Androglobin

Overview
NameAndroglobin
Smed IDSMED30032126
Length (bp)4608
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Androglobin (SMED30032126) t-SNE clustered cells

Violin plots show distribution of expression levels for Androglobin (SMED30032126) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Androglobin (SMED30032126) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Androglobin (SMED30032126) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032126

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 21

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30032126SMESG000053594.1 SMESG000047986.1 Contig3726newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30032126SMESG000016163.1 Contig3726newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
head regionSMED30032126SMESG000053594.1 SMESG000047986.1 SmedASXL_016456SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30032126SMESG000078886.1 SMESG000078780.1 SMESG000078276.1 SMESG000077377.1 SMESG000076900.1 SMESG000072841.1 SMESG000070563.1 SMESG000069843.1 SMESG000067323.1 SMESG000067128.1 SMESG000066333.1 SMESG000063482.1 SMESG000063430.1 SMESG000062535.1 SMESG000055265.1 SMESG000052056.1 SMESG000051183.1 SMESG000049398.1 SMESG000047988.1 SMESG000045843.1 SMESG000043425.1 SMESG000041242.1 SMESG000040236.1 SMESG000039783.1 SMESG000034367.1 SMESG000031778.1 SMESG000031308.1 SMESG000028811.1 SMESG000025956.1 SMESG000023833.1 SMESG000023573.1 SMESG000023546.1 SMESG000019820.1 SMESG000018414.1 SMESG000017936.1 SMESG000015191.1 SMESG000014475.1 SMESG000009011.1 SMESG000008656.1 SMESG000005037.1 SMESG000004638.1 SMESG000003422.1 SMESG000053594.1 SMESG000047986.1 Contig44032uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032126SMESG000078886.1 SMESG000078780.1 SMESG000078276.1 SMESG000077377.1 SMESG000076900.1 SMESG000072841.1 SMESG000070563.1 SMESG000069843.1 SMESG000067323.1 SMESG000067128.1 SMESG000066333.1 SMESG000063482.1 SMESG000063430.1 SMESG000062535.1 SMESG000055265.1 SMESG000052056.1 SMESG000051183.1 SMESG000049398.1 SMESG000047988.1 SMESG000045843.1 SMESG000043425.1 SMESG000041242.1 SMESG000040236.1 SMESG000039783.1 SMESG000034367.1 SMESG000031778.1 SMESG000031308.1 SMESG000028811.1 SMESG000025956.1 SMESG000023833.1 SMESG000023573.1 SMESG000023546.1 SMESG000019820.1 SMESG000018414.1 SMESG000017936.1 SMESG000015191.1 SMESG000014475.1 SMESG000009011.1 SMESG000008656.1 SMESG000005037.1 SMESG000004638.1 SMESG000003422.1 SMESG000053594.1 SMESG000047986.1 Contig44032newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032126SMESG000053594.1 SMESG000047986.1 Contig42480uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032126SMESG000053594.1 SMESG000047986.1 Contig42480newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30032126SMESG000053594.1 SMESG000047986.1 dd_Smed_v4_10677_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30032126SMESG000053594.1 SMESG000047986.1 dd_Smed_v4_10677_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30032126SMESG000053594.1 SMESG000047986.1 dd_Smed_v4_10677_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30032126SMESG000053594.1 SMESG000047986.1 dd_Smed_v4_10677_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30032126SMESG000053594.1 SMESG000047986.1 dd_Smed_v4_10677_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30032126SMESG000053594.1 SMESG000047986.1 dd_Smed_v4_10677_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
cilated neuronSMED30032126SMESG000053594.1 SMESG000047986.1 dd_Smed_v4_10677_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032126SMESG000069725.1 Contig4601GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032126SMESG000053594.1 Contig4601GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30032126SMESG000053594.1 SMESG000047986.1 dd_Smed_v6_10677_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30032126SMESG000053594.1 SMESG000047986.1 dd_Smed_v6_10677_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30032126SMESG000053594.1 SMESG000047986.1 dd_Smed_v6_10677_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30032126SMESG000053594.1 SMESG000047986.1 dd_Smed_v6_10677_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30032126SMESG000053594.1 SMESG000047986.1 dd_Smed_v4_10677_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Androglobin vs. Ensembl Human
Match: ADGB (androglobin [Source:HGNC Symbol;Acc:HGNC:21212])

HSP 1 Score: 220.705 bits (561), Expect = 3.223e-57
Identity = 246/1065 (23.10%), Postives = 442/1065 (41.50%), Query Frame = 3
Query: 1236 QMLSTSKMASRYEALRKIGMPSIYSHPVILNYYRDSPLEKSISPELIPSWKLIRPFIKVDIPQLNDCTTHSAYFDSKNVSNQKDDQSKYIEIQTPFINYKLSKKNNSTKEIFDENLENLKIIPHCTSKSNNQIMDSENMGSLD-------SNFGNSNSKLQI------PCEF----SYENEVLNLRDEERYDFSKGLMKS---------------WIDVDTFFECFEVLYIYHKTETYRYTESLSDFKTTNIDQKEPFYLFTDNIDNSEIIICLSVFCKWFTHNDPYYLPDNANNRNSPSINIVRDKSNNLENDNDPFATDQIQGVFFAENHYWKNFKIGKCLKRAKTNGTKAVSLKFPPGRHCLRIFIQALNGFHCKFISQNQFFFGTEDEIIPLAVECPKRIQSLGIDIISAFKNMISNFSNDEERKSNEIALNNL-ILDFSKNSHSRALTSEFTQVFSQGIIKTIKMCNRELLTSDMIFALRAIILDFQSYITLTIXXXXXXXXXXXXAKIPPINSKIDNRKQSSTKSLTNIENKEEKRNEFFGDYSSRDMLYIIRLQKLIKGYYVRKVIMARSPRSNYHDRVVNELNKIKTLIEHNSSEIGNNLLNEIFEIYPQISKHYGLDNDQLNHIKFQEFKGNGILQPVNGFGMLFREIFHIDPLTKKTDDILI-KLNCNVQKCTLSIINNDNGEKTTEIILKRLNFKAFVPNSNGYTLIATTKDVENVVP---WKLKIIGGANNLLPTFIKQELCNDFSIFKIRDYYVPEEDGLLFHQIAKIKLDHPISVFVKLSNPNVSLRLSIYNFDEELYFVEGIGEAYIESFLLLKDYFCEEQVDLVRSGSRNSTKLKKGQEK-VERYXXXXXXXXXXXXXEGKKV-------------------------------YKYSIRASVNNSTWLLSQDNEEFVNXXXXXXRKNM------NEQTLNDNPSKLIQSSEFTKKENVQKILPKTKTKERGQEGVKILKGTEKP-----ITKNNPVDNNTSRPNSTYFESDKQHWTALIISDTCLEDNIQIYKNNEKHDTLCSTKKIW 4190
            ++ S  KMA   E LR+ G+  I SHPV++   R  PL     P  +P WKLIR   +  I             +++ +  +K +  +++EI +PF+NY+++     T+  F  +L    I P     S ++  ++      D       ++ GN+ S++ +        +F    +++++ LNL  E     +    KS               W+D + F  CF+ +YI+HK  +Y      S+FK +  +++  +YLF D++   E+++C S   +W  +         A  ++SP I                       G+  AE   WK+ K G  + +  T  TKA  ++ P GRH L     +  G      S   F  G E  ++P       R     + I+ A  N+I+NF +  +  +   AL +L    +    H + LT++  +VF   + + +K         +  FA RA++LD +                        +NS ++         +       +K      +YS+ ++   I++Q + +G YVR ++ AR P +  +  V + L K+  ++E N  +   +LL  +F+   +  + Y    D+   I F ++      QP N + ++FRE F +       D IL+ K+   +  C L I+NND  E+  ++  K + +  +  N  GYT +A     +  V    WKL++IG +  L P   +   CN F+I +IRDYY+P +  +LF    K+    P ++ V+ S P+  ++L +   +E +    G G+A I +F     +F + +  L    S++        +K  E Y  K +      S +G+ V                               YKY I+ SV  ++W L++    FV  LK LK+ N       +E+ +N         SE  K     K     K KE+  E  K  K  + P     I+  +P   + ++P          +W   ++++    +  ++ K+ E+ D + + K+ W
Sbjct:  430 KIFSLEKMADSAEKLREYGLSHICSHPVLVTRSRSCPLVAPPKPPPLPPWKLIRQKKETVITD-----------EAQELIVKKPE--RFLEISSPFLNYRMTPFTIPTEMHFVRSLIKKGIPPGSDLPSVSETDETATHSQTDLSQITKATSQGNTASQVILGKGTDEQTDFGLGDAHQSDGLNLEREIVSQTTATQEKSQEELPTTNNSVSKEIWLDFEDFCVCFQNIYIFHKPSSYCLNFQKSEFKFS--EERVSYYLFVDSLKPIELLVCFSALVRWGEYG--------ALTKDSPPIE---------------------PGLLTAETFSWKSLKPGSLVLKIHTYATKATVVRLPVGRHMLLFNAYSPVGHSIHICSMVSFVIGDEHVVLPNFEPESCRFTEQSLLIMKAIGNVIANFKDKGKLSA---ALKDLQTAHYPVPFHDKELTAQHFRVFHLSLWRLMKKVQITKPPPNFKFAFRAMVLDLEL-----------------------LNSSLEEVSLVEWLDVKYCMPTSDK------EYSAEEVAAAIKIQAMWRGTYVRLLMKARIPDTKENISVADTLQKVWAVLEMNLEQYAVSLLRLMFKSKCKSLESYPCYQDEETKIAFADYTVTYQEQPPNSWFIVFRETFLVH-----QDMILVPKVYTTLPICILHIVNNDTMEQVPKVFQKVVPY-LYTKNKKGYTFVAEAFTGDTYVAASRWKLRLIGSSAPL-PCLSRDSPCNSFAIKEIRDYYIPNDKKILFRYSVKVLTPQPATIQVRTSKPDAFIKLQVLENEETMVSSTGKGQAIIPAF-----HFLKSEKGLSSQSSKHILSFHSASKKEQEVYVKKKAAQGIQKSPKGRAVSAIQDIGLPLVEEETTSTPTREDSSSTPLQNYKYIIQCSVLYNSWPLTESQLTFVQALKDLKKSNTKAYGERHEELINLGSPDSHTISEGQKSSVTSKTT--RKGKEKSSEKEKTAKEKQAPRFEPQISTVHPQQEDPNKP----------YWILRLVTEHNESELFEVKKDTERADEIRAMKQAW 1394          

HSP 2 Score: 213.001 bits (541), Expect = 7.853e-55
Identity = 125/287 (43.55%), Postives = 177/287 (61.67%), Query Frame = 3
Query:  150 NSDGKHARIGIWPEWSEIDINNEKWDIPLKTKEKDK-ARSPLMTQNLFEDPEGLLKLPSSLKVFKWKRTYE-YFTKNPVIVDTEEGIHKFDIFSLNEHLFISETMRWIICQINNLWITSEKKCAXXXXXXXXXXXXXXXNGTHH-----TWRFWEHIYSLNKVGKG-FPQYNPAGKYIVKLFWMGDWRKILVDDTLPFDENDRLLLPVTTITNELWPXXXXXXXXXXXXXXYNFSSNETEFGDFSVIHSLTGWIPQKKIVSKEYRNQIVNDLSKLLNHWTYSNENCN 986
            +++ K  +  +WPEWSE DIN+EKWD     KEKDK  +SP+   + FEDPEG ++LP SLK++ WKR  +  F++ PV+V  E     FD+FS NEHL  SE MRWII +I  +W                  +S    GT        W+ WEHIYSL K  KG  P +N  GKY+VKL+WMG WRKI +DD LPFDE++ LLLP TT   ELWP++LSKA++K+A++  +  ++  E G+F+VIH+LTGW+P+   +   Y +++   L ++L  +  S+E  +
Sbjct:   37 STEQKKGKFPLWPEWSEADINSEKWDAGKGAKEKDKTGKSPVF--HFFEDPEGKIELPPSLKIYSWKRPQDILFSQTPVVVKNE---ITFDLFSANEHLLCSELMRWIISEIYAVW-----------KIFNGGILSNYFKGTSGEPPLLPWKPWEHIYSLCKAVKGHMPLFNSYGKYVVKLYWMGCWRKITIDDFLPFDEDNNLLLPATTYEFELWPMLLSKAIIKLANIDIHV-ADRRELGEFTVIHALTGWLPEVISLHPGYMDKVWELLKEILPEFKLSDEASS 306          
BLAST of Androglobin vs. Ensembl Human
Match: ADGB (androglobin [Source:HGNC Symbol;Acc:HGNC:21212])

HSP 1 Score: 204.527 bits (519), Expect = 4.616e-54
Identity = 160/647 (24.73%), Postives = 284/647 (43.89%), Query Frame = 3
Query: 1785 WIDVDTFFECFEVLYIYHKTETYRYTESLSDFKTTNIDQKEPFYLFTDNIDNSEIIICLSVFCKWFTHNDPYYLPDNANNRNSPSINIVRDKSNNLENDNDPFATDQIQGVFFAENHYWKNFKIGKCLKRAKTNGTKAVSLKFPPGRHCLRIFIQALNGFHCKFISQNQFFFGTEDEIIPLAVECPKRIQSLGIDIISAFKNMISNFSNDEERKSNEIALNNL-ILDFSKNSHSRALTSEFTQVFSQGIIKTIKMCNRELLTSDMIFALRAIILDFQSYITLTIXXXXXXXXXXXXAKIPPINSKIDNRKQSSTKSLTNIENKEEKRNEFFGDYSSRDMLYIIRLQKLIKGYYVRKVIMARSPRSNYHDRVVNELNKIKTLIEHNSSEIGNNLLNEIFEIYPQISKHYGLDNDQLNHIKFQEFKGNGILQPVNGFGMLFREIFHIDPLTKKTDDILI-KLNCNVQKCTLSIINNDNGEKTTEIILKRLNFKAFVPNSNGYTLIATTKDVENVVP---WKLKIIGGANNLLPTFIKQELCNDFSIFKIRDYYVPEEDGLLFHQIAKIKLDHPISVFVKLSNPNVSLRLSIYNFDEELYFVEGIGEAYIESFLLLKD-------YFCEEQVDLVRSGSRNSTKLKKGQE 3689
            W+D + F  CF+ +YI+HK  +Y      S+FK +  +++  +YLF D++   E+++C S   +W  +         A  ++SP I                       G+  AE   WK+ K G  + +  T  TKA  ++ P GRH L     +  G      S   F  G E  ++P       R     + I+ A  N+I+NF +  +  +   AL +L    +    H + LT++  +VF   + + +K         +  FA RA++LD +                        +NS ++         +       +K      +YS+ ++   I++Q + +G YVR ++ AR P +  +  V + L K+  ++E N  +   +LL  +F+   +  + Y    D+   I F ++      QP N + ++FRE F +       D IL+ K+   +  C L I+NND  E+  ++  K + +  +  N  GYT +A     +  V    WKL++IG +  L P   +   CN F+I +IRDYY+P +  +LF    K+    P ++ V+ S P+  ++L +   +E +    G G+A I +F  LK         + E   +L+  GS +S  + +GQ+
Sbjct:   52 WLDFEDFCVCFQNIYIFHKPSSYCLNFQKSEFKFS--EERVSYYLFVDSLKPIELLVCFSALVRWGEYG--------ALTKDSPPIE---------------------PGLLTAETFSWKSLKPGSLVLKIHTYATKATVVRLPVGRHMLLFNAYSPVGHSIHICSMVSFVIGDEHVVLPNFEPESCRFTEQSLLIMKAIGNVIANFKDKGKLSA---ALKDLQTAHYPVPFHDKELTAQHFRVFHLSLWRLMKKVQITKPPPNFKFAFRAMVLDLEL-----------------------LNSSLEEVSLVEWLDVKYCMPTSDK------EYSAEEVAAAIKIQAMWRGTYVRLLMKARIPDTKENISVADTLQKVWAVLEMNLEQYAVSLLRLMFKSKCKSLESYPCYQDEETKIAFADYTVTYQEQPPNSWFIVFRETFLVH-----QDMILVPKVYTTLPICILHIVNNDTMEQVPKVFQKVVPY-LYTKNKKGYTFVAEAFTGDTYVAASRWKLRLIGSSAPL-PCLSRDSPCNSFAIKEIRDYYIPNDKKILFRYSVKVLTPQPATIQVRTSKPDAFIKLQVLENEETMVSSTGKGQAIIPAFHFLKSEKGLSSQSYGERHEELINLGSPDSHTISEGQK 628          
BLAST of Androglobin vs. Ensembl Human
Match: ADGB (androglobin [Source:HGNC Symbol;Acc:HGNC:21212])

HSP 1 Score: 134.806 bits (338), Expect = 7.551e-35
Identity = 78/179 (43.58%), Postives = 104/179 (58.10%), Query Frame = 3
Query:  150 NSDGKHARIGIWPEWSEIDINNEKWDIPLKTKEKDK-ARSPLMTQNLFEDPEGLLKLPSSLKVFKWKRTYE-YFTKNPVIVDTEEGIHKFDIFSLNEHLFISETMRWIICQINNLWITSEKKCAXXXXXXXXXXXXXXXNGTHHTWRFWEHIYSLNKVGKG-FPQYNPAGKYIVKLFWM 677
            +++ K  +  +WPEWSE DIN+EKWD     KEKDK  +SP+   + FEDPEG ++LP SLK++ WKR  +  F++ PV+V  E     FD+FS NEHL  SE MRWII +I  +W                 +  +        W+ WEHIYSL K  KG  P +N  GKY+VKL+WM
Sbjct:   37 STEQKKGKFPLWPEWSEADINSEKWDAGKGAKEKDKTGKSPVF--HFFEDPEGKIELPPSLKIYSWKRPQDILFSQTPVVVKNE---ITFDLFSANEHLLCSELMRWIISEIYAVWKIFNGGILSNYFKGTSGEPPLL------PWKPWEHIYSLCKAVKGHMPLFNSYGKYVVKLYWM 204          
BLAST of Androglobin vs. Ensembl Human
Match: ADGB (androglobin [Source:HGNC Symbol;Acc:HGNC:21212])

HSP 1 Score: 112.849 bits (281), Expect = 9.141e-28
Identity = 69/188 (36.70%), Postives = 101/188 (53.72%), Query Frame = 3
Query:   60 LPKKKEERNKSAQSNSPYHKKLKEGTLTGMNSDGKHARIGIWPEWSEIDINNEKWDIPLKTKEKDK-ARSPLMTQNLFEDPEGLLKLPSSLKVFKWKRTYE-YFTKNPVIVDTEEGIHKFDIFSLNEHLFISETMRWIICQINNLWITSEKKCAXXXXXXXXXXXXXXXNGTHHTWRFWEHIYSLNKV 617
            +  K+ ++ +  + NS +     +  +   +++ K  +  +WPEWSE DIN+EKWD     KEKDK  +SP+   + FEDPEG ++LP SLK++ WKR  +  F++ PV+V  E     FD+FS NEHL  SE MRWII +I  +W                 +  +        W+ WEHIYSL K 
Sbjct:    1 MASKQTKKKEVHRINSAHGSDKSKDNVQSGSTEQKKGKFPLWPEWSEADINSEKWDAGKGAKEKDKTGKSPVF--HFFEDPEGKIELPPSLKIYSWKRPQDILFSQTPVVVKNE---ITFDLFSANEHLLCSELMRWIISEIYAVWKIFNGGILSNYFKGTSGEPPLL------PWKPWEHIYSLCKA 177          
BLAST of Androglobin vs. Ensembl Human
Match: ADGB (androglobin [Source:HGNC Symbol;Acc:HGNC:21212])

