTCAAGG
TCAATATAACTTGTGAATATAGCACAGCTATGAATTTTCAACCCAACTAT
AAACTGTTAGTTATTAATATTTTATATTTAGTTCACAATTTACTGAACTG
GAGTTTATTTTAATAATTTCTCAAATTTTTGACCAGAAATCAAATTGTAC
AGGATTTTAATTAA
back to top

protein sequence of SMED30032130-orf-1

>SMED30032130-orf-1 ID=SMED30032130-orf-1|Name=SMED30032130-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1187bp
MLFLLWIIYFPTSIKSNHYNSYSENIPKNLDGTLYGDIYNWVDMIQNYIK
QLALNGIRKDVTQSLFDQAKYKLEIKDGMEIVKDISEQLGSYLFNRKKAA
LRIANAAVEIYDMNKRRKGNFSYEFLKDLPTNEVMDSDNPKSLPPMTFNS
YFKQNVTEKHSTIKIADEVPRSLNTTIFTVHWTYKLEEIMKENAKEDTRI
RWQYFGSTAGVLRLFPGREWSSNFVGFYTDYDPRVRAWYITATSGPKDVI
ILIDCSFSMTGEKFSIAKEVSKAIIQTLTKHDYLNVICARNSHWDEIGKW
HLYKSHALSCRPDSLVAATIAHRKDLIESIDNLVPGGTSELETGFELAFD
LLKSVPRTGCQSIIVFLTDGRDTDGENVRCGPGYYTRSGYVPGPVCKYNW
TKVHSIINKTNMGLTVPARIFSYLVKDDGEMLPGSIACGHGGSMRKIVYG
ENIISQLSNYFEFLAKVTQKKEGLWTSPYIDSLGTGLLITHAVPAISTED
GTLLGVAGVDVTLEEIEMLIARYQWGSMTSFFINNKGNVIFHPLLKASTT
LEDDPIFIHIQSLEQNKAGNPKDFSKVVDDMINMTAGNRRIIDGRRGTPK
GDFKAGVKYDKMPLEYYYAPLKHSNVYSIAIVLADTDKVFRRLEEPSNIS
QPVPSFFNLLIEYNSTKVLKEYPNIFKELDVRFNETKYPMLRVTYNYSSI
FFAPSVHCDPSKYFFDDDLAQKTLDAHRYMNELTHNSDPGCDVPEGKYAQ
GTRAYVLVTESIENQWKSRNFESIDEVTWTYVGMRSGVFRTYPGHRSTRL
YDPTKRPWYRRTLANPTKISISTPYFDAAGSGKIITISQAVFEGMPTLSK
EHCKNINSLKPGGCHCVKDSDCLSGYCYISKAPGPDAHETRCATERIEAI
TSLDIGYDSFHKRLFQIMQASDGVKSCNSSYKCPDGYLDCWTKCYIFDDR
ANIIMASEFVAATAFDTNKYLGITVGKKESEIMKDLIYHHKFFQRSESID
FQGACTYVSSYPQVTLKGIPRTPEDFDNYYKTRGPIPSFINSYSCIQDVV
TFSANISALGPSRMIVGNVSGPCTTGFYYVTSMPETNLFLLVVESRYDRS
DSFFYNFNCEISRKIVASGAYRIINGTCAHKETNKQTLAEKGTCPEIVKV
NITCEYSTAMNFQPNYKLLVINILYLVHNLLNWSLF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036465vWFA_dom_sf
IPR002035VWF_A
IPR013608VWA_N
Vocabulary: molecular function
TermDefinition
GO:0005244voltage-gated ion channel activity
GO:0005262calcium channel activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006811ion transport
GO:0006816calcium ion transport
GO:0034765regulation of ion transmembrane transport
GO:0070588calcium ion transmembrane transport
GO:0098703calcium ion import across plasma membrane
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:1990454L-type voltage-gated calcium channel complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002035von Willebrand factor, type ASMARTSM00327VWA_4coord: 246..466
e-value: 8.5E-5
score: 31.9
IPR002035von Willebrand factor, type APFAMPF00092VWAcoord: 248..377
e-value: 3.2E-8
score: 34.0
IPR002035von Willebrand factor, type APROSITEPS50234VWFAcoord: 248..379
score: 11.715
NoneNo IPR availableGENE3DG3DSA:3.30.450.20coord: 757..847
e-value: 2.3E-13
score: 52.1
NoneNo IPR availableGENE3DG3DSA:3.30.450.20coord: 488..636
e-value: 2.5E-11
score: 45.5
NoneNo IPR availablePANTHERPTHR10166VOLTAGE-DEPENDENT CALCIUM CHANNEL SUBUNIT ALPHA-2/DELTA-RELATEDcoord: 29..1178
NoneNo IPR availablePANTHERPTHR10166:SF43coord: 29..1178
NoneNo IPR availableCDDcd12913PDC1_MCP_likecoord: 760..844
e-value: 6.01435E-7
score: 47.907
NoneNo IPR availableCDDcd12913PDC1_MCP_likecoord: 469..513
e-value: 2.43659E-7
score: 49.0626
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..16
score: 0.676
IPR036465von Willebrand factor A-like domain superfamilyGENE3DG3DSA:3.40.50.410coord: 247..458
e-value: 1.2E-17
score: 66.5
IPR036465von Willebrand factor A-like domain superfamilySUPERFAMILYSSF53300vWA-likecoord: 246..376
IPR013608VWA N-terminalPFAMPF08399VWA_Ncoord: 139..220
e-value: 1.0E-15
score: 58.3