HSP 1 Score: 114.775 bits (286), Expect = 2.527e-25
Identity = 77/276 (27.90%), Postives = 133/276 (48.19%), Query Frame = 3
Query: 2892 VVNELNKIKTLIEHNSSEIGNNLLNEIFEIYPQISKHYGLDNDQLNHIKFQEFKGNGILQPVNGFGMLFREIFHIDPLTKKTDDILI-KLNCNVQKCTLSIINNDNGEKTTEIILKRLNFKAFVPNSNGYTLIATTKDVENVVP---WKLKIIGGANNLLPTFIKQELCNDFSIFKIRDYYVPEEDGLLFHQIAKIKLDHPISVFVKLSNPNVSLRLSIYNFDEELYFVEGIGEAYIESFLLLKD-------YFCEEQVDLVRSGSRNSTKLKKGQ 3686
            V + L K+  ++E N  +   +LL  +F+   +  + Y    D+   I F ++      QP N + ++FRE F +       D IL+ K+   +  C L I+NND  E+  ++  K + +  +  N  GYT +A     +  V    WKL++IG +  L P   +   CN F+I +IRDYY+P +  +LF    K+    P ++ V+ S P+  ++L +   +E +    G G+A I +F  LK         + E   +L+  GS +S  + +GQ
Sbjct:    1 VADTLQKVWAVLEMNLEQYAVSLLRLMFKSKCKSLESYPCYQDEETKIAFADYTVTYQEQPPNSWFIVFRETFLVH-----QDMILVPKVYTTLPICILHIVNNDTMEQVPKVFQKVVPY-LYTKNKKGYTFVAEAFTGDTYVAASRWKLRLIGSSAPL-PCLSRDSPCNSFAIKEIRDYYIPNDKKILFRYSVKVLTPQPATIQVRTSKPDAFIKLQVLENEETMVSSTGKGQAIIPAFHFLKSEKGLSSQSYGERHEELINLGSPDSHTISEGQ 269          
BLAST of Androglobin vs. Ensembl Celegans
Match: clp-2 (CaLPain family [Source:UniProtKB/TrEMBL;Acc:Q22143])

HSP 1 Score: 72.4034 bits (176), Expect = 2.244e-12
Identity = 62/211 (29.38%), Postives = 94/211 (44.55%), Query Frame = 3
Query:  279 QNLFEDPEGLLKLPSS--LKVFKWKRTYEYFTKNPVIVDTEEGIHKFDIFSLNEHLFISETMRWIICQINNLWITSEKKCAXXXXXXXXXXXXXXXNGTHHTWRFWEHIYS---LNKVGKGFPQYNPAGKYIVKLFWMGDWRKILVDDTLPFDENDRLLLPVTTITNELWPXXXXXXXXXXXXXXYNFSSNETEFGDFSVIHSLTGWIPQK 896
            Q  F DPEG + L     +K+  WKR  E F +NP I           IFS++ H  I +T+      I++L I +                        +  RF + + +     +   G P YNPAGKY+ K    G WRK+L+DD  P DEN+R++   T    ELW + L +         Y+F  + +       +++LTGWIP++
Sbjct:  243 QGKFTDPEGKISLTQKQRMKLKCWKRVSELF-ENPTI-----------IFSIDCHT-IKQTVISDCSFISSLSIAA-----------------------LYEKRFKKQLVTSIIFPQDANGKPIYNPAGKYMFKFHLNGAWRKVLIDDYFPVDENNRMMCSQTENKGELW-VSLLEKAYMKVMGGYDFPGSNSNID----LNALTGWIPER 412          
BLAST of Androglobin vs. Ensembl Zebrafish
Match: adgb (androglobin [Source:ZFIN;Acc:ZDB-GENE-041001-205])

HSP 1 Score: 419.468 bits (1077), Expect = 3.239e-122
Identity = 385/1512 (25.46%), Postives = 629/1512 (41.60%), Query Frame = 3
Query:   63 PKKKEERNKSAQSNSPYHKKLKEGTLTGMNS---DGKHARIGIWPEWSEIDINNEKWDIPLKTKEKDKARSPLMTQNLFEDPEGLLKLPSSLKVFKWKRTYEYFTKN-PVIVDTEEGIHKFDIFSLNEHLFISETMRWIICQINNLWITSEKKCAXXXXXXXXXXXXXXXNGTHHTWRFWEHIYSLNKVGKG-FPQYNPAGKYIVKLFWMGDWRKILVDDTLPFDENDRLLLPVTTITNELWPXXXXXXXXXXXXXXYNFSSNETEFGDFSVIHSLTGWIPQKKIVSKEYRNQIVNDLSKLLNHWTYSNENCNLTGDKNDISNVEDIQHIEVNLDKTDNKEILLXXXXXXXXXXXXXXXXXXXXXXXXXXLFDGKNLNENPETLVIASYNSSF---NKLQMLSTSKMASRYEALRKIGMPSIYSHPVILNYYRDSPLEKSISPELIPSWKLIRPFIKVDIPQLNDCTTHSAYFDSKNVSNQKDDQSKYIEIQTPFINYKL-------SKKNNSTKEIFDENLENLKIIPHCTSKSNNQIMDSENMGSLDSNFGNSNSKL------QIPCEF-----SYENEVL----------NLRDEERYDFSKG------------------LMKSWIDVDTFFECFEVLYIYHKTETY-------RYTESLS-----------------------------DFKTTNIDQKEPFYLFTDNIDNSEIIICLSVFCKWFTHNDPYYLPDNANNRNSPSINIVRDKSNNLENDNDPFATDQIQGVFFAENHYWKNFKIGKCLKRAKTNGTKAVSLKFPPGRHCLRIFIQALNGFHCKFISQNQFFFGTEDEIIPLAVECPKRIQSLGIDIISAFKNMISNFSNDEERKSNEIALNNLILDFSKNSHSRALTSEFTQVFSQGIIKTIKMCNRELLTSDMIFALRAIILDFQSYITLTIXXXXXXXXXXXXAKIPPINSKIDNRKQSSTKSLTNIENKEEKRNEFFGDYSS-RDMLYIIRLQKLIKGYYVRKVIMARSPRSNYHDRVVNELNKIKTLIEHNSSEIGNNLLNEIFEIYPQISKHYGLDNDQLNHIKFQEFKGNGILQPVNGFGMLFREIFHIDPLTKKTDDILIKLNCNVQKCTLSIINNDNGEKTTEIILKRLNFKAFVPNSNGYTLIAT--TKDVENV-VPWKLKIIGGANNLLPTFIKQELCNDFSIFKIRDYYVPEEDGLLFHQIAKIKLDHPISVFVKLSNPNVSLRLSIYNFDEELYFVEGIGEAYIESFLLLKDYFCEEQVDLVRSGSRNSTKLKKGQEKVERYXXXXXXXXXXXXXEGKKVYKYSIRASVNNSTWLLSQDNEEFVNXXXXXXRKNMNEQTLNDNPSKLIQSSEFTKKENVQKILPKTKTKERGQEGVKILKGTEKPI-TKNNPVDNNTSRPNSTY-----------------------FESDKQHWTALIISDTCLEDNIQIYKNNEKHDTLCSTKKIWLEMDTLRFEKGKQVQMKY 4244
            PKKK   +    S+  +  K +  +L G +    + K + I +WPEW++ D+N EKWD P KT +  K         LF+DPEG ++LPSSL++  WKR  E+  K  PV+V   E    FD+ S NEHLF SE MRWII + + LW    K C          +   +       W+ WEHIYSL K GK   P YN  GKY++KL+W+G WRKI VDD LPFD+++ LLLP TT  +ELWP++L+K +LK+AS     S +  EFG+F++IH LTGWIP+   +   Y  +I + L   +  +    E           S+ E I   + N++   +K                                  +     P+ +V ASY        +  ML  ++MA   E+LR+ G+  ++SHPV+L   RD PL        +P WKLIRP  + +I             + K    QK +Q  +IE+ +PFIN+KL        +     K +++ NL +            +++ D+E+    + N  NS + L      Q+P E      S  NE +          + +D+E+    K                   L+K+W+D+  F +CF+ L I+HK   Y        +T S+S                             +  T + D K  ++LF DN+ ++EI+I  S    W          ++   R               E+   P       G   A+   WK+      + + +T   KAV L  PPGRH L++   A    H    S+  F FG E+ ++P   +   R     + I+ A   +IS FS+ EE          L L   +   +  +  +  +VFS+ +           LTS+ +FA++ +  D   +                                 S + L    + +E    + G  ++ ++M   I LQ   KGY VR+++ A  P +  +  V   L ++   +E +  +   +LL  +      I++ Y    D+ N I F ++    + +  N + ++FRE+F +     K   ++ K+   +  C L +INND  EK    +   +    + PN  GYT +A   T DV  +   W++++I G+   LP   +   CNDFS+ +++ YY+P +  ++   + K+  DH  +V  + S  +V ++LSI + ++E+   +G G   I  +  L          + ++ +R        +E+V    +      +         +KY I+A V   +W L +    F+ KL+  +R  M  +   D                                   IL GT  P+ T     +   S P ST+                        +  K HWT  ++SD     NI++ K+ E+ + + + K  W   +  R  K  Q +++Y
Sbjct:    5 PKKKASASSLVASSPGHSPKKEASSLVGASESPVESKKSLISLWPEWNDTDVNAEKWDAP-KTPKDSK---------LFDDPEGKVELPSSLRIHTWKRPSEFILKKIPVVV---ENADTFDLTSANEHLFSSELMRWIISECHILW----KVCNTREDKVVSTETVPTL------WKPWEHIYSLCKAGKDHMPLYNTYGKYVIKLYWLGSWRKITVDDMLPFDKDNNLLLPATTNQSELWPMLLAKGILKVASTDTPVSGSGREFGEFTIIHCLTGWIPEMIPLKSWYTGKIWDFLRDNVAQFQLEEE-----------SSEEKITITDSNVNNVQSKSP------------------------------KSRATGSVPQIVVCASYQPLHLMEKRTSML--TRMADSSESLRQYGLSQLFSHPVLLTCTRDCPLVAPPKTPPLPQWKLIRPRKQTNITD-----------EPKEPPVQKPEQ--FIEVSSPFINFKLMTMSAHDMEHGGLKKRMYNSNLTSF-----------SEMEDTEDEHIQNDNIQNSTNTLQTNENTQVPAEDKKKDNSIANEGVESTAAPDKETDRKDKEKVQTGKESSAGLLQSQDALASNKPLLLKTWVDLHNFTKCFQTLLIFHKPNMYPHQFKTSHFTNSISSRLSAAALSYTVASTHSVAALPKQSDLTGNIHTQSADGKGTYFLFADNLLSTEIVIGFSALVHWG---------ESVEERK--------------ESSTRP-------GSLTAKPFSWKSIISKLPVVQIQTTACKAVLLSLPPGRHVLQVHTNASLAVHLHLCSKFPFVFGDEETVMPYLDKESLRFCEQAVTIVRALGCVISCFSDPEE----------LPLTTKELEKAHGMGIKQQRVFSEAVYHMFFSALGRKLTSEELFAVQTLTGDPSPH--------------------------------GSNEKLLEARSADETPEGWTGRQATDKEMQAAIVLQAGWKGYLVREILTAARPGTKENVIVAKTLQEMWASVESDVEKHAVSLLRHMVTNGEGIAELYPCREDECNRITFTDY-SVPVPETTNSWILIFREVFRVS----KNMLLVPKMFSPIPVCILHVINNDTLEKIPR-VFNNVEPYMYTPNKGGYTFVAEAHTGDVPVIGGKWRMRLI-GSREPLPLLARGAPCNDFSVKELKGYYIPNQKNIICRHVVKVSSDHKATVQCQTSKSDVYIKLSILDHEKEVASCQGKGHVIIPVYCFL----ASNGSSVAQAEARQDQGSLTAEERV--TGAGGGKEGNDQHPTDTLFHKYYIQAEVLQESWPLDEALSSFIQKLRDEERNEM--RVFGD-----------------------------------ILDGTSMPVGTDQQNREGQKSTPKSTHKAKEKEKDKDKLALKSSSIMDLNLDVSKPHWTLRVVSDQSEAGNIEVKKDTERLEEIRAMKLAWESAEPGRAVKAHQSRLRY 1304          
BLAST of Androglobin vs. Ensembl Zebrafish
Match: capn7 (calpain 7 [Source:ZFIN;Acc:ZDB-GENE-111111-1])

HSP 1 Score: 68.5514 bits (166), Expect = 4.966e-11
Identity = 40/100 (40.00%), Postives = 57/100 (57.00%), Query Frame = 3
Query:  597 IYSLNKVGKGFPQYNPAGKYIVKLFWMGDWRKILVDDTLPFDENDRLLLPVTTITNELWPXXXXXXXXXXXXXXYNFSSNETEFGDFSVIHSLTGWIPQK 896
            IY  N+  KG P+YNP GKY+VKL   G  RK+++DD LP D N  LL   ++  NELW + L +         Y+F  + +       +H+LTGWIP++
Sbjct:  317 IYPQNR--KGEPEYNPCGKYMVKLHINGVPRKVIIDDFLPVDRNGELLCSYSSNRNELW-VSLIEKAYMKVMGGYDFPGSNSNID----LHALTGWIPER 409          
BLAST of Androglobin vs. Ensembl Xenopus
Match: cyp20a1 (cytochrome P450 family 20 subfamily A member 1 [Source:Xenbase;Acc:XB-GENE-988532])

HSP 1 Score: 66.6254 bits (161), Expect = 3.264e-10
Identity = 40/100 (40.00%), Postives = 56/100 (56.00%), Query Frame = 3
Query:  597 IYSLNKVGKGFPQYNPAGKYIVKLFWMGDWRKILVDDTLPFDENDRLLLPVTTITNELWPXXXXXXXXXXXXXXYNFSSNETEFGDFSVIHSLTGWIPQK 896
            IY  NK  KG P+YNP GKY+VKL   G  RK+++DD LP D +  LL   +   NELW + L +         Y+F  + +       +H+LTGWIP++
Sbjct:  315 IYPQNK--KGEPEYNPCGKYMVKLHINGVPRKVIIDDFLPVDHSGELLCSYSNNKNELW-VSLIEKAYMKVMGGYDFPGSNSNID----LHALTGWIPER 407          
BLAST of Androglobin vs. Ensembl Xenopus
Match: cyp20a1 (cytochrome P450 family 20 subfamily A member 1 [Source:Xenbase;Acc:XB-GENE-988532])

HSP 1 Score: 66.6254 bits (161), Expect = 3.415e-10
Identity = 40/100 (40.00%), Postives = 56/100 (56.00%), Query Frame = 3
Query:  597 IYSLNKVGKGFPQYNPAGKYIVKLFWMGDWRKILVDDTLPFDENDRLLLPVTTITNELWPXXXXXXXXXXXXXXYNFSSNETEFGDFSVIHSLTGWIPQK 896
            IY  NK  KG P+YNP GKY+VKL   G  RK+++DD LP D +  LL   +   NELW + L +         Y+F  + +       +H+LTGWIP++
Sbjct:  306 IYPQNK--KGEPEYNPCGKYMVKLHINGVPRKVIIDDFLPVDHSGELLCSYSNNKNELW-VSLIEKAYMKVMGGYDFPGSNSNID----LHALTGWIPER 398          
BLAST of Androglobin vs. Ensembl Xenopus
Match: cyp20a1 (cytochrome P450 family 20 subfamily A member 1 [Source:Xenbase;Acc:XB-GENE-988532])

HSP 1 Score: 66.6254 bits (161), Expect = 3.449e-10
Identity = 40/100 (40.00%), Postives = 56/100 (56.00%), Query Frame = 3
Query:  597 IYSLNKVGKGFPQYNPAGKYIVKLFWMGDWRKILVDDTLPFDENDRLLLPVTTITNELWPXXXXXXXXXXXXXXYNFSSNETEFGDFSVIHSLTGWIPQK 896
            IY  NK  KG P+YNP GKY+VKL   G  RK+++DD LP D +  LL   +   NELW + L +         Y+F  + +       +H+LTGWIP++
Sbjct:  322 IYPQNK--KGEPEYNPCGKYMVKLHINGVPRKVIIDDFLPVDHSGELLCSYSNNKNELW-VSLIEKAYMKVMGGYDFPGSNSNID----LHALTGWIPER 414          
BLAST of Androglobin vs. Ensembl Xenopus
Match: cyp20a1 (cytochrome P450 family 20 subfamily A member 1 [Source:Xenbase;Acc:XB-GENE-988532])

HSP 1 Score: 66.6254 bits (161), Expect = 3.478e-10
Identity = 40/100 (40.00%), Postives = 56/100 (56.00%), Query Frame = 3
Query:  597 IYSLNKVGKGFPQYNPAGKYIVKLFWMGDWRKILVDDTLPFDENDRLLLPVTTITNELWPXXXXXXXXXXXXXXYNFSSNETEFGDFSVIHSLTGWIPQK 896
            IY  NK  KG P+YNP GKY+VKL   G  RK+++DD LP D +  LL   +   NELW + L +         Y+F  + +       +H+LTGWIP++
Sbjct:  308 IYPQNK--KGEPEYNPCGKYMVKLHINGVPRKVIIDDFLPVDHSGELLCSYSNNKNELW-VSLIEKAYMKVMGGYDFPGSNSNID----LHALTGWIPER 400          
BLAST of Androglobin vs. Ensembl Mouse
Match: Adgb (androglobin [Source:MGI Symbol;Acc:MGI:3605549])

HSP 1 Score: 259.996 bits (663), Expect = 1.639e-69
Identity = 271/1093 (24.79%), Postives = 477/1093 (43.64%), Query Frame = 3
Query: 1167 GKNLNENPETLVIASYNSSF---NKLQMLSTSKMASRYEALRKIGMPSIYSHPVILNYYRDSPLEKSISPELIPSWKLIRPFIKVDIPQLNDCTTHSAYFDSKNVSNQKDDQSKYIEIQTPFINYKLSKKNNSTKEIFDENLENLKIIPHCTSKS---NNQIMDSENMGSLDSNFGN---SNSKLQI------PCE-----------FSYENEVLNL------RDEERYDFSKGLMKS-WIDVDTFFECFEVLYIYHKTETYRYTESLSDFKTTNIDQKEPFYLFTDNIDNSEIIICLSVFCKWFTHNDPYYLPDNANNRNSPSINIVRDKSNNLENDNDPFATDQIQGVFFAENHYWKNFKIGKCLKRAKTNGTKAVSLKFPPGRHCLRIFIQALNGFHCKFISQNQFFFGTEDEIIPLAVECPKRIQSLGIDIISAFKNMISNFSNDEERKSNEIALNNL-ILDFSKNSHSRALTSEFTQVFSQGIIKTIKMCNRELLTSDMIFALRAIILDFQSYITLTIXXXXXXXXXXXXAKIPPINSKIDNRKQSSTKSLTNIENKEEKRNEFFGDYSSRDMLYIIRLQKLIKGYYVRKVIMARSPRSNYHDRVVNELNKIKTLIEHNSSEIGNNLLNEIFEIYPQISKHYGLDNDQLNHIKFQEFKGNGILQPVNGFGMLFREIFHIDPLTKKTDDILIKLNCNVQKCTLSIINNDNGEKTTEIILKRLNFKAFVPNSNGYTLIATTKDVENVVP---WKLKIIGGANNLLPTFIKQELCNDFSIFKIRDYYVPEEDGLLFHQIAKIKLDHPISVFVKLSNPNVSLRLSIYNFDEELYFVEGIGEAYIESFLLLKDYFC-----EEQVDLVRSGSRNS----TKLKKGQEKVERYXXXXXXXXXXX------------------XXEGKKVYKYSIRASVNNSTWLLSQDNEEFVNXXXXXXRKNMNEQTLNDNPSKLIQSSEFTKKENVQKI-LPKT--KTKERGQEGVKILKGTEKPITKNNPVDNNTSRPNSTYFESDKQHWTALIISDTCLEDNIQIYKNNEKHDTLCSTKKIWLEMDTLRFEKGKQVQMKY 4244
            G +  + P  +V A++   +   NK+   S  KMA+  E LR+ G+  I SHPV++   R  PL     P  +P+WKLIR   +  I             ++++   +K +Q  ++EI +PF+NY+++     T+  F +++   K  P  +S      N ++ S + G +    GN    N  LQI      P E            S + ++++L      + +E    ++G+ K  W+D + F  CF  +YI+HK  +Y      S+FK   ++++ P+YLF D++   E+++C S   +W                          +S  L  D+ P       G+  AE   WK+ K    + R  T  TKA  ++ P GRH L     +  G      S   F  G ED ++P       R     I I+ A  N+I+NF +  +  +   AL +L    +    +++ LT++  +VF   + + +K        S+  FA RA++ D     + +                      +   +    K  T I  KE         Y+S ++   +++Q + KG YVR ++ AR P +  +  V + L KI  ++E N  +   +LL  +F+   +  + Y    D+   + F +   N   QP N + ++FREIF    L  +   IL K+   +  C L +INND  E+  ++  K + F  +  N  GYT +A     +  V    WKL++IG  N  LP   +   CN FSI +IRDYY+P +  +LF    K+ +   I++ V+ S P+  ++L +   +E +    G G+A I +F  L +         +QV L     +      TK K GQ   + +  ++ G  +                    S+  ++ YKY I+  V  ++W L++    FV  LK +++ ++ E+  ++ P+ +         E  + + +PKT  K KE+  E  K+ K  + P  +   V   T+  +S   + +K +W   ++S+    D + + K+ E+ D + + K+ W   +  R  K  Q ++KY
Sbjct:  384 GSSAIQLPHMVVYATFTPLYLFENKI--FSLEKMANSAEKLREYGLSHICSHPVLVTRSRSCPLVSPPKPPPLPAWKLIRHKKETVITD-----------EAQDAVPKKPEQ--FLEISSPFLNYRMTPFTIPTETHFVQSVIK-KGTPLGSSLPPLVENDLVASTSQGEMSIVNGNQSQGNIALQITLGKDEPSEPALADFHQLEATSLDRDLISLTTATLDKSQEELAINEGVAKEIWLDFEDFCVCFHHIYIFHKPHSYCLNFQKSEFKF--VEERVPYYLFVDSLKPIELLVCFSALVRW-------------------------GESGALTKDSPPVEP----GLLTAEAITWKSLKPLSVVLRIHTYATKASVVRLPAGRHMLLFNAYSPVGHAIHVCSMTTFVIGDEDIVLPNFEPESYRFTEQSIIIMKAIGNVIANFKDKGKLPA---ALRDLQAAHYPIPLNNKELTAQHFRVFHISLWRLMKKSQVAKPPSNFKFAFRAMVFDTDLLDSFS--------------------EDVSLAEWVDLKYSTPINEKE---------YTSEEIAAAVKIQSMWKGCYVRLLMKARKPETKENVTVADTLQKIWAVLEMNLEQYALSLLRLMFKSKCKSMESYPCYQDEETKLAFADHTVNYADQPPNSWFIVFREIF----LVPQDMIILPKVYTTLPICILHVINNDTLEQVPKVFQKVVPF-LYTKNKKGYTFVAEAYTGDTFVSGARWKLRLIGSYNP-LPFLARDSPCNTFSIKEIRDYYIPNDRKILFRYSIKVTVAQSITIQVRTSKPDTFIKLQVLESEEVITSTVGKGQAVIPAFYFLGNEKALSSQSSKQVLLSHPSPKKDPEVLTKKKSGQPGQKSFKGRSGGGLTDTGMPLLEEEILNIPTLEENSSTPQQCYKYIIQCLVLFNSWPLNETQLTFVQALKDMEKMDIKEK--HEEPAPMGSPDSHAVSEGQKSVGVPKTTRKGKEKSAEKEKLAKEKQAPRFEPQQVQMPTAV-HSQQEDPNKPYWILRLVSEHTDSDYVDVKKDTERADEIRAMKQAWETTEPGRAIKAAQARLKY 1388          

HSP 2 Score: 211.46 bits (537), Expect = 1.686e-54
Identity = 129/309 (41.75%), Postives = 185/309 (59.87%), Query Frame = 3
Query:   60 LPKKKEERNKSAQSNSPYHKKLKEGTLTGMNSDGKHARIGIWPEWSEIDINNEKWDIPLKTKEKDK-ARSPLMTQNLFEDPEGLLKLPSSLKVFKWKRTYEY-FTKNPVIVDTEEGIHKFDIFSLNEHLFISETMRWIICQINNLWITSEKKCAXXXXXXXXXXXXXXXNGTHHTWRFWEHIYSLNKVGKG-FPQYNPAGKYIVKLFWMGDWRKILVDDTLPFDENDRLLLPVTTITNELWPXXXXXXXXXXXXXXYNFSSNETEFGDFSVIHSLTGWIPQKKIVSKEYRNQIVNDLSKLLNHWTYSNE 977
            +  K+ +R +  + NS +     +  +   + + K  +  IWPEWSE DIN EKWD     KEKDK A+SP+   + FEDPEG ++LP SLKVF WKR  ++ F++ PV+V  E     FD+FS NEHL  SE MRWII +I  +W               + ++ I        W+ WEHIYSL K  KG  P +N  GKY+VKL+WMG WRKI VDD LPFDE + LLLP T+   ELWP++LSKA++K+A++  +  ++  E G+ +VIH+LTGW+P+   +   Y +++   L ++L  +  + E
Sbjct:    1 MASKQAKRKEVHRINSAHGSDKSKDNVPPGSFEQKKGKFPIWPEWSEADINAEKWDAGKGGKEKDKTAKSPIF--HFFEDPEGKIELPQSLKVFSWKRPQDFIFSRTPVVVKNE---ITFDLFSPNEHLLCSELMRWIISEIYAVWKIFNGGILSNYHKGNLGELPIL------PWKPWEHIYSLCKAVKGHVPLFNSYGKYVVKLYWMGCWRKITVDDFLPFDEENNLLLPATSYEFELWPMLLSKAIIKLANVDVHV-AHRRELGELTVIHALTGWLPEVIPLHPAYVDRVWELLKEILPEFKLTEE 297          
BLAST of Androglobin vs. Ensembl Mouse
Match: Adgb (androglobin [Source:MGI Symbol;Acc:MGI:3605549])

HSP 1 Score: 258.455 bits (659), Expect = 4.332e-69
Identity = 270/1086 (24.86%), Postives = 474/1086 (43.65%), Query Frame = 3
Query: 1188 PETLVIASYNSSF---NKLQMLSTSKMASRYEALRKIGMPSIYSHPVILNYYRDSPLEKSISPELIPSWKLIRPFIKVDIPQLNDCTTHSAYFDSKNVSNQKDDQSKYIEIQTPFINYKLSKKNNSTKEIFDENLENLKIIPHCTSKS---NNQIMDSENMGSLDSNFGN---SNSKLQI------PCE-----------FSYENEVLNL------RDEERYDFSKGLMKS-WIDVDTFFECFEVLYIYHKTETYRYTESLSDFKTTNIDQKEPFYLFTDNIDNSEIIICLSVFCKWFTHNDPYYLPDNANNRNSPSINIVRDKSNNLENDNDPFATDQIQGVFFAENHYWKNFKIGKCLKRAKTNGTKAVSLKFPPGRHCLRIFIQALNGFHCKFISQNQFFFGTEDEIIPLAVECPKRIQSLGIDIISAFKNMISNFSNDEERKSNEIALNNL-ILDFSKNSHSRALTSEFTQVFSQGIIKTIKMCNRELLTSDMIFALRAIILDFQSYITLTIXXXXXXXXXXXXAKIPPINSKIDNRKQSSTKSLTNIENKEEKRNEFFGDYSSRDMLYIIRLQKLIKGYYVRKVIMARSPRSNYHDRVVNELNKIKTLIEHNSSEIGNNLLNEIFEIYPQISKHYGLDNDQLNHIKFQEFKGNGILQPVNGFGMLFREIFHIDPLTKKTDDILIKLNCNVQKCTLSIINNDNGEKTTEIILKRLNFKAFVPNSNGYTLIATTKDVENVVP---WKLKIIGGANNLLPTFIKQELCNDFSIFKIRDYYVPEEDGLLFHQIAKIKLDHPISVFVKLSNPNVSLRLSIYNFDEELYFVEGIGEAYIESFLLLKDYFC-----EEQVDLVRSGSRNS----TKLKKGQEKVERYXXXXXXXXXXX------------------XXEGKKVYKYSIRASVNNSTWLLSQDNEEFVNXXXXXXRKNMNEQTLNDNPSKLIQSSEFTKKENVQKI-LPKT--KTKERGQEGVKILKGTEKPITKNNPVDNNTSRPNSTYFESDKQHWTALIISDTCLEDNIQIYKNNEKHDTLCSTKKIWLEMDTLRFEKGKQVQMKY 4244
            P  +V A++   +   NK+   S  KMA+  E LR+ G+  I SHPV++   R  PL     P  +P+WKLIR   +  I             ++++   +K +Q  ++EI +PF+NY+++     T+  F +++   K  P  +S      N ++ S + G +    GN    N  LQI      P E            S + ++++L      + +E    ++G+ K  W+D + F  CF  +YI+HK  +Y      S+FK   ++++ P+YLF D++   E+++C S   +W                          +S  L  D+ P       G+  AE   WK+ K    + R  T  TKA  ++ P GRH L     +  G      S   F  G ED ++P       R     I I+ A  N+I+NF +  +  +   AL +L    +    +++ LT++  +VF   + + +K        S+  FA RA++ D     + +                      +   +    K  T I  KE         Y+S ++   +++Q + KG YVR ++ AR P +  +  V + L KI  ++E N  +   +LL  +F+   +  + Y    D+   + F +   N   QP N + ++FREIF    L  +   IL K+   +  C L +INND  E+  ++  K + F  +  N  GYT +A     +  V    WKL++IG  N  LP   +   CN FSI +IRDYY+P +  +LF    K+ +   I++ V+ S P+  ++L +   +E +    G G+A I +F  L +         +QV L     +      TK K GQ   + +  ++ G  +                    S+  ++ YKY I+  V  ++W L++    FV  LK +++ ++ E+  ++ P+ +         E  + + +PKT  K KE+  E  K+ K  + P  +   V   T+  +S   + +K +W   ++S+    D + + K+ E+ D + + K+ W   +  R  K  Q ++KY
Sbjct:  415 PHMVVYATFTPLYLFENKI--FSLEKMANSAEKLREYGLSHICSHPVLVTRSRSCPLVSPPKPPPLPAWKLIRHKKETVITD-----------EAQDAVPKKPEQ--FLEISSPFLNYRMTPFTIPTETHFVQSVIK-KGTPLGSSLPPLVENDLVASTSQGEMSIVNGNQSQGNIALQITLGKDEPSEPALADFHQLEATSLDRDLISLTTATLDKSQEELAINEGVAKEIWLDFEDFCVCFHHIYIFHKPHSYCLNFQKSEFKF--VEERVPYYLFVDSLKPIELLVCFSALVRW-------------------------GESGALTKDSPPVEP----GLLTAEAITWKSLKPLSVVLRIHTYATKASVVRLPAGRHMLLFNAYSPVGHAIHVCSMTTFVIGDEDIVLPNFEPESYRFTEQSIIIMKAIGNVIANFKDKGKLPA---ALRDLQAAHYPIPLNNKELTAQHFRVFHISLWRLMKKSQVAKPPSNFKFAFRAMVFDTDLLDSFS--------------------EDVSLAEWVDLKYSTPINEKE---------YTSEEIAAAVKIQSMWKGCYVRLLMKARKPETKENVTVADTLQKIWAVLEMNLEQYALSLLRLMFKSKCKSMESYPCYQDEETKLAFADHTVNYADQPPNSWFIVFREIF----LVPQDMIILPKVYTTLPICILHVINNDTLEQVPKVFQKVVPF-LYTKNKKGYTFVAEAYTGDTFVSGARWKLRLIGSYNP-LPFLARDSPCNTFSIKEIRDYYIPNDRKILFRYSIKVTVAQSITIQVRTSKPDTFIKLQVLESEEVITSTVGKGQAVIPAFYFLGNEKALSSQSSKQVLLSHPSPKKDPEVLTKKKSGQPGQKSFKGRSGGGLTDTGMPLLEEEILNIPTLEENSSTPQQCYKYIIQCLVLFNSWPLNETQLTFVQALKDMEKMDIKEK--HEEPAPMGSPDSHAVSEGQKSVGVPKTTRKGKEKSAEKEKLAKEKQAPRFEPQQVQMPTAV-HSQQEDPNKPYWILRLVSEHTDSDYVDVKKDTERADEIRAMKQAWETTEPGRAIKAAQARLKY 1412          

HSP 2 Score: 211.075 bits (536), Expect = 2.440e-54
Identity = 125/277 (45.13%), Postives = 172/277 (62.09%), Query Frame = 3
Query:  156 DGKHARIGIWPEWSEIDINNEKWDIPLKTKEKDK-ARSPLMTQNLFEDPEGLLKLPSSLKVFKWKRTYEY-FTKNPVIVDTEEGIHKFDIFSLNEHLFISETMRWIICQINNLWITSEKKCAXXXXXXXXXXXXXXXNGTHHTWRFWEHIYSLNKVGKG-FPQYNPAGKYIVKLFWMGDWRKILVDDTLPFDENDRLLLPVTTITNELWPXXXXXXXXXXXXXXYNFSSNETEFGDFSVIHSLTGWIPQKKIVSKEYRNQIVNDLSKLLNHWTYSNE 977
            + K  +  IWPEWSE DIN EKWD     KEKDK A+SP+   + FEDPEG ++LP SLKVF WKR  ++ F++ PV+V  E     FD+FS NEHL  SE MRWII +I  +W               + ++ I        W+ WEHIYSL K  KG  P +N  GKY+VKL+WMG WRKI VDD LPFDE + LLLP T+   ELWP++LSKA++K+A++  +  ++  E G+ +VIH+LTGW+P+   +   Y +++   L ++L  +  + E
Sbjct:   39 EQKKGKFPIWPEWSEADINAEKWDAGKGGKEKDKTAKSPIF--HFFEDPEGKIELPQSLKVFSWKRPQDFIFSRTPVVVKNE---ITFDLFSPNEHLLCSELMRWIISEIYAVWKIFNGGILSNYHKGNLGELPIL------PWKPWEHIYSLCKAVKGHVPLFNSYGKYVVKLYWMGCWRKITVDDFLPFDEENNLLLPATSYEFELWPMLLSKAIIKLANVDVHV-AHRRELGELTVIHALTGWLPEVIPLHPAYVDRVWELLKEILPEFKLTEE 303          
BLAST of Androglobin vs. Ensembl Mouse
Match: Adgb (androglobin [Source:MGI Symbol;Acc:MGI:3605549])

HSP 1 Score: 255.758 bits (652), Expect = 3.401e-68
Identity = 269/1088 (24.72%), Postives = 473/1088 (43.47%), Query Frame = 3
Query: 1188 PETLVIASYNSSF---NKLQMLSTSKMASRYEALRKIGMPSIYSHPVILNYYRDSPLEKSISPELIPSWKLIRPFIKVDIPQLNDCTTHSAYFDSKNVSNQKDDQSKYIEIQTPFINYKLSKKNNSTKEIFDENLENLKIIPHCTSKS---NNQIMDSENMGSLDSNFGN---SNSKLQI--------PCE-----------FSYENEVLNL------RDEERYDFSKGLMKS-WIDVDTFFECFEVLYIYHKTETYRYTESLSDFKTTNIDQKEPFYLFTDNIDNSEIIICLSVFCKWFTHNDPYYLPDNANNRNSPSINIVRDKSNNLENDNDPFATDQIQGVFFAENHYWKNFKIGKCLKRAKTNGTKAVSLKFPPGRHCLRIFIQALNGFHCKFISQNQFFFGTEDEIIPLAVECPKRIQSLGIDIISAFKNMISNFSNDEERKSNEIALNNL-ILDFSKNSHSRALTSEFTQVFSQGIIKTIKMCNRELLTSDMIFALRAIILDFQSYITLTIXXXXXXXXXXXXAKIPPINSKIDNRKQSSTKSLTNIENKEEKRNEFFGDYSSRDMLYIIRLQKLIKGYYVRKVIMARSPRSNYHDRVVNELNKIKTLIEHNSSEIGNNLLNEIFEIYPQISKHYGLDNDQLNHIKFQEFKGNGILQPVNGFGMLFREIFHIDPLTKKTDDILIKLNCNVQKCTLSIINNDNGEKTTEIILKRLNFKAFVPNSNGYTLIATTKDVENVVP---WKLKIIGGANNLLPTFIKQELCNDFSIFKIRDYYVPEEDGLLFHQIAKIKLDHPISVFVKLSNPNVSLRLSIYNFDEELYFVEGIGEAYIESFLLLKDYFC-----EEQVDLVRSGSRNS----TKLKKGQEKVERYXXXXXXXXXXX------------------XXEGKKVYKYSIRASVNNSTWLLSQDNEEFVNXXXXXXRKNMNEQTLNDNPSKLIQSSEFTKKENVQKI-LPKT--KTKERGQEGVKILKGTEKPITKNNPVDNNTSRPNSTYFESDKQHWTALIISDTCLEDNIQIYKNNEKHDTLCSTKKIWLEMDTLRFEKGKQVQMKY 4244
            P  +V A++   +   NK+   S  KMA+  E LR+ G+  I SHPV++   R  PL     P  +P+WKLIR   +  I             ++++   +K +Q  ++EI +PF+NY+++     T+  F +++   K  P  +S      N ++ S + G +    GN    N  LQI        P E            S + ++++L      + +E    ++G+ K  W+D + F  CF  +YI+HK  +Y      S+FK   ++++ P+YLF D++   E+++C S   +W                          +S  L  D+ P       G+  AE   WK+ K    + R  T  TKA  ++ P GRH L     +  G      S   F  G ED ++P       R     I I+ A  N+I+NF +  +  +   AL +L    +    +++ LT++  +VF   + + +K        S+  FA RA++ D     + +                      +   +    K  T I  KE         Y+S ++   +++Q + KG YVR ++ AR P +  +  V + L KI  ++E N  +   +LL  +F+   +  + Y    D+   + F +   N   QP N + ++FREIF    L  +   IL K+   +  C L +INND  E+  ++  K + F  +  N  GYT +A     +  V    WKL++IG  N  LP   +   CN FSI +IRDYY+P +  +LF    K+ +   I++ V+ S P+  ++L +   +E +    G G+A I +F  L +         +QV L     +      TK K GQ   + +  ++ G  +                    S+  ++ YKY I+  V  ++W L++    FV  LK +++ ++  +  ++ P+ +         E  + + +PKT  K KE+  E  K+ K  + P  +   V   T+  +S   + +K +W   ++S+    D + + K+ E+ D + + K+ W   +  R  K  Q ++KY
Sbjct:  415 PHMVVYATFTPLYLFENKI--FSLEKMANSAEKLREYGLSHICSHPVLVTRSRSCPLVSPPKPPPLPAWKLIRHKKETVITD-----------EAQDAVPKKPEQ--FLEISSPFLNYRMTPFTIPTETHFVQSVIK-KGTPLGSSLPPLVENDLVASTSQGEMSIVNGNQSQGNIALQITLGKGKDEPSEPALADFHQLEATSLDRDLISLTTATLDKSQEELAINEGVAKEIWLDFEDFCVCFHHIYIFHKPHSYCLNFQKSEFKF--VEERVPYYLFVDSLKPIELLVCFSALVRW-------------------------GESGALTKDSPPVEP----GLLTAEAITWKSLKPLSVVLRIHTYATKASVVRLPAGRHMLLFNAYSPVGHAIHVCSMTTFVIGDEDIVLPNFEPESYRFTEQSIIIMKAIGNVIANFKDKGKLPA---ALRDLQAAHYPIPLNNKELTAQHFRVFHISLWRLMKKSQVAKPPSNFKFAFRAMVFDTDLLDSFS--------------------EDVSLAEWVDLKYSTPINEKE---------YTSEEIAAAVKIQSMWKGCYVRLLMKARKPETKENVTVADTLQKIWAVLEMNLEQYALSLLRLMFKSKCKSMESYPCYQDEETKLAFADHTVNYADQPPNSWFIVFREIF----LVPQDMIILPKVYTTLPICILHVINNDTLEQVPKVFQKVVPF-LYTKNKKGYTFVAEAYTGDTFVSGARWKLRLIGSYNP-LPFLARDSPCNTFSIKEIRDYYIPNDRKILFRYSIKVTVAQSITIQVRTSKPDTFIKLQVLESEEVITSTVGKGQAVIPAFYFLGNEKALSSQSSKQVLLSHPSPKKDPEVLTKKKSGQPGQKSFKGRSGGGLTDTGMPLLEEEILNIPTLEENSSTPQQCYKYIIQCLVLFNSWPLNETQLTFVQALKDMEKMDIKAEK-HEEPAPMGSPDSHAVSEGQKSVGVPKTTRKGKEKSAEKEKLAKEKQAPRFEPQQVQMPTAV-HSQQEDPNKPYWILRLVSEHTDSDYVDVKKDTERADEIRAMKQAWETTEPGRAIKAAQARLKY 1415          

HSP 2 Score: 211.075 bits (536), Expect = 2.152e-54
Identity = 125/277 (45.13%), Postives = 172/277 (62.09%), Query Frame = 3
Query:  156 DGKHARIGIWPEWSEIDINNEKWDIPLKTKEKDK-ARSPLMTQNLFEDPEGLLKLPSSLKVFKWKRTYEY-FTKNPVIVDTEEGIHKFDIFSLNEHLFISETMRWIICQINNLWITSEKKCAXXXXXXXXXXXXXXXNGTHHTWRFWEHIYSLNKVGKG-FPQYNPAGKYIVKLFWMGDWRKILVDDTLPFDENDRLLLPVTTITNELWPXXXXXXXXXXXXXXYNFSSNETEFGDFSVIHSLTGWIPQKKIVSKEYRNQIVNDLSKLLNHWTYSNE 977
            + K  +  IWPEWSE DIN EKWD     KEKDK A+SP+   + FEDPEG ++LP SLKVF WKR  ++ F++ PV+V  E     FD+FS NEHL  SE MRWII +I  +W               + ++ I        W+ WEHIYSL K  KG  P +N  GKY+VKL+WMG WRKI VDD LPFDE + LLLP T+   ELWP++LSKA++K+A++  +  ++  E G+ +VIH+LTGW+P+   +   Y +++   L ++L  +  + E
Sbjct:   39 EQKKGKFPIWPEWSEADINAEKWDAGKGGKEKDKTAKSPIF--HFFEDPEGKIELPQSLKVFSWKRPQDFIFSRTPVVVKNE---ITFDLFSPNEHLLCSELMRWIISEIYAVWKIFNGGILSNYHKGNLGELPIL------PWKPWEHIYSLCKAVKGHVPLFNSYGKYVVKLYWMGCWRKITVDDFLPFDEENNLLLPATSYEFELWPMLLSKAIIKLANVDVHV-AHRRELGELTVIHALTGWLPEVIPLHPAYVDRVWELLKEILPEFKLTEE 303          
BLAST of Androglobin vs. Ensembl Mouse
Match: Adgb (androglobin [Source:MGI Symbol;Acc:MGI:3605549])

HSP 1 Score: 207.608 bits (527), Expect = 5.592e-55
Identity = 125/275 (45.45%), Postives = 171/275 (62.18%), Query Frame = 3
Query:  162 KHARIGIWPEWSEIDINNEKWDIPLKTKEKDK-ARSPLMTQNLFEDPEGLLKLPSSLKVFKWKRTYEY-FTKNPVIVDTEEGIHKFDIFSLNEHLFISETMRWIICQINNLWITSEKKCAXXXXXXXXXXXXXXXNGTHHTWRFWEHIYSLNKVGKG-FPQYNPAGKYIVKLFWMGDWRKILVDDTLPFDENDRLLLPVTTITNELWPXXXXXXXXXXXXXXYNFSSNETEFGDFSVIHSLTGWIPQKKIVSKEYRNQIVNDLSKLLNHWTYSNE 977
            K  +  IWPEWSE DIN EKWD     KEKDK A+SP+   + FEDPEG ++LP SLKVF WKR  ++ F++ PV+V  E     FD+FS NEHL  SE MRWII +I  +W               + ++ I        W+ WEHIYSL K  KG  P +N  GKY+VKL+WMG WRKI VDD LPFDE + LLLP T+   ELWP++LSKA++K+A++  +  ++  E G+ +VIH+LTGW+P+   +   Y +++   L ++L  +  + E
Sbjct:   41 KKGKFPIWPEWSEADINAEKWDAGKGGKEKDKTAKSPIF--HFFEDPEGKIELPQSLKVFSWKRPQDFIFSRTPVVVKNEI---TFDLFSPNEHLLCSELMRWIISEIYAVWKIFNGGILSNYHKGNLGELPIL------PWKPWEHIYSLCKAVKGHVPLFNSYGKYVVKLYWMGCWRKITVDDFLPFDEENNLLLPATSYEFELWPMLLSKAIIKLANVDVHV-AHRRELGELTVIHALTGWLPEVIPLHPAYVDRVWELLKEILPEFKLTEE 303          

HSP 2 Score: 93.5893 bits (231), Expect = 1.020e-18
Identity = 97/378 (25.66%), Postives = 166/378 (43.92%), Query Frame = 3
Query: 1188 PETLVIASYNSSF---NKLQMLSTSKMASRYEALRKIGMPSIYSHPVILNYYRDSPLEKSISPELIPSWKLIRPFIKVDIPQLNDCTTHSAYFDSKNVSNQKDDQSKYIEIQTPFINYKLSKKNNSTKEIFDENLENLKIIPHCTSKS---NNQIMDSENMGSLDSNFGN---SNSKLQI------PCE-----------FSYENEVLNL------RDEERYDFSKGLMKS-WIDVDTFFECFEVLYIYHKTETYRYTESLSDFKTTNIDQKEPFYLFTDNIDNSEIIICLSVFCKWFTHNDPYYLPDNANNRNSPSINIVRDKSNNLENDNDPFATDQIQGVFFAENHYWKNFKIGKCLKRAKTNGTKAVSLKFPPG 2222
            P  +V A++   +   NK+   S  KMA+  E LR+ G+  I SHPV++   R  PL     P  +P+WKLIR   +  I             ++++   +K +Q  ++EI +PF+NY+++     T+  F +++   K  P  +S      N ++ S + G +    GN    N  LQI      P E            S + ++++L      + +E    ++G+ K  W+D + F  CF  +YI+HK  +Y      S+FK   ++++ P+YLF D++   E+++C S   +W                          +S  L  D+ P       G+  AE   WK+ K    + R  T  TKA  ++ P G
Sbjct:  415 PHMVVYATFTPLYLFENKI--FSLEKMANSAEKLREYGLSHICSHPVLVTRSRSCPLVSPPKPPPLPAWKLIRHKKETVITD-----------EAQDAVPKKPEQ--FLEISSPFLNYRMTPFTIPTETHFVQSVIK-KGTPLGSSLPPLVENDLVASTSQGEMSIVNGNQSQGNIALQITLGKDEPSEPALADFHQLEATSLDRDLISLTTATLDKSQEELAINEGVAKEIWLDFEDFCVCFHHIYIFHKPHSYCLNFQKSEFKF--VEERVPYYLFVDSLKPIELLVCFSALVRW-------------------------GESGALTKDSPPVEP----GLLTAEAITWKSLKPLSVVLRIHTYATKASVVRLPAG 745          
BLAST of Androglobin vs. Ensembl Mouse
Match: Adgb (androglobin [Source:MGI Symbol;Acc:MGI:3605549])

HSP 1 Score: 95.9005 bits (237), Expect = 1.911e-20
Identity = 99/395 (25.06%), Postives = 172/395 (43.54%), Query Frame = 3
Query: 1161 FDGKNLNENPETLVIASYNSSF---NKLQMLSTSKMASRYEALRKIGMPSIYSHPVILNYYRDSPLEKSISPELIPSWKLIRPFIKVDIPQLNDCTTHSAYFDSKNVSNQKDDQSKYIEIQTPFINYKLSKKNNSTKEIFDENLENLKIIPHCTSKS---NNQIMDSENMGSLDSNFGN---SNSKLQI------PCE-----------FSYENEVLNL------RDEERYDFSKGLMKS-WIDVDTFFECFEVLYIYHKTETYRYTESLSDFKTTNIDQKEPFYLFTDNIDNSEIIICLSVFCKWFTHNDPYYLPDNANNRNSPSINIVRDKSNNLENDNDPFATDQIQGVFFAENHYWKNFKIGKCLKRAKTNGTKAVSLKFPPGRHCLRIFI 2246
            + G +  + P  +V A++   +   NK+   S  KMA+  E LR+ G+  I SHPV++   R  PL     P  +P+WKLIR   +  I             ++++   +K +Q  ++EI +PF+NY+++     T+  F +++   K  P  +S      N ++ S + G +    GN    N  LQI      P E            S + ++++L      + +E    ++G+ K  W+D + F  CF  +YI+HK  +Y      S+FK   ++++ P+YLF D++   E+++C S   +W                          +S  L  D+ P       G+  AE   WK+ K    + R  T  TKA  ++ P G      F+
Sbjct:    8 WKGSSAIQLPHMVVYATFTPLYLFENKI--FSLEKMANSAEKLREYGLSHICSHPVLVTRSRSCPLVSPPKPPPLPAWKLIRHKKETVITD-----------EAQDAVPKKPEQ--FLEISSPFLNYRMTPFTIPTETHFVQSVIK-KGTPLGSSLPPLVENDLVASTSQGEMSIVNGNQSQGNIALQITLGKDEPSEPALADFHQLEATSLDRDLISLTTATLDKSQEELAINEGVAKEIWLDFEDFCVCFHHIYIFHKPHSYCLNFQKSEFKF--VEERVPYYLFVDSLKPIELLVCFSALVRW-------------------------GESGALTKDSPPVE----PGLLTAEAITWKSLKPLSVVLRIHTYATKASVVRLPAGYGLTSCFL 355          
BLAST of Androglobin vs. UniProt/SwissProt
Match: sp|G3UZ78|ADGB_MOUSE (Androglobin OS=Mus musculus OX=10090 GN=Adgb PE=1 SV=1)

HSP 1 Score: 258.455 bits (659), Expect = 3.031e-68
Identity = 270/1086 (24.86%), Postives = 474/1086 (43.65%), Query Frame = 3
Query: 1188 PETLVIASYNSSF---NKLQMLSTSKMASRYEALRKIGMPSIYSHPVILNYYRDSPLEKSISPELIPSWKLIRPFIKVDIPQLNDCTTHSAYFDSKNVSNQKDDQSKYIEIQTPFINYKLSKKNNSTKEIFDENLENLKIIPHCTSKS---NNQIMDSENMGSLDSNFGN---SNSKLQI------PCE-----------FSYENEVLNL------RDEERYDFSKGLMKS-WIDVDTFFECFEVLYIYHKTETYRYTESLSDFKTTNIDQKEPFYLFTDNIDNSEIIICLSVFCKWFTHNDPYYLPDNANNRNSPSINIVRDKSNNLENDNDPFATDQIQGVFFAENHYWKNFKIGKCLKRAKTNGTKAVSLKFPPGRHCLRIFIQALNGFHCKFISQNQFFFGTEDEIIPLAVECPKRIQSLGIDIISAFKNMISNFSNDEERKSNEIALNNL-ILDFSKNSHSRALTSEFTQVFSQGIIKTIKMCNRELLTSDMIFALRAIILDFQSYITLTIXXXXXXXXXXXXAKIPPINSKIDNRKQSSTKSLTNIENKEEKRNEFFGDYSSRDMLYIIRLQKLIKGYYVRKVIMARSPRSNYHDRVVNELNKIKTLIEHNSSEIGNNLLNEIFEIYPQISKHYGLDNDQLNHIKFQEFKGNGILQPVNGFGMLFREIFHIDPLTKKTDDILIKLNCNVQKCTLSIINNDNGEKTTEIILKRLNFKAFVPNSNGYTLIATTKDVENVVP---WKLKIIGGANNLLPTFIKQELCNDFSIFKIRDYYVPEEDGLLFHQIAKIKLDHPISVFVKLSNPNVSLRLSIYNFDEELYFVEGIGEAYIESFLLLKDYFC-----EEQVDLVRSGSRNS----TKLKKGQEKVERYXXXXXXXXXXX------------------XXEGKKVYKYSIRASVNNSTWLLSQDNEEFVNXXXXXXRKNMNEQTLNDNPSKLIQSSEFTKKENVQKI-LPKT--KTKERGQEGVKILKGTEKPITKNNPVDNNTSRPNSTYFESDKQHWTALIISDTCLEDNIQIYKNNEKHDTLCSTKKIWLEMDTLRFEKGKQVQMKY 4244
            P  +V A++   +   NK+   S  KMA+  E LR+ G+  I SHPV++   R  PL     P  +P+WKLIR   +  I             ++++   +K +Q  ++EI +PF+NY+++     T+  F +++   K  P  +S      N ++ S + G +    GN    N  LQI      P E            S + ++++L      + +E    ++G+ K  W+D + F  CF  +YI+HK  +Y      S+FK   ++++ P+YLF D++   E+++C S   +W                          +S  L  D+ P       G+  AE   WK+ K    + R  T  TKA  ++ P GRH L     +  G      S   F  G ED ++P       R     I I+ A  N+I+NF +  +  +   AL +L    +    +++ LT++  +VF   + + +K        S+  FA RA++ D     + +                      +   +    K  T I  KE         Y+S ++   +++Q + KG YVR ++ AR P +  +  V + L KI  ++E N  +   +LL  +F+   +  + Y    D+   + F +   N   QP N + ++FREIF    L  +   IL K+   +  C L +INND  E+  ++  K + F  +  N  GYT +A     +  V    WKL++IG  N  LP   +   CN FSI +IRDYY+P +  +LF    K+ +   I++ V+ S P+  ++L +   +E +    G G+A I +F  L +         +QV L     +      TK K GQ   + +  ++ G  +                    S+  ++ YKY I+  V  ++W L++    FV  LK +++ ++ E+  ++ P+ +         E  + + +PKT  K KE+  E  K+ K  + P  +   V   T+  +S   + +K +W   ++S+    D + + K+ E+ D + + K+ W   +  R  K  Q ++KY
Sbjct:  415 PHMVVYATFTPLYLFENKI--FSLEKMANSAEKLREYGLSHICSHPVLVTRSRSCPLVSPPKPPPLPAWKLIRHKKETVITD-----------EAQDAVPKKPEQ--FLEISSPFLNYRMTPFTIPTETHFVQSVIK-KGTPLGSSLPPLVENDLVASTSQGEMSIVNGNQSQGNIALQITLGKDEPSEPALADFHQLEATSLDRDLISLTTATLDKSQEELAINEGVAKEIWLDFEDFCVCFHHIYIFHKPHSYCLNFQKSEFKF--VEERVPYYLFVDSLKPIELLVCFSALVRW-------------------------GESGALTKDSPPVEP----GLLTAEAITWKSLKPLSVVLRIHTYATKASVVRLPAGRHMLLFNAYSPVGHAIHVCSMTTFVIGDEDIVLPNFEPESYRFTEQSIIIMKAIGNVIANFKDKGKLPA---ALRDLQAAHYPIPLNNKELTAQHFRVFHISLWRLMKKSQVAKPPSNFKFAFRAMVFDTDLLDSFS--------------------EDVSLAEWVDLKYSTPINEKE---------YTSEEIAAAVKIQSMWKGCYVRLLMKARKPETKENVTVADTLQKIWAVLEMNLEQYALSLLRLMFKSKCKSMESYPCYQDEETKLAFADHTVNYADQPPNSWFIVFREIF----LVPQDMIILPKVYTTLPICILHVINNDTLEQVPKVFQKVVPF-LYTKNKKGYTFVAEAYTGDTFVSGARWKLRLIGSYNP-LPFLARDSPCNTFSIKEIRDYYIPNDRKILFRYSIKVTVAQSITIQVRTSKPDTFIKLQVLESEEVITSTVGKGQAVIPAFYFLGNEKALSSQSSKQVLLSHPSPKKDPEVLTKKKSGQPGQKSFKGRSGGGLTDTGMPLLEEEILNIPTLEENSSTPQQCYKYIIQCLVLFNSWPLNETQLTFVQALKDMEKMDIKEK--HEEPAPMGSPDSHAVSEGQKSVGVPKTTRKGKEKSAEKEKLAKEKQAPRFEPQQVQMPTAV-HSQQEDPNKPYWILRLVSEHTDSDYVDVKKDTERADEIRAMKQAWETTEPGRAIKAAQARLKY 1412          

HSP 2 Score: 211.075 bits (536), Expect = 1.707e-53
Identity = 125/277 (45.13%), Postives = 172/277 (62.09%), Query Frame = 3
Query:  156 DGKHARIGIWPEWSEIDINNEKWDIPLKTKEKDK-ARSPLMTQNLFEDPEGLLKLPSSLKVFKWKRTYEY-FTKNPVIVDTEEGIHKFDIFSLNEHLFISETMRWIICQINNLWITSEKKCAXXXXXXXXXXXXXXXNGTHHTWRFWEHIYSLNKVGKG-FPQYNPAGKYIVKLFWMGDWRKILVDDTLPFDENDRLLLPVTTITNELWPXXXXXXXXXXXXXXYNFSSNETEFGDFSVIHSLTGWIPQKKIVSKEYRNQIVNDLSKLLNHWTYSNE 977
            + K  +  IWPEWSE DIN EKWD     KEKDK A+SP+   + FEDPEG ++LP SLKVF WKR  ++ F++ PV+V  E     FD+FS NEHL  SE MRWII +I  +W               + ++ I        W+ WEHIYSL K  KG  P +N  GKY+VKL+WMG WRKI VDD LPFDE + LLLP T+   ELWP++LSKA++K+A++  +  ++  E G+ +VIH+LTGW+P+   +   Y +++   L ++L  +  + E
Sbjct:   39 EQKKGKFPIWPEWSEADINAEKWDAGKGGKEKDKTAKSPIF--HFFEDPEGKIELPQSLKVFSWKRPQDFIFSRTPVVVKNE---ITFDLFSPNEHLLCSELMRWIISEIYAVWKIFNGGILSNYHKGNLGELPIL------PWKPWEHIYSLCKAVKGHVPLFNSYGKYVVKLYWMGCWRKITVDDFLPFDEENNLLLPATSYEFELWPMLLSKAIIKLANVDVHV-AHRRELGELTVIHALTGWLPEVIPLHPAYVDRVWELLKEILPEFKLTEE 303          
BLAST of Androglobin vs. UniProt/SwissProt
Match: sp|Q8N7X0|ADGB_HUMAN (Androglobin OS=Homo sapiens OX=9606 GN=ADGB PE=2 SV=3)

HSP 1 Score: 220.705 bits (561), Expect = 1.548e-56
Identity = 246/1065 (23.10%), Postives = 442/1065 (41.50%), Query Frame = 3
Query: 1236 QMLSTSKMASRYEALRKIGMPSIYSHPVILNYYRDSPLEKSISPELIPSWKLIRPFIKVDIPQLNDCTTHSAYFDSKNVSNQKDDQSKYIEIQTPFINYKLSKKNNSTKEIFDENLENLKIIPHCTSKSNNQIMDSENMGSLD-------SNFGNSNSKLQI------PCEF----SYENEVLNLRDEERYDFSKGLMKS---------------WIDVDTFFECFEVLYIYHKTETYRYTESLSDFKTTNIDQKEPFYLFTDNIDNSEIIICLSVFCKWFTHNDPYYLPDNANNRNSPSINIVRDKSNNLENDNDPFATDQIQGVFFAENHYWKNFKIGKCLKRAKTNGTKAVSLKFPPGRHCLRIFIQALNGFHCKFISQNQFFFGTEDEIIPLAVECPKRIQSLGIDIISAFKNMISNFSNDEERKSNEIALNNL-ILDFSKNSHSRALTSEFTQVFSQGIIKTIKMCNRELLTSDMIFALRAIILDFQSYITLTIXXXXXXXXXXXXAKIPPINSKIDNRKQSSTKSLTNIENKEEKRNEFFGDYSSRDMLYIIRLQKLIKGYYVRKVIMARSPRSNYHDRVVNELNKIKTLIEHNSSEIGNNLLNEIFEIYPQISKHYGLDNDQLNHIKFQEFKGNGILQPVNGFGMLFREIFHIDPLTKKTDDILI-KLNCNVQKCTLSIINNDNGEKTTEIILKRLNFKAFVPNSNGYTLIATTKDVENVVP---WKLKIIGGANNLLPTFIKQELCNDFSIFKIRDYYVPEEDGLLFHQIAKIKLDHPISVFVKLSNPNVSLRLSIYNFDEELYFVEGIGEAYIESFLLLKDYFCEEQVDLVRSGSRNSTKLKKGQEK-VERYXXXXXXXXXXXXXEGKKV-------------------------------YKYSIRASVNNSTWLLSQDNEEFVNXXXXXXRKNM------NEQTLNDNPSKLIQSSEFTKKENVQKILPKTKTKERGQEGVKILKGTEKP-----ITKNNPVDNNTSRPNSTYFESDKQHWTALIISDTCLEDNIQIYKNNEKHDTLCSTKKIW 4190
            ++ S  KMA   E LR+ G+  I SHPV++   R  PL     P  +P WKLIR   +  I             +++ +  +K +  +++EI +PF+NY+++     T+  F  +L    I P     S ++  ++      D       ++ GN+ S++ +        +F    +++++ LNL  E     +    KS               W+D + F  CF+ +YI+HK  +Y      S+FK +  +++  +YLF D++   E+++C S   +W  +         A  ++SP I                       G+  AE   WK+ K G  + +  T  TKA  ++ P GRH L     +  G      S   F  G E  ++P       R     + I+ A  N+I+NF +  +  +   AL +L    +    H + LT++  +VF   + + +K         +  FA RA++LD +                        +NS ++         +       +K      +YS+ ++   I++Q + +G YVR ++ AR P +  +  V + L K+  ++E N  +   +LL  +F+   +  + Y    D+   I F ++      QP N + ++FRE F +       D IL+ K+   +  C L I+NND  E+  ++  K + +  +  N  GYT +A     +  V    WKL++IG +  L P   +   CN F+I +IRDYY+P +  +LF    K+    P ++ V+ S P+  ++L +   +E +    G G+A I +F     +F + +  L    S++        +K  E Y  K +      S +G+ V                               YKY I+ SV  ++W L++    FV  LK LK+ N       +E+ +N         SE  K     K     K KE+  E  K  K  + P     I+  +P   + ++P          +W   ++++    +  ++ K+ E+ D + + K+ W
Sbjct:  430 KIFSLEKMADSAEKLREYGLSHICSHPVLVTRSRSCPLVAPPKPPPLPPWKLIRQKKETVITD-----------EAQELIVKKPE--RFLEISSPFLNYRMTPFTIPTEMHFVRSLIKKGIPPGSDLPSVSETDETATHSQTDLSQITKATSQGNTASQVILGKGTDEQTDFGLGDAHQSDGLNLEREIVSQTTATQEKSQEELPTTNNSVSKEIWLDFEDFCVCFQNIYIFHKPSSYCLNFQKSEFKFS--EERVSYYLFVDSLKPIELLVCFSALVRWGEYG--------ALTKDSPPIE---------------------PGLLTAETFSWKSLKPGSLVLKIHTYATKATVVRLPVGRHMLLFNAYSPVGHSIHICSMVSFVIGDEHVVLPNFEPESCRFTEQSLLIMKAIGNVIANFKDKGKLSA---ALKDLQTAHYPVPFHDKELTAQHFRVFHLSLWRLMKKVQITKPPPNFKFAFRAMVLDLEL-----------------------LNSSLEEVSLVEWLDVKYCMPTSDK------EYSAEEVAAAIKIQAMWRGTYVRLLMKARIPDTKENISVADTLQKVWAVLEMNLEQYAVSLLRLMFKSKCKSLESYPCYQDEETKIAFADYTVTYQEQPPNSWFIVFRETFLVH-----QDMILVPKVYTTLPICILHIVNNDTMEQVPKVFQKVVPY-LYTKNKKGYTFVAEAFTGDTYVAASRWKLRLIGSSAPL-PCLSRDSPCNSFAIKEIRDYYIPNDKKILFRYSVKVLTPQPATIQVRTSKPDAFIKLQVLENEETMVSSTGKGQAIIPAF-----HFLKSEKGLSSQSSKHILSFHSASKKEQEVYVKKKAAQGIQKSPKGRAVSAIQDIGLPLVEEETTSTPTREDSSSTPLQNYKYIIQCSVLYNSWPLTESQLTFVQALKDLKKSNTKAYGERHEELINLGSPDSHTISEGQKSSVTSKTT--RKGKEKSSEKEKTAKEKQAPRFEPQISTVHPQQEDPNKP----------YWILRLVTEHNESELFEVKKDTERADEIRAMKQAW 1394          

HSP 2 Score: 213.001 bits (541), Expect = 3.771e-54
Identity = 125/287 (43.55%), Postives = 177/287 (61.67%), Query Frame = 3
Query:  150 NSDGKHARIGIWPEWSEIDINNEKWDIPLKTKEKDK-ARSPLMTQNLFEDPEGLLKLPSSLKVFKWKRTYE-YFTKNPVIVDTEEGIHKFDIFSLNEHLFISETMRWIICQINNLWITSEKKCAXXXXXXXXXXXXXXXNGTHH-----TWRFWEHIYSLNKVGKG-FPQYNPAGKYIVKLFWMGDWRKILVDDTLPFDENDRLLLPVTTITNELWPXXXXXXXXXXXXXXYNFSSNETEFGDFSVIHSLTGWIPQKKIVSKEYRNQIVNDLSKLLNHWTYSNENCN 986
            +++ K  +  +WPEWSE DIN+EKWD     KEKDK  +SP+   + FEDPEG ++LP SLK++ WKR  +  F++ PV+V  E     FD+FS NEHL  SE MRWII +I  +W                  +S    GT        W+ WEHIYSL K  KG  P +N  GKY+VKL+WMG WRKI +DD LPFDE++ LLLP TT   ELWP++LSKA++K+A++  +  ++  E G+F+VIH+LTGW+P+   +   Y +++   L ++L  +  S+E  +
Sbjct:   37 STEQKKGKFPLWPEWSEADINSEKWDAGKGAKEKDKTGKSPVF--HFFEDPEGKIELPPSLKIYSWKRPQDILFSQTPVVVKNE---ITFDLFSANEHLLCSELMRWIISEIYAVW-----------KIFNGGILSNYFKGTSGEPPLLPWKPWEHIYSLCKAVKGHMPLFNSYGKYVVKLYWMGCWRKITIDDFLPFDEDNNLLLPATTYEFELWPMLLSKAIIKLANIDIHV-ADRRELGEFTVIHALTGWLPEVISLHPGYMDKVWELLKEILPEFKLSDEASS 306          
BLAST of Androglobin vs. UniProt/SwissProt
Match: sp|Q9R1S8|CAN7_MOUSE (Calpain-7 OS=Mus musculus OX=10090 GN=Capn7 PE=2 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 1.131e-8
Identity = 38/100 (38.00%), Postives = 55/100 (55.00%), Query Frame = 3
Query:  597 IYSLNKVGKGFPQYNPAGKYIVKLFWMGDWRKILVDDTLPFDENDRLLLPVTTITNELWPXXXXXXXXXXXXXXYNFSSNETEFGDFSVIHSLTGWIPQK 896
            IY  NK G+  P+YNP GKY+VKL   G  RK+++DD LP D    LL   +   +ELW + L +         Y+F  + +       +H+LTGWIP++
Sbjct:  315 IYPQNKDGE--PEYNPCGKYMVKLHLNGVPRKVIIDDQLPVDHKGELLCSYSNNKSELW-VSLIEKAYMKVMGGYDFPGSNSNID----LHALTGWIPER 407          
BLAST of Androglobin vs. UniProt/SwissProt
Match: sp|Q9Y6W3|CAN7_HUMAN (Calpain-7 OS=Homo sapiens OX=9606 GN=CAPN7 PE=1 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 1.284e-8
Identity = 38/100 (38.00%), Postives = 55/100 (55.00%), Query Frame = 3
Query:  597 IYSLNKVGKGFPQYNPAGKYIVKLFWMGDWRKILVDDTLPFDENDRLLLPVTTITNELWPXXXXXXXXXXXXXXYNFSSNETEFGDFSVIHSLTGWIPQK 896
            IY  NK G+  P+YNP GKY+VKL   G  RK+++DD LP D    LL   +   +ELW + L +         Y+F  + +       +H+LTGWIP++
Sbjct:  315 IYPQNKDGE--PEYNPCGKYMVKLHLNGVPRKVIIDDQLPVDHKGELLCSYSNNKSELW-VSLIEKAYMKVMGGYDFPGSNSNID----LHALTGWIPER 407          
BLAST of Androglobin vs. UniProt/SwissProt
Match: sp|A0FKG7|CAN7_PIG (Calpain-7 OS=Sus scrofa OX=9823 GN=CAPN7 PE=2 SV=1)

HSP 1 Score: 61.2326 bits (147), Expect = 8.253e-8
Identity = 37/100 (37.00%), Postives = 54/100 (54.00%), Query Frame = 3
Query:  597 IYSLNKVGKGFPQYNPAGKYIVKLFWMGDWRKILVDDTLPFDENDRLLLPVTTITNELWPXXXXXXXXXXXXXXYNFSSNETEFGDFSVIHSLTGWIPQK 896
            IY  NK G+   +YNP GKY+VKL   G  RK+++DD LP D    LL   +   +ELW + L +         Y+F  + +       +H+LTGWIP++
Sbjct:  315 IYPQNKDGES--EYNPCGKYMVKLHLNGVPRKVIIDDQLPVDHKGELLCSYSNNKSELW-VSLIEKAYMKVMGGYDFPGSNSNID----LHALTGWIPER 407          
BLAST of Androglobin vs. TrEMBL
Match: A0A1L8G7V6 (Calpain catalytic domain-containing protein OS=Xenopus laevis OX=8355 GN=XELAEV_18026747mg PE=3 SV=1)

HSP 1 Score: 468.389 bits (1204), Expect = 1.043e-135
Identity = 397/1425 (27.86%), Postives = 659/1425 (46.25%), Query Frame = 3
Query:  162 KHARIGIWPEWSEIDINNEKWDIPLKTKEKDKARSPLMTQNLFEDPEGLLKLPSSLKVFKWKRTYEYFTKNPVIVDTEEGIHKFDIFSLNEHLFISETMRWIICQINNLWITSEKKCAXXXXXXXXXXXXXXXNGTHHTWRFWEHIYSLNKVGKG-FPQYNPAGKYIVKLFWMGDWRKILVDDTLPFDENDRLLLPVTTITNELWPXXXXXXXXXXXXXXYNFSSNETEFGDFSVIHSLTGWIPQKKIVSKEYRNQIVNDLSKLLNHWTYSNENCNLTGDKNDISNVEDIQHIEVNLD-----------KTDNKE-----ILLXXXXXXXXXXXXXXXXXXXXXXXXXXLFDGKNLNENPETLVIASYNS---SFNKLQMLSTSKMASRYEALRKIGMPSIYSHPVILNYYRDSPLEKSISPELIPSWKLIRPFIKVDIPQLNDCTTHSAYFDSKNVSNQKDDQSKYIEIQTPFINYKLSKKN-------------------------NSTKEIFDEN--LENLKIIPHCTSKSNNQIMDSENMGSLDSNFGNSNSKLQIPCEFSYENEVLNLRDEERYDFSKGL--MKSWIDVDTFFECFEVLYIYHKTETYRYTESLSDFKTTNIDQKEPFYLFTDNIDNSEIIICLSVFCKWFTHNDPYYLPDNANNRNSPSINIVRDKSNNLENDNDPFATDQ--IQGVFFAENHYWKNFKIGKCLKRAKTNGTKAVSLKFPPGRHCLRIFIQALNGFHCKFISQNQFFFGTEDEIIPLAVECPKRIQSLGIDIISAFKNMISNFSNDEERKSNEIALNNLILD-FSKNSHSRALTSEFTQVFSQGIIKTIKMCNRELLTSDMIFALRAIILDFQSYITLTIXXXXXXXXXXXXAKIPPINSKIDNRKQSSTKSLTNIENKEEKRNEFFGDYSSRDMLYIIRLQKLIKGYYVRKVIMARSPRSNYHDRVVNELNKIKTLIEHNSSEIGNNLLNEIFEIYPQISKHYGLDNDQLNHIKFQEFKGNGILQPVNGFGMLFREIFHIDPLTKKTDDILI--KLNCNVQKCTLSIINNDNGEKTTEIILKRLNFKAFVPNSNGYTLIATTKDVENVVP---WKLKIIGGANNLLPTFIKQELCNDFSIFKIRDYYVPEEDGLLFHQIAKIKLDHPISVFVKLSNPNVSLRLSIYNFDEELYFVEGIGEAYIESFLLLKD-----YFCEEQVDLV------RSGSRNSTKLKKGQEKV--ERYXXXXXXXXXXXXXEGKKV----YKYSIRASVNNSTWLLSQDNEEFVNXXXXXXRKNMNEQTLNDNPSKLIQSSEFTKKENVQKILPKTKTKERGQEGVKILKGTEKPITKNNPVDN----NTSRPNSTY----FESDKQHWTALIISDTCLEDNIQIYKNNEKHDTLCSTKKIW 4190
            K  ++ IWPEW++ DIN+EKWD    TKEK+K       Q+ F+DPEG ++LP++LK+  WKR +E+    P +V  +E    FD+FS N+HL  SE MRWII ++N +W           +   I + + + + T   W+ WEHIY+L K  KG  P YN  GKYIVKLFWMG WRKI+VDDT PF E+++LLLP TT   ELWPL+LSKA++K+AS++ N  +   E G+F+V+HSLTGW+ +   +   Y N++ + L  ++  +T  +E              ++I+  EV +D           +  NKE         +K K  +  +  +   E      +   D   +   P+ +V ASY+    S +K  +L   +MA   E LR+ G+  IY+HPV++   R  PL  S  P  +P WKLIRP  ++ +             ++K    ++ +Q  ++EI TPF+N++L+  N                         N T+E  + N  +++L++     +++++ I D+  +    ++    N+ L +    S +      ++ E     K L   ++W+D   F +CF+ LY++HK  TY YT   SDFKTT  D++  +YL  DN+  +E+++  S    W                                  + PF  +    + +  AE   WKN   G  + +  T  TK+  +  PPGRH LR    +  G H    S   F FG E+ ++P   +   R       I+ A   + + FSN+ E      AL  L L  + +   S  L  E  Q+F   + +         +T D+IFA RA+ LDF   +T          ++    +IPP                       +KR     D +S++    ++LQ   +G Y+RK   +R   +     V   L K++  +E N+ + G +LL  +F+ +   S  Y    D+   I F +F  +   QP N + +L RE+F++       +D+LI  K+   +  C L +I+ND  E+    +  ++    +  N  GYT +A     +  +     +L++I GA   LP+  +  + N+FS+ +IRDYY+P ++ ++F    K  ++H  ++ V+ S P+   ++ I +  EEL    G G+A I +   L +      F  +   L+      R  S  STK  K + +V  + +  +    + + + E K      +KY ++A+V   +W L++    F+        +++ +Q   D   K    ++F+     QK     KT ++G+E     K TEKP       +      TSRP S       ES K  W   ++S+    D +++ K+ E+ D + + K+ W
Sbjct:   41 KKGKVTIWPEWNDSDINSEKWDSGKGTKEKEKTGKIPALQHFFDDPEGKIELPANLKIHSWKRPHEFIASMPPVVVKDET--SFDLFSANKHLTGSELMRWIISEVNAVW--------KIYNTNLINNKASTQDPTSLVWKPWEHIYALCKAAKGHMPLYNSYGKYIVKLFWMGSWRKIVVDDTFPFSEDNKLLLPATTCETELWPLLLSKAIIKLASINTNGFAKR-ELGEFTVLHSLTGWLLEVIPLENNYLNEVWDLLKGIVPEYTLPDEENPDAKSPTTDDKSKEIKPPEVKIDGPVIPVIIKPPEKSNKEQRDAGKKKGEKEKIRSASHSARPASELSNPLLQSTQDCSMVQMTPQMVVYASYSPLQLSEHKTSVL--GQMADSSEKLRQYGLSHIYNHPVLVTRTRSCPLVGSPKPPPVPRWKLIRPKKEITVTD-----------EAKEPVEKQPEQ--FVEISTPFLNFRLNSINVPTEVSKVQTSPSRSSLAAFSLASLNETEENVESNNIIKSLQLCAGDETEASSIIKDATGLNK-GTDGVTENTPLDMCTSMSNQPTHGIEKNPENKVMEKKLPPTQTWMDFSDFCKCFQTLYVFHKPNTYPYTCRKSDFKTT--DERGFYYLHIDNLKPTEVLVSFSALAHW---------------------------------GDSPFTEEPGLQKSLLTAEQFSWKNVCTGPVVLKIHTYVTKSTMISLPPGRHVLRFTASSPFGHHIHLCSTEPFVFGDEETVMPYLEKESCRFMEQVKHILKAVWKVFNTFSNENELSQ---ALKELELAVYPQKRGSLQLAKEHFQIFKTALWQVFVEAMGSKVTQDLIFAFRALTLDFDLVLT---------KNTDTKYEIPP---------------------SWQKR-----DATSQEEAAAMKLQACWRGIYIRKFGQSRKAGTKEKSCVQETLEKVRNALEPNAEQHGISLLRYMFK-HSSSSCEYSCSEDERYRISFSDFTISYNDQPANSWFVLSREVFNV------CEDMLIVPKIYTTIPVCVLHVIDNDTLEEMP-WVFNKVAPHIYTKNKKGYTFVAEAHSGDFSISSGKCRLRLI-GACKPLPSLSRDAVTNNFSVKEIRDYYLPNDNNIIFRYAVKTSVEHMATIQVQTSKPDAYFKIQILDNGEELVSATGKGQAVIPAVCFLPNERPLSAFSSKSQTLLNGTKKGRVTSGGSTKNSKMRTEVISDPHQEEGQNVSENENPEIKTTPLARHKYIVQATVLYKSWPLTESQAAFI--------ESLKDQEKLDMKDKHEDMTDFSSSNESQKSFGTPKTAKKGKE-----KATEKPDKSAKERERLQSAGTSRPESRVAQQQLESHKPWWVLRLVSEGSEADTVEVKKDTERIDEIRAMKQAW 1343          
BLAST of Androglobin vs. TrEMBL
Match: A0A0K1NWP2 (Androglobin OS=Callorhinchus milii OX=7868 PE=2 SV=1)

HSP 1 Score: 454.521 bits (1168), Expect = 1.387e-130
Identity = 407/1490 (27.32%), Postives = 687/1490 (46.11%), Query Frame = 3
Query:   57 MLPKKKEERNKSAQSNSPY-HKKLKEGTL-------TGMNSDGKHARIGIWPEWSEIDINNEKWDIPLKTKEKDK-ARSPLMTQNLFEDPEGLLKLPSSLKVFKWKRTYEYFT-KNPVIVDTEEGIHKFDIFSLNEHLFISETMRWIICQINNLWITSEKKCAXXXXXXXXXXXXXXXNGTHHTWRFWEHIYSLNKVGKG-FPQYNPAGKYIVKLFWMGDWRKILVDDTLPFDENDRLLLPVTTITNELWPXXXXXXXXXXXXXXYNFSSNETEFGDFSVIHSLTGWIPQKKIVSKEYRNQIVNDLSKLLNHWTYSNENCNLTGDKNDISNVEDIQHIEVNLD------------------------KTDNKEILLXXXXXXXXXXXXXXXXXXXXXXXXXXLFDGKNLNENPETLVIASYNSSFNKLQMLSTSKMASRYEALRKIGMPSIYSHPVILNYYRDSPLEKSISPELIPSWKLIRPFIKVDIPQLNDCTTHSAYFDSKNVSNQKDDQSKYIEIQTPFI-------NYKLSKKNNSTKEIFDENLE-NLKIIPHCTSKSNNQIMDSENMGSLDSNFGNSNSKLQIPCEFSYENEVLNLRDEERYDFSKGLM-------------------KSWIDVDTFFECFEVLYIYHKTETYRYTESLSDFKTTNIDQKEPFYLFTDNIDNSEIIICLSVFCKWFTHNDPYYLPDNANNRNSPSINIVRDKSNNLENDNDPFATDQIQGVFFAENHYWKNFKIGKCLKRAKTNGTKAVSLKFPPGRHCLRIFIQALNGFHCKFISQNQFFFGTEDEIIP-LAVECPKRIQSLGIDIISAFKNMISNFSNDEERKSNEIALNNLILDFSKNSHSRALTSEFTQVFSQGIIKTIKMCNRELLTSDMIFALRAIILDFQSYITLTIXXXXXXXXXXXXAKIPPINSKIDNRKQSSTKSLTNIENKEEKRNEFFGDYSSRDMLYIIRLQKLIKGYYVRKVIMARSPRSNYHDRVVNELNKIKTLIEHNSSEIGNNLLNEIFEIYPQISKHYGLDNDQLNHIKFQEFKGNGILQPVNGFGMLFREIFHIDPLTKKTDDILI--KLNCNVQKCTLSIINNDNGEKTTEIILKRLNFKAFVPNSNGYTLIATTKDVENVV---PWKLKIIGGANNLLPTFIKQELCNDFSIFKIRDYYVPEEDGLLFHQIAKIKLDHPISVFVKLSNPNVSLRLSIYNFDEELYFVEGIGEAYIESFLLLKD--------------YFCEEQVDLVRSGSRNSTKLKKGQ----------EKVERYXXXXXXXXXXXXXEGKKVYKYSIRASVNNSTWLLSQDNEEFVNXXXXXXRKNMN--EQTLNDNPSKLIQSSEFTKKENVQKILPKTKTKERGQEGVKILKGTEKPITKNNPVDNNTSRPNSTYFESDKQHWTALIISDTCLEDNIQIYKNNEKHDTLCSTKKIWLEMDTLRFEKGKQVQMKY 4244
            M+   K+ +NK  ++N P  H   K+ T        TG   + +  R  +WPEWSE DIN+E+WD   K KEKDK A+SP +  +LF+DPEG +++P SL V  WKR +E+ + + PV+V+ E     FD+   ++    SE MRWII  I +LW  S      ++            + +  +W+ WEHIYSL K  KG  PQYN  GKY+VKLFWMG WRKI+VDDT+PFD++D LLLP TTIT+ELWP++LSKAL+KIAS+  N + N+ E GDF+VIH+L GW P+   ++K Y ++I   L +L+  +  + ++ +        S V+D++ +EV  +                        K  NKE+       +  K                 + +   +   P+ +V ASY  S  +LQ     KM    E LR  G  S+YSH V+++  R  PL+    P  IP WKLIRP          + T  SA  + +    +K DQ  ++EI +PFI       N  L+ +  S+    D N E  L  IP  +  ++     S    +   +  + ++ L+   E S      +L  + R   ++ L+                   ++WID D F +CF+ L I+HK  +Y +T   SD K   ID++  +YLF DN+  +EI++  S   +W           + N    PS + V  +    E      +++ + G+  AE + W +      +   +T  TK+V L  P GRH LR    +  G H +  S   F FG E+ I+  L+ E  + +Q    +I+ A  N++++  +++E    E+ L  +      N     + +E  Q F      T+ +  R+  TS  +FA+R I  DF+     +        +     +I  +      R+ ++T      EN                    I +Q   +G++VR+++ AR P +  ++ +     ++   +E N+ + G  LL  IF+  P+I+  Y    D+     + ++      Q  N + + FRE+F+       ++D+L+  K+ C++  C L +INND G++ +++  K   F     N  GYT +A  + +   +    WKL++I G    LPT  + ++  +FS+ +I+DYYV  +  ++F    K+  +H +++  + S P V ++L I+N  +++    G G+A I +F   K+              +         R+ + ++  L+ G+           KV               +  ++ +KY I+  V N++W L+++   F+ +L+ L +  +    Q   + PS +I             + P  +++   +      K   +P ++ N +D N            K H+   I+SD    D I+I K++E+ D + + K+ W + +  R  K  Q ++KY
Sbjct:    1 MVAMSKQGKNKGHKANLPLAHLYQKDATAFVISCGGTGAIPEPRKGRYPLWPEWSEADINSERWDAG-KGKEKDKSAKSPSL--HLFDDPEGKIEMPLSLMVHTWKRPHEFISDRMPVVVENELW---FDLMPDSQRAVDSELMRWIIADITSLWKISNNSLPEKNIT----------SDSSLSWKPWEHIYSLCKAAKGHMPQYNNYGKYVVKLFWMGCWRKIIVDDTMPFDQDDNLLLPATTITSELWPMLLSKALVKIASIDMNANGNK-ELGDFTVIHALAGWNPEIIPINKNYADKIWTLLMQLVPEFKLTPDDLSEIKLNEIDSLVKDVKEVEVKSESPVINKITDKVVKGTEKQEAKDSGKKKNKEV-------EKDKNKSTVHSGRAAPIAQGSISESPAIPAFPQMVVCASY--SQIELQHAFLQKMGESSEMLRCYGFSSLYSHSVMISRTRSCPLKPPQKPPTIPRWKLIRP---------RNHTLPSA--EPREFIIKKPDQ--FVEIASPFIHELPEISNLHLNIRRPSS---IDTNKEIGLDGIPSNSQVASPSPFLSRIQWNAALDLKDESANLRYKGEVSIRGSNTSLLSDGRL-LAQPLLSMLPGSDLNMTIEKKPIGKETWIDYDDFCKCFQTLVIFHKPNSYPFTAQRSDMKP--IDERGTYYLFVDNLKPTEILVTFSALVRW----------GDINCERLPSKDKVERRDYQKE------SSNLLSGLLLAEPYSWTSLITNAPILHMRTYATKSVMLMLPEGRHVLRFIPSSPLGHHIQLCSTVSFTFGEEETILSNLSKESLRFVQQ-AQEIMKALGNVLNSCGDEQELAKAEMEL--MKAHVPPNIGKGQMLAEHMQNFQNAFYATLALALRDSYTSQDLFAIRVITQDFRVRNIFS-------ETLNYFGEIYDVPQMWKGRRPTAT------ENNA-----------------AITIQAQCRGFFVRRLLAARVPGTKDNEILKECTQRVWLTLEPNADQHGFILLRHIFKANPKIAAQYQCAGDEWTKAVYTDYVTTYADQFANSWFVPFREVFY------ASEDVLVVPKVYCSIPICALHVINNDTGKEFSKVFQKTTPF-ICTKNKKGYTFVAEARTLNMPLLSGKWKLRLI-GCQTPLPTPAR-DVNGNFSVREIKDYYVTNKKCIIFRYQVKVMANHMVTIQTQTSKPEVYIKLLIFNKGQQVAAATGKGQAIIPAFKFCKNTKLSISHSSSSKNQHVLNPTPVTKRTRTNSAANLRIGRTSPRTVIGQTSKVSVEEDSPLVAPERELSPEEEGHKYIIQGEVLNNSWTLTKNEMAFIEELQNLDKNEIKVFGQKFEEQPSAIIMD-----------VRPSFESRVSKKSKGGKEKVISRPESRVNQLDFN------------KPHYIMHIVSDQNEADMIEIKKDSERVDEIRAMKQAWEDTEPGRALKAMQSRLKY 1364          
BLAST of Androglobin vs. TrEMBL
Match: A0A4W3IEI0 (Calpain catalytic domain-containing protein OS=Callorhinchus milii OX=7868 PE=3 SV=1)

HSP 1 Score: 454.136 bits (1167), Expect = 1.393e-130
Identity = 402/1466 (27.42%), Postives = 683/1466 (46.59%), Query Frame = 3
Query:   57 MLPKKKEERNKSAQSNSPY-HKKLKEGTL-------TGMNSDGKHARIGIWPEWSEIDINNEKWDIPLKTKEKDK-ARSPLMTQNLFEDPEGLLKLPSSLKVFKWKRTYEYFT-KNPVIVDTEEGIHKFDIFSLNEHLFISETMRWIICQINNLWITSEKKCAXXXXXXXXXXXXXXXNGTHHTWRFWEHIYSLNKVGKG-FPQYNPAGKYIVKLFWMGDWRKILVDDTLPFDENDRLLLPVTTITNELWPXXXXXXXXXXXXXXYNFSSNETEFGDFSVIHSLTGWIPQKKIVSKEYRNQIVNDLSKLLNHWTYSNENCNLTGDKNDISNVEDIQHIEVNLD------------------------KTDNKEILLXXXXXXXXXXXXXXXXXXXXXXXXXXLFDGKNLNENPETLVIASYNSSFNKLQMLSTSKMASRYEALRKIGMPSIYSHPVILNYYRDSPLEKSISPELIPSWKLIRPFIKVDIPQLNDCTTHSAYFDSKNVSNQKDDQSKYIEIQTPFINYKLSKKNNSTKEIFDENLENLKIIPHCTSK---SNNQIMDSENMGSLDSNFGNSNSKLQIPCEFSYENEVLNLRDEERYDFSKGLMKSWIDVDTFFECFEVLYIYHKTETYRYTESLSDFKTTNIDQKEPFYLFTDNIDNSEIIICLSVFCKWFTHNDPYYLPDNANNRNSPSINIVRDKSNNLENDNDPFATDQIQGVFFAENHYWKNFKIGKCLKRAKTNGTKAVSLKFPPGRHCLRIFIQALNGFHCKFISQNQFFFGTEDEIIP-LAVECPKRIQSLGIDIISAFKNMISNFSNDEERKSNEIALNNLILDFSKNSHSRALTSEFTQVFSQGIIKTIKMCNRELLTSDMIFALRAIILDFQSYITLTIXXXXXXXXXXXXAKIPPINSKIDNRKQSSTKSLTNIENKEEKRNEFFGDYSSRDMLYIIRLQKLIKGYYVRKVIMARSPRSNYHDRVVNELNKIKTLIEHNSSEIGNNLLNEIFEIYPQISKHYGLDNDQLNHIKFQEFKGNGILQPVNGFGMLFREIFHIDPLTKKTDDILI--KLNCNVQKCTLSIINNDNGEKTTEIILKRLNFKAFVPNSNGYTLIATTKDVENVV---PWKLKIIGGANNLLPTFIKQELCNDFSIFKIRDYYVPEEDGLLFHQIAKIKLDHPISVFVKLSNPNVSLRLSIYNFDEELYFVEGIGEAYIESFLLLKD--------------YFCEEQVDLVRSGSRNSTKLKKGQ----------EKVERYXXXXXXXXXXXXXEGKKVYKYSIRASVNNSTWLLSQDNEEFVNXXXXXXRKNMN--EQTLNDNPSKLIQSSEFTKKENVQKILPKTKTKERGQEGVKILKGTEKPITKNNPVDNNTSRPNSTYFESDKQHWTALIISDTCLEDNIQIYKNNEKHDTLCSTKKIWLEMDTLRFEKGKQVQMKY 4244
            M+   K+ +NK  ++N P  H   K+ T        TG   + +  R  +WPEWSE DIN+E+WD   K KEKDK A+SP +  +LF+DPEG +++P SL V  WKR +E+ + + PV+V+ E     FD+   ++    SE MRWII  I +LW  S      ++            + +  +W+ WEHIYSL K  KG  PQYN  GKY+VKLFWMG WRKI+VDDT+PFD++D LLLP TTIT+ELWP++LSKAL+KIAS+  N + N+ E GDF+VIH+L GW P+   ++K Y ++I   L +L+  +  + ++ +        S V+D++ +EV  +                        K  NKE+       +  K                 + +   +   P+ +V ASY+    +LQ     KM    E LR  G  S+YSH V+++  R  PL+    P  IP WKLIRP          + T  SA  + +    +K DQ  ++EI +PFI ++L + +N    I    L  ++       K   +N +     ++   +++  +    L  P         LN+  E++    K   ++WID D F +CF+ L I+HK  +Y +T   SD K   ID++  +YLF DN+  +EI++  S   +W           + N    PS + V  +    E      +++ + G+  AE + W +      +   +T  TK+V L  P GRH LR    +  G H +  S   F FG E+ I+  L+ E  + +Q    +I+ A  N++++  +++E    E+ L  +      N     + +E  Q F      T+ +  R+  TS  +FA+R I  DF+     +        +     +I  +      R+ ++T      EN                    I +Q   +G++VR+++ AR P +  ++ +     ++   +E N+ + G  LL  IF+  P+I+  Y    D+     + ++      Q  N + + FRE+F+       ++D+L+  K+ C++  C L +INND G++ +++  K   F     N  GYT +A  + +   +    WKL++I G    LPT  + ++  +FS+ +I+DYYV  +  ++F    K+  +H +++  + S P V ++L I+N  +++    G G+A I +F   K+              +         R+ + ++  L+ G+           KV               +  ++ +KY I+  V N++W L+++   F+ +L+ L +  +    Q   + PS +I             + P  +++   +      K   +P ++ N +D N            K H+   I+SD    D I+I K++E+ D + + K+ W + +  R  K  Q ++KY
Sbjct:    1 MVAMSKQGKNKGHKANLPLAHLYQKDATAFVISCGGTGAIPEPRKGRYPLWPEWSEADINSERWDAG-KGKEKDKSAKSPSL--HLFDDPEGKIEMPLSLMVHTWKRPHEFISDRMPVVVENELW---FDLMPDSQRAVDSELMRWIIADITSLWKISNNSLPEKNIT----------SDSSLSWKPWEHIYSLCKAAKGHMPQYNNYGKYVVKLFWMGCWRKIIVDDTMPFDQDDNLLLPATTITSELWPMLLSKALVKIASIDMNANGNK-ELGDFTVIHALAGWNPEIIPINKNYADKIWTLLMQLVPEFKLTPDDLSEIKLNEIDSLVKDVKEVEVKSESPVINKITDKVVKGTEKQEAKDSGKKKNKEV-------EKDKNKSTVHSGRAAPIAQGSISESPAIPAFPQMVVCASYSQI--ELQHAFLQKMGESSEMLRCYGFSSLYSHSVMISRTRSCPLKPPQKPPTIPRWKLIRP---------RNHTLPSA--EPREFIIKKPDQ--FVEIASPFI-HELPEISNLHLNIPSPFLSRIQWNAALDLKDESANLRYKGEVSIRGSNTSLLSDGRLLAQPLLSMLPGSDLNMTIEKK-PIGK---ETWIDYDDFCKCFQTLVIFHKPNSYPFTAQRSDMKP--IDERGTYYLFVDNLKPTEILVTFSALVRW----------GDINCERLPSKDKVERRDYQKE------SSNLLSGLLLAEPYSWTSLITNAPILHMRTYATKSVMLMLPEGRHVLRFIPSSPLGHHIQLCSTVSFTFGEEETILSNLSKESLRFVQQ-AQEIMKALGNVLNSCGDEQELAKAEMEL--MKAHVPPNIGKGQMLAEHMQNFQNAFYATLALALRDSYTSQDLFAIRVITQDFRVRNIFS-------ETLNYFGEIYDVPQMWKGRRPTAT------ENNA-----------------AITIQAQCRGFFVRRLLAARVPGTKDNEILKECTQRVWLTLEPNADQHGFILLRHIFKANPKIAAQYQCAGDEWTKAVYTDYVTTYADQFANSWFVPFREVFY------ASEDVLVVPKVYCSIPICALHVINNDTGKEFSKVFQKTTPF-ICTKNKKGYTFVAEARTLNMPLLSGKWKLRLI-GCQTPLPTPAR-DVNGNFSVREIKDYYVTNKKCIIFRYQVKVMANHMVTIQTQTSKPEVYIKLLIFNKGQQVAAATGKGQAIIPAFKFCKNTKLSISHSSSSKNQHVLNPTPVTKRTRTNSAANLRIGRTSPRTVIGQTSKVSVEEDSPLVAPERELSPEEEGHKYIIQGEVLNNSWTLTKNEMAFIEELQNLDKNEIKVFGQKFEEQPSAIIMD-----------VRPSFESRVSKKSKGGKEKVISRPESRVNQLDFN------------KPHYIMHIVSDQNEADMIEIKKDSERVDEIRAMKQAWEDTEPGRALKAMQSRLKY 1339          
BLAST of Androglobin vs. TrEMBL
Match: A0A4D9EIY7 (Putative tubulin polyglutamylase TTLL2 OS=Platysternon megacephalum OX=55544 GN=DR999_PMT09164 PE=3 SV=1)

HSP 1 Score: 444.121 bits (1141), Expect = 6.827e-127
Identity = 412/1503 (27.41%), Postives = 679/1503 (45.18%), Query Frame = 3
Query:   66 KKKE--ERNKSAQSNSPYHKKLKEGTLTGMNSDGKHARIGIWPEWSEIDINNEKWDIPLKTKEKDKA-RSPLMTQNLFEDPEGLLKLPSSLKVFKWKRTYEYFT-KNPVIVDTEEGIHKFDIFSLNEHLFISETMRWIICQINNLW-------ITSEKKCAXXXXXXXXXXXXXXXNGTH-HTWRFWEHIYSLNKVGKG-FPQYNPAGKYIVKLFWMGDWRKILVDDTLPFDENDRLLLPVTTITNELWPXXXXXXXXXXXXXXYNFSSNETEFGDFSVIHSLTGWIPQKKIVSKEYRNQIVNDLSKLLNHWTYSNENC----NLTGD-----------KNDI--SNVEDIQHIEVNLDKTDNKEI----LLXXXXXXXXXXXXXXXXXXXXXXXXXXLFDGKNLNENPETLVIASYNS-SFNKLQMLSTSKMASRYEALRKIGMPSIYSHPVILNYYRDSPLEKSISPELIPSWKLIRPFIKVDIPQLNDCTTHSAYFDSKNVSNQKDDQSKYIEIQTPFINYKLSKKNNSTKEIFDENLENLKIIPHCTSKS--------NNQIMD-SENMGSLDSNFGNSNSKL----------------QIPCEFSYENEVLNLR-------------DEERYDFSKGLMKSWIDVDTFFECFEVLYIYHKTETYRYTESLSDFKTTNIDQKEPFYLFTDNIDNSEIIICLSVFCKWFTHNDPYYLPDNANNRNSPSINIVRDKSNNLENDNDPFATDQIQGVFFAENHYWKNFKIGKCLKRAKTNGTKAVSLKFPPGRHCLRIFIQALNGFHCKFISQNQFFFGTEDEIIP-LAVECPKRIQSLGIDIISAFKNMISNFSNDEERKSNEIALNNLIL-DFSKNSHSRALTSEFTQVFSQGIIKTIKMCNRELLTSDMIFALRAIILDFQSYITLTIXXXXXXXXXXXXAKIPPINSKIDNRKQSSTKSLTNIENKEEKRNEFFGDYSSRDMLYIIRLQKLIKGYYVRKVIMARSPRSNYHDRVVNELNKIKTLIEHNSSEIGNNLLNEIFEIYPQISKHYGLDNDQLNHIKFQEFKGNGILQPVNGFGMLFREIFHIDPLTKKTDDILI--KLNCNVQKCTLSIINNDNGEKTTEIILKRLNFKAFVPNSNGYTLIATTKDVENVVP---WKLKIIGGANNLLPTFIKQELCNDFSIFKIRDYYVPEEDGLLFHQIAKIKLDHPISVFVKLSNPNVSLRLSIYNFDEELYFVEGIGEAYIESFLLLKDYFCEEQV-----------------DLVRSGSRNSTKLK--------------KGQEKVERYXXXXXXXXXXXXXEGKKVYKYSIRASVNNSTWLLSQDNEEFVNXXXXXXRKNMNEQT-LNDNPSKLIQSSEFTKKENVQKI-LPKTKTKERGQEGVKILKGTEKPITKNNPVDN--NTSRPNSTYFESDKQHWTALIISDTCLEDNIQIYKNNEKHDTLCSTKKIWLEMDTLRFEKGKQ 4229
            KKKE   RN S   ++P  +        G  S+ K  +  IWPEW+E DIN EKWD     KEKDKA +SP++  ++FEDPEG ++LP SLKV  WKR +E+ T K PV+V  E   + FD+FS NEHL  SE MRWII +I  +W       +T+E K               ++N T   +W+ WEHIY+L K  KG  P YN  GKY+VKL+WMG WRKI+VDDT+PF+E + LLLP TT   ELWPL+L+KA++K+A+   +  + + E  +F+++H+LTGWIP+   +   Y +++   L  ++  +   NE      N   D           KN+I  ++ +  +  ++  DK + +EI        + +K+             ++  +   +   +   P+ +V ASY     ++ ++    +MA   E LR+ G+  IYSHPV++   R  PL     P  IP WKLIRP  +  +             +++    +K +Q  YIEI +PF+NY+++     T   F  +       P  T  S        N+  +D ++NM  L +   +  + L                 I  + +  +E ++               + ER   S+   ++W D + F  CF+ L+I+HK  TY Y+   +DFK T  D +  +YLF D++   EI++  S   +W            A  +    I                      QG+   E+  WK+   G+ + +  T  TKA  L  PPGRH L     +  G H    S     FG ED ++P L  E  + I+   + I+ A  N+I+NFS++ E      AL  L L  F  + H   +  E  +VF+    + I+      +  +  FA R+  LD ++                        ++ +++   S    L NI    + R       +S +   +++LQ   +G Y+R++I  R P +  +  V   L K+ TLIE N  + G  LL E+F+   +  K Y    D+     F ++      QP N + ++FRE FH+      T+D+L+  K+   +  C L +++ND  E+ + I LK +    +  N  GYT +A     +  V    W+L++I G+ + LP   +  + N +S  +I+DYY+P +  ++F    K+   H  +V V+ S  +V ++L + + +EE+    G G A I +F    ++ C E+                  D    G++    L               +GQ  +E             + + +  +KY I+A V  ++W L++    FV  LK +++  +      +D P   +    ++  E  +    PKT  K +        K TEK   + +  D   +TSRP S   + +K +W   ++ +    + +++ K+ E+ D + + K+ W   +  R  K  Q
Sbjct:    7 KKKELPARNNSGHISAPAKEPAAVLPSVGAASESKKGKFPIWPEWNEADINAEKWDAGKVGKEKDKAGKSPVL--HVFEDPEGKIELPPSLKVNSWKRPHEFLTNKVPVVVKNE---NWFDLFSANEHLLGSELMRWIISEICAVWRIYNVNVLTNEGKT--------------NTNETPIFSWKPWEHIYALCKAIKGHLPLYNSYGKYVVKLYWMGCWRKIIVDDTMPFNEENNLLLPATTCQTELWPLLLAKAIIKLANTDIH-EAGKRELEEFTILHALTGWIPEVIPLQPGYLDKVWIFLKDIVPEFKLPNETTPELKNPLSDMKAKETKGPELKNEIPVASKQAEKAEKIGKDKLEQREIGKKKSRDGEKEKNKTAPHSARIATDIQSSLQSFIESSPVPTVPQMVVYASYVPLHLSEEKIFVLGQMADSSEKLRQYGLSHIYSHPVLVTRTRSCPLVAPPKPPPIPRWKLIRPKKETVVTD-----------EAQEPIIKKPEQ--YIEIASPFLNYRVTPIAMPTNIHFPSSTIKRGCSPATTLPSVFESDENVNDIYLDVNQNMRFLSAEDNSQETSLIQQHNTEGPTKDELIENISIDVAQTSEAVDTSIYNQTVDKSPEDIESERNPVSR---ETWFDFEDFSTCFQNLHIFHKPNTYVYSYQKADFKFT--DDRVFYYLFVDSLKPIEILVSFSALVRWGD--------SGATQKEGSGIP---------------------QGMLTVESFSWKSVATGQLVLKIHTYATKAAMLSLPPGRHVLIFTASSPIGHHIHLCSMVPCVFGEEDTVMPNLDKESYRFIEQATV-ILKAIGNVINNFSSEPELSK---ALKELELTHFPHSLHGTGIAREHFKVFNNAFGRLIQQVLGNKVPPNFEFAFRSFTLDLKAN-----------------------DASVEDNVSSEVIEL-NIPVAWQNRTP-----TSEEEAAVLKLQSNWRGTYIRQLINGRKPGTKENANVKETLQKLWTLIESNIEQCGVTLLREMFKSNCKSIKKYPCYEDEWAKTTFADYAVTYFDQPPNFWFVVFRETFHV------TEDMLVVPKVYTTIPTCMLHVVDNDTLEEMSRIFLK-VAPHIYTKNKKGYTFMAEAHTGDLPVAAGKWRLRLI-GSQSPLPILSRDAVNNFYSTKEIKDYYIPNDKHVVFRYAVKVTASHIATVQVQTSKSDVFIKLQVLDSEEEIVNTVGKGHAVIPAF----NFLCTERPLSSQSSKGQISQSSAKKDPETGGTKRKGALATQKGIKSHRPESVLEGQAVIEE-EIVILPALEKNAVDTQPTHKYIIQALVLYNSWPLTESQLAFVQALKEMEKNEIKAHGEKHDEPIAAVNQDGYSNFEGPKSASTPKTTRKTKD-------KATEKAEKEKSSKDKTASTSRPESQQSDPNKPYWILHLVIEQSEAEVLELKKDTERADEIKAMKQAWESAEPGRAVKAFQ 1389          
BLAST of Androglobin vs. TrEMBL
Match: A0A3Q0CHX9 (androglobin OS=Mesocricetus auratus OX=10036 GN=Adgb PE=3 SV=1)

HSP 1 Score: 433.335 bits (1113), Expect = 5.682e-123
Identity = 397/1479 (26.84%), Postives = 678/1479 (45.84%), Query Frame = 3
Query:   60 LPKKKEERNKSAQSNSPYHKKLKEGTLTGMNSDGKHARIGIWPEWSEIDINNEKWDIPLKTKEKDK-ARSPLMTQNLFEDPEGLLKLPSSLKVFKWKRTYEY-FTKNPVIVDTEEGIHKFDIFSLNEHLFISETMRWIICQINNLWITSEKKCAXXXXXXXXXXXXXXXNGTHHTWRFWEHIYSLNKVGKG-FPQYNPAGKYIVKLFWMGDWRKILVDDTLPFDENDRLLLPVTTITNELWPXXXXXXXXXXXXXXYNFSSNETEFGDFSVIHSLTGWIPQKKIVSKEYRNQIVNDLSKLLNHWTYSNENCN---LTGDKNDI----SNVEDIQHIEVNLDKTDNKEILLXXXXXXXXXXXXXXXXXXXXXXXXXXLFDGKNLNENPETLVIASYNSSF---NKLQMLSTSKMASRYEALRKIGMPSIYSHPVILNYYRDSPLEKSISPELIPSWKLIRPFIKVDIPQLNDCTTHSAYFDSKNVSNQKDDQSKYIEIQTPFINYKLSKKNNSTKEIFDENLE------NLKIIPHCTSKSNNQIMDSE-NMGSLDSNFGNSNSK---------------LQIPCEFSYENEVLNL----RDEERYDFS---KGLMKS-WIDVDTFFECFEVLYIYHKTETYRYTESLSDFKTTNIDQKEPFYLFTDNIDNSEIIICLSVFCKWFTHNDPYYLPDNANNRNSPSINIVRDKSNNLENDNDPFATDQIQGVFFAENHYWKNFKIGKCLKRAKTNGTKAVSLKFPPGRHCLRIFIQALNGFHCKFISQNQFFFGTEDEIIPLAVECPKRIQSLGIDIISAFKNMISNFSNDEERKSNEIALNNL-ILDFSKNSHSRALTSEFTQVFSQGIIKTIKMCNRELLTSDMIFALRAIILDFQSYITLTIXXXXXXXXXXXXAKIPPINSKIDNRKQSSTKSLTNIENKEEKRNEFFGDYSSRDMLYIIRLQKLIKGYYVRKVIMARSPRSNYHDRVVNELNKIKTLIEHNSSEIGNNLLNEIFEIYPQISKHYGLDNDQLNHIKFQEFKGNGILQPVNGFGMLFREIFHIDPLTKKTDDILIKLNCNVQKCTLSIINNDNGEKTTEIILKRLNFKAFVPNSNGYTLIATTKDVENVVP---WKLKIIGGANNLLPTFIKQELCNDFSIFKIRDYYVPEEDGLLFHQIAKIKLDHPISVFVKLSNPNVSLRLSIYNFDEELYFVEGIGEAYIESFLLLKDYFCEEQVDLVRSGSR----NSTKLKKGQEKVERYXXXXXXXXXXXXXEG----------------------------KKVYKYSIRASVNNSTWLLSQDNEEFVNXXXXXXRKNMNEQ-----TLNDNPSKLIQSSEFTKKENVQKILPKTKTKERGQEGVKILKGTEKPITKNNPVDNNTSRPNSTYFESDKQHWTALIISDTCLEDNIQIYKNNEKHDTLCSTKKIWLEMDTLRFEKGKQVQMKY 4244
            +  K+ +R +  + NS +     +  +   + + K  +  IWPEWSE DIN EKWD     KEKDK  +SP+   + FEDPEG ++LP SLKVF WKR  ++ F++ PV+V  E     FD+FS NEHL  SE MRWII +I  +W           +     ++ +        W+ WEHIYSL K  KG  P +N  GKY+VKL+WMG WRKI +DD  PFDE++ LLLP TT   ELWP++LSKA++K+A++  + +    E G+F+VIH+LTGW+P+   +   Y +++   L ++L  +    ++ +   LT   N +      ++D + ++   +  D K+            + +      K   KS++   G +  ++P  +V A++   +   NK+   +  KMA+  E LR+ G+  I SHPV++   R  PL     P  +P WKLIR   +  I             ++ +   +K +Q  ++EI +PF+NY+++     T+  F +++          + P   ++ N      E NM + + + GN  S+               L  P     E ++++L    +D+ + D +   +G+ K  W+D + F  CF  +YI+HK  +Y      S+FK +  +++ P+YLF D++   E+++C S   +W            A  ++SP +                       G+  AE   WK+ K    + R  T  TKAV ++ P GRH L     +  G      S   F  G ED ++P       R     + I+ A  N+I++F  D+ + S   AL +L    +    +++ LT++  +VF   + + +K         +  FA RA++LD  + I  ++    +     +     PIN K                           +Y+  ++   ++LQ + KG YVR ++ AR P +  +    + L KI T++E N  +   +LL  +F    +  + Y    D+   + F ++  N   QP N + ++FRE F    L  +   +L K+   +  C L ++NND  E+  ++  K + +  +  N  GYT +A     +  V    WKL++IG  N  LP   +   C+ F++ +IRDYY+P +  +LF    K+ +   I++ V+ S P+  ++L +   +E +    G G+A I +F     YF   +  L    S+    + T  KK QE + +  +  +   S  S  G                            ++ YKY I+  V  ++W L++    FV  LK L++ ++ E+     T+    S  +  SE  K   V K     K KE+  E  K+ K  + P  +  P+    S+      + +K +W   ++S+    D + + K+ ++ D + + K+ W   +  R  K  Q ++KY
Sbjct:    1 MASKQAKRKEVHRINSAHGSDKSKDNVPPGSGEQKKGKFPIWPEWSEADINAEKWDAGKGVKEKDKTGKSPIF--HFFEDPEGKIELPPSLKVFSWKRPQDFIFSRTPVVVKNE---MTFDLFSPNEHLLCSELMRWIISEIYAVWKIFNGGILNNYNKGNSGELPMLL------WKPWEHIYSLCKAVKGHMPLFNSYGKYVVKLYWMGCWRKITIDDFFPFDEDNNLLLPATTYEFELWPMLLSKAIIKLANVDIHIAQRR-ELGEFTVIHALTGWLPEVIPLHSGYVDRVWELLKEILPEFKLVEDHSSESKLTVIDNKLKEPGKEIKDSKEVKNGKEVKDGKDF-----------KPEISVTTLKAPEKSDRPAKGSSAIQSPHMVVYATFTPLYLFENKI--FTLEKMANSAEKLREYGLSHICSHPVLVTRSRSCPLVAPPKPPPLPPWKLIRQKKETVITD-----------EAPDAVPKKPEQ--FLEISSPFLNYRMTPFTIPTETRFVQSVVKKGTPLGSSLPPLVENELNANTSQGEMNMVTGNQSQGNIASQTLSGKDEQAELLLGDLHAPEAIGLERDLISLTTGTQDKSQEDLATINEGVSKEIWLDFEDFCVCFHHIYIFHKPSSYCLNFQKSEFKFS--EERVPYYLFVDSLKPIELLVCFSALVRWGE--------SGALTKDSPHVE---------------------PGLLTAEAITWKSLKPLSAVLRIHTYATKAVMVRLPVGRHMLLFSAYSPVGHAIHVCSMVTFVIGDEDVVLPNFEPESYRFTEQSLIIMKAVGNVIASF-KDKAKLST--ALRDLQAAHYPIPLYNKELTAQHFRVFHISLWRLMKKSQVAKPPLNFKFAFRAMVLD--TDILDSLVEDVSLAEWVDFKYCMPINEK---------------------------EYTPEEIAAAVKLQSMWKGTYVRLLMKARMPDTKENASAADTLQKIWTVLEMNMEQHALSLLRLMFRSKCKSMESYPCYQDEETKMAFADYMVNYPDQPPNSWFIIFRETF----LVPQDMILLPKVYTTLPICMLHVVNNDTMEQMPKVFQKVVPY-LYPKNKKGYTFVAEAYTGDAYVSSARWKLRLIGSYNP-LPFLSRDTPCSTFTMKEIRDYYIPNDKKILFRYSIKVTVAQCITIQVRTSKPDAFIKLQVLESEETMVSTTGKGQAIIPAF-----YFLGSERALSSQSSKQILLSHTSPKKEQEVITKKKTGQASQKSFKSRPGSVAVDAGLPLLEEEVLNVTTVEENSSTPQQCYKYIIQCMVMFNSWPLTETQLTFVQALKDLEKMDVKEKHEELITVGSPDSHAV--SEGQKSVGVSKT--TRKGKEKAGEKEKLAKEKQAPRFEPQPIPTVHSQQE----DPNKPYWVLRLVSEHSDSDYVDVKKDTDRSDEIRAMKQAWEATEPGRAIKASQARLKY 1359          
BLAST of Androglobin vs. Ensembl Cavefish
Match: ENSAMXT00000014829.2 (pep primary_assembly:Astyanax_mexicanus-2.0:3:69587493:69601802:1 gene:ENSAMXG00000014390.2 transcript:ENSAMXT00000014829.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 182.185 bits (461), Expect = 3.004e-47
Identity = 150/654 (22.94%), Postives = 271/654 (41.44%), Query Frame = 3
Query: 1749 ERYDFSKGLMKS-WIDVDTFFECFEVLYIYHKTETYRYTESLSDFKT-------------------TNIDQKEPF----------------YLFTDNIDNSEIIICLSVFCKWFTHNDPYYLPDNANNRNSPSINIVRDKSNNLENDNDPFATDQIQGVFFAENHYWKNFKIGKCLKRAKTNGTKAVSLKFPPGRHCLRIFIQALNGFHCKFISQNQFFFGTEDEIIPLAVECPKRIQSLGIDIISAFKNMISNFSNDEERKSNEIALNNLILDFSKNSHSRALTSEFTQVFSQGIIKTIKMCNRELLTSDMIFALRAIILDFQSYITLTIXXXXXXXXXXXXAKIPPINSKIDNRKQSSTKSLTNIENKEEKRNEFFGDYSSRDMLYIIRLQKLIKGYYVRKVIMARSPRSNYHDRVVNELNKIKTLIEHNSSEIGNNLLNEIFEIYPQISKHYGLDNDQLNHIKFQEFKGNGILQPVNGFGMLFREIFHID-PLTKKTDDILIKLNCNVQKCTLSIINNDNGEKTTEIILKRLNFKAFVPNSNGYTLIATTKDVENVV---PWKLKIIGGANNLLPTFIKQELCNDFSIFKIRDYYVPEEDGLLFHQIAKIKLDHPISVFVKLSNPNVSLRLSIYNFDEELYFVEGIGEAYI 3590
            + +D  K +++  W+ +  F +CF+ L I+H  +TY +    S FK+                   +    K P                 +LF DN+  +EI+I  S    W              + N   ++                      GV  A+   WK+ +        +T+  KA  L  PPGRH  RI + A  GFH +  S   F FG E+E++P   +   R     + ++ A   ++S+FS+ +E  S    L   +       HS+    E  +VF++ +           LTS+ +FA++A+  D                         PI ++  N K + T S         KR       + ++      LQ   KGY VR+++ A  P S  + +V   L ++   +E ++ +   +LL  +     Q  + +    D+   I F ++    + +  N + ++FRE+FH+  PL      ++ K+   ++ C L +INN+ GE+    +  R+  + + PN  GYT +A     +  V    W++++I G+ + LP   ++   + F++ + + YYVP E  ++     K+  DH  +V  + SN NV ++LSI + ++E+   +G G   I
Sbjct:   54 QSHDLEKTMLQEVWVHLHDFPKCFQSLVIFHNPDTYPHYSQKSQFKSYIASRGAATTQPSVVGSTNSAASGKLPESSGATHMQGSYEKCCDFLFVDNLLPTEILISFSALVHW----------GGTKDENKECVSRA--------------------GVLTAQPFSWKSIESQLPWIHIQTSACKAAILSLPPGRHVFRIHMMAPLGFHLQVCSMAPFVFGGEEEVMPHLDKESLRFSQQALLVLRALGGVVSSFSDPQELPSASRVLEEAL---CPPLHSKVANREHWRVFNEAVYHMFCSVLGRKLTSEELFAVQALTGD-------------------------PI-AQYSNTKDTDTPSADGAPEVSSKRQA-----TEQEKQAATILQAGWKGYLVREILRAAKPGSEENQKVSQTLLEMWASVESDAEKHAESLLRYMITNNEQTMELFPCKEDEWTRITFADY-SVPVPETTNSWMLIFREVFHVSKPLL-----LVPKMYSPLRNCLLHVINNETGEELPR-VFNRVEPRIYTPNKAGYTFLAEAYSEDTPVIGGKWRMRLI-GSQHPLPQLAREAPASTFAVKQFKGYYVPNEKNIICRHAVKVTCDHVATVQFQTSNANVHIKLSILDHEKEVASNQGKGHVII 635          
BLAST of Androglobin vs. Ensembl Cavefish
Match: ENSAMXT00000052548.1 (pep primary_assembly:Astyanax_mexicanus-2.0:3:69554680:69563918:1 gene:ENSAMXG00000041135.1 transcript:ENSAMXT00000052548.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 98.2117 bits (243), Expect = 5.547e-23
Identity = 50/111 (45.05%), Postives = 68/111 (61.26%), Query Frame = 3
Query:  162 KHARIGIWPEWSEIDINNEKWDIPLKTKEKDKARSPLMTQNLFEDPEGLLKLPSSLKVFKWKRTYEYFT-KNPVIVDTEEGIHKFDIFSLNEHLFISETMRWIICQINNLW 491
            + +R  +WPEW+E +++ EKWD+    K+    +SP+     F+DPEG + LP+SLKV  WKR  EY   K P +V+ E     FD+ S NEHL  SE MRWII +I  LW
Sbjct:   47 RRSRFPVWPEWNETEVSAEKWDVATTAKDGKVGKSPV--SQFFDDPEGKVDLPASLKVHTWKRPSEYIINKVPFVVENES---TFDLTSANEHLLSSELMRWIISEICILW 152          
BLAST of Androglobin vs. Ensembl Cavefish
Match: ENSAMXT00000031082.1 (pep primary_assembly:Astyanax_mexicanus-2.0:3:69554680:69566979:1 gene:ENSAMXG00000041135.1 transcript:ENSAMXT00000031082.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.0333 bits (201), Expect = 1.569e-17
Identity = 42/98 (42.86%), Postives = 59/98 (60.20%), Query Frame = 3
Query:  162 KHARIGIWPEWSEIDINNEKWDIPLKTKEKDKARSPLMTQNLFEDPEGLLKLPSSLKVFKWKRTYEY-FTKNPVIVDTEEGIHKFDIFSLNEHLFISE 452
            + +R  +WPEW+E +++ EKWD+    K+    +SP+     F+DPEG + LP+SLKV  WKR  EY   K P +V+ E     FD+ S NEHL  SE
Sbjct:   47 RRSRFPVWPEWNETEVSAEKWDVATTAKDGKVGKSPV--SQFFDDPEGKVDLPASLKVHTWKRPSEYIINKVPFVVENES---TFDLTSANEHLLSSE 139          
BLAST of Androglobin vs. Ensembl Cavefish
Match: capn7 (calpain 7 [Source:NCBI gene;Acc:103047868])

HSP 1 Score: 68.1662 bits (165), Expect = 6.906e-11
Identity = 39/100 (39.00%), Postives = 57/100 (57.00%), Query Frame = 3
Query:  597 IYSLNKVGKGFPQYNPAGKYIVKLFWMGDWRKILVDDTLPFDENDRLLLPVTTITNELWPXXXXXXXXXXXXXXYNFSSNETEFGDFSVIHSLTGWIPQK 896
            IY  N+  +G P+YNP GKY+VKL   G  RK+++DD LP D N  LL   ++  NELW + L +         Y+F  + +       +H+LTGWIP++
Sbjct:  315 IYPQNR--RGEPEYNPCGKYMVKLHINGVPRKVIIDDFLPVDRNGELLCSYSSNRNELW-VSLIEKAYMKVMGGYDFPGSNSNID----LHALTGWIPER 407          
BLAST of Androglobin vs. Ensembl Cavefish
Match: capn7 (calpain 7 [Source:NCBI gene;Acc:103047868])

HSP 1 Score: 67.781 bits (164), Expect = 8.093e-11
Identity = 39/100 (39.00%), Postives = 57/100 (57.00%), Query Frame = 3
Query:  597 IYSLNKVGKGFPQYNPAGKYIVKLFWMGDWRKILVDDTLPFDENDRLLLPVTTITNELWPXXXXXXXXXXXXXXYNFSSNETEFGDFSVIHSLTGWIPQK 896
            IY  N+  +G P+YNP GKY+VKL   G  RK+++DD LP D N  LL   ++  NELW + L +         Y+F  + +       +H+LTGWIP++
Sbjct:  315 IYPQNR--RGEPEYNPCGKYMVKLHINGVPRKVIIDDFLPVDRNGELLCSYSSNRNELW-VSLIEKAYMKVMGGYDFPGSNSNID----LHALTGWIPER 407          
BLAST of Androglobin vs. Ensembl Nematostella
Match: EDO44028 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWT3])

HSP 1 Score: 221.476 bits (563), Expect = 1.269e-58
Identity = 164/498 (32.93%), Postives = 247/498 (49.60%), Query Frame = 3
Query:  132 GTLT-GMNSDGKHAR-IGIWPEWSEIDINNEKWDIPLKTKEKDKARSPLMTQNLFEDPEGLLKLPSSLK--VFKWKRTYEY-FTKNPVIVDTEEGIHKFDIFSLNEHLFISETMRWIICQINNLW---------------ITSEKKCAXXXXXXXXXXXXXXXNGTHHTWRFWEHIYSLNKV-------GKGFPQYNPAGKYIVKLFWMGDWRKILVDDTLPFDENDRLLLPVTTITNELWPXXXXXXXXXXXXXXYNFSSNETEFGDFSVIHSLTGWIPQKKIVSKEYRNQIVNDLSKLLNHWTYSNENCNLTGDKNDISNVEDIQHIEVNLDKTDNKEILLXXXXXXXXXXXXXXXXXXXXXXXXXXLFDGKNLNENPETLVIASYNSSFNKLQMLST-SKMASRYEALRKIGMPSIYSHPVILNYYRDSPLEKSISPELIPSWKLIRPFIKVDIPQLNDCTTHSAYFDSKNVSNQKDDQSKYIEIQTPFINYKLS 1541
            G+L  G +  GK+ + I IWPEWS+ DIN EKWD   K KEK+K +SP    + +EDPEG + LP SL+  V  WKR  ++   K PV+VD +    + D+   N HL   ET+RWII Q+  LW                   K+   +    + ++    ++   +TW+ W HI+   K            P YNP GKY VK++WMG WRK+ VDD +PFDE  ++LLP +   +ELWP++LSKAL+K+ASL Y   S   E GDF+V+H+LTGW+P+   +   + +++ + L K L  W   N          D +  +  +  +   +K D K        +K+  E + K +++            +  N+ PE ++ ASY+        +S   +MA   E LR+ G+   + HPV++   RD+PL     P  IP WKLIR   K                        +D   K++E+ +PF+NY +S
Sbjct:   34 GSLKDGDDKKGKNKQPIIIWPEWSDQDINQEKWDTTHKAKEKEKGKSP--NPHPYEDPEGRIDLPQSLRYRVDHWKRPVDFILEKVPVVVDPKSLTQEIDLLCNNGHLADCETLRWIIAQVTCLWRMHFKIEIPEVKTKDTKEGKEKDKDKEKEKEKEKQSEASQEDNTWKPWSHIWPKEKSQEKVKEKATAIPVYNPGGKYCVKVYWMGAWRKVTVDDWMPFDEEGKMLLPASPNEHELWPMLLSKALIKVASLDYAGGSTSCEIGDFTVVHALTGWLPEVIPLKYGHTSEVWDLLMKALPRWKLENTPA------PDEAKPQAAEGGKKEREK-DRKSTRSIKDRQKEESERESKTREKDKDKAGSVTGQAEQANKEPEFVIFASYSHPPTAPMRISVLREMADASEKLRQSGLSHNHPHPVMVTMIRDTPLVAPPPPIEIPRWKLIRQKKK----------KQPIEPPITPPEPPRD--PKFLEVTSPFVNYNVS 510          

HSP 2 Score: 55.8398 bits (133), Expect = 1.370e-7
Identity = 33/134 (24.63%), Postives = 66/134 (49.25%), Query Frame = 3
Query: 2868 PRSNYHDRVVNELNKIKTLIEHNSSEIGNNLLNEIFEIYPQISKHYGLDNDQLNHIKFQEFKGNGILQPVNGFGMLFREIFHID-PLTKKTDDILIKLNCNVQKCTLSIINNDNGEKTTEIILKRLNFKAFVPN 3266
            P S+   +V   L+K  + +E N       +   +F+   ++   +    D+ + + F ++ G+   QP N + ++FRE+F +D P+      ++ +L CN+  C L +++ND GE+ T +      F+   PN
Sbjct:  836 PGSDEQQQVSALLSKAWSTLEPNQENFAIEIFRRMFKRDQELFPLFPFFKDEWSRVAFTDYNGSYPEQPSNSWFVVFREVFIVDEPVL-----MVPRLYCNIPTCLLRVVDNDTGEELTRV------FQRVAPN 958          
BLAST of Androglobin vs. Ensembl Nematostella
Match: EDO30864 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZJ5])

HSP 1 Score: 125.946 bits (315), Expect = 1.248e-30
Identity = 98/432 (22.69%), Postives = 200/432 (46.30%), Query Frame = 3
Query: 2346 RIQSLGIDIISAFKNMISNFSNDEERKSNEIALNNLILDFSKNSHSRALTSEFTQVFSQGIIKTIKMCNRELLTSDMIFALRAIILDFQSYITLTIXXXXXXXXXXXXAKIPPINSKIDNRKQSSTKSLTNIENKEEKRNEFFGDYSSRDMLYIIRLQKLIKGYYVRKVIMARSPRSNYHDRVVNELNKIKTLIEHNSSEIGNNLLNEIFEIYPQISKHYGLDNDQLNHIKFQEFKGNGILQPVNGFGMLFREIFHID-PLTKKTDDILIKLNCNVQKCTLSIINNDNGEKTTEIILKRLNFKAFVPNSNGYTLIATTKDVENVVP---WKLKIIGGANNLLPTFIKQELCNDFSIFKIRDYYVPEEDGLLFHQIAKIKLDHPISVFVKLSNPNVSLRLSIYNFDEELYFVEGIGEAYIESFLLLKDYFCEE 3629
            R     + ++ +  ++++ FS+    K  E       LD      SR +     +VF + + K +K    +     M FA +A    FQ+ + +         S+ +  +I  +      R+ S  K  T++ +  +++       S  + +  +++Q   +G++VRK+  A     +   +V   L+K  + +E N       +   +F+   ++   +    D+ + + F ++ G+   QP N + ++FR +F +D P+      ++ KL CN+  C L +++ND GE+ T +  +R+       N  GYT IA  + +  ++P   ++L++IG +   LP   ++ + + F   +IRDYY+P    ++F    K+  DH  S+ +  S P+V ++L I + + E+    G G A I +F+  +D   +E
Sbjct:    5 RFMEHAMHVMKSVGDLVTKFSDPPADKRPE-------LDLGLKDESRDVQERHYKVFIRCLFKALKYNLGDAYDPAMHFAWKAFA--FQASLCVRQHIAFRPLSAADITRIGTM------RRDSPMKRPTSVPSSSQEKP------SQHEEVAALKIQSSFRGHFVRKLAKAFVAGDDEQQQVSALLSKAWSTLEPNQENFAIEIFRRMFKRDQELFPLFPFFKDEWSRVAFTDYNGSYPEQPSNSWFVVFRSVFMVDEPVL-----MVPKLYCNIPTCLLRVVDNDTGEELTRV-FQRVAPNNMKKNKRGYTFIAEARILNAILPPGKFRLRVIG-STEPLPYPPRESVNSHFVHKEIRDYYIPNRYNIIFRHTVKVTDDHMASLQLGTSKPDVYIKLQILDDEVEVMSTTGKGHAVIPAFIFYRDRTGDE 408          
BLAST of Androglobin vs. Ensembl Nematostella
Match: EDO27357 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9G8])

HSP 1 Score: 80.4925 bits (197), Expect = 1.068e-17
Identity = 37/74 (50.00%), Postives = 47/74 (63.51%), Query Frame = 3
Query:  576 TWRFWEHIY----SLNKV---GKGFPQYNPAGKYIVKLFWMGDWRKILVDDTLPFDENDRLLLPVTTITNELWP 776
            TW+ W HI+    S  KV       P YNP GKY VK++WMG WRK+ VDD +PFDE  ++LLP +   +ELWP
Sbjct:   43 TWKPWSHIWPKEKSQEKVKEKATAIPVYNPGGKYCVKVYWMGAWRKVTVDDWMPFDEEGKMLLPASPNEHELWP 116          
BLAST of Androglobin vs. Ensembl Nematostella
Match: EDO45797 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRP7])

HSP 1 Score: 64.6994 bits (156), Expect = 2.727e-10
Identity = 38/105 (36.19%), Postives = 60/105 (57.14%), Query Frame = 3
Query:  597 IYSLNKVGKGFPQYNPAGKYIVKLFWMGDWRKILVDDTLPFDENDRLLLPVTTITNELWPXXXXXXXXXXXXXXYNFSSNETEFGDFSVIHSLTGWIPQKKIVSK 911
            IY  NK+GK  P  NP+GKY++KL   G  RK+++DD LP  ++ +LL   +T  NE+W + L +         Y+F  + +       +H+LTGWIP++  + K
Sbjct:  316 IYPQNKIGK--PVINPSGKYMIKLKLNGVSRKVIIDDLLPMGKDGKLLCGHSTNRNEMW-ISLVEKAYMKVMGGYDFPGSNSSID----LHALTGWIPERMSLKK 413          
BLAST of Androglobin vs. Ensembl Medaka
Match: ENSORLT00000017755.2 (pep primary_assembly:ASM223467v1:24:8578805:8580767:-1 gene:ENSORLG00000014153.2 transcript:ENSORLT00000017755.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 96.2857 bits (238), Expect = 3.332e-22
Identity = 70/205 (34.15%), Postives = 97/205 (47.32%), Query Frame = 3
Query:   69 KKEERNKSAQSNSPYHKKLKEGTLTGMNSDGKHARIGIWPEWSEIDINNEKWDIPLKTKEKDKARSPLMTQNLFEDPEGLLKLPSSLKVFKWKRTYEYFT-KNPVIVDTEEGIHKFDIFSLNEHLFISETMRWIICQINNLWITSEKKCAXXXXXXXXXXXXXXXNGTHHTWRFWEHIYSLNKVGKG-FPQYNPAGKYIVKLFWM 677
            KK E +    S+S    +  E  L+  N+D       IWPEW++ DIN E W     TK + + ++     + +EDPE    LP SLK   WKR  ++ T +N  IV+ +     FD+ + NEHL   +T+  II +I  +W                             WR WEHIYSL KV +   P YN  GKY+VKL+WM
Sbjct:    7 KKRESSTGKMSSS---DRQTETLLSVSNADIFGGSF-IWPEWNDADINKENWSSGPNTKSRKRPKA-----DFYEDPEEKTFLPPSLKAHSWKRPADFLTEQNLTIVENQTS---FDLLTPNEHLMFCQTITSIISEIYIVW-------------------------KQDNWRPWEHIYSLCKVVEDHVPLYNSYGKYVVKLYWM 174          
BLAST of Androglobin vs. Ensembl Medaka
Match: ENSORLT00000037529.1 (androglobin [Source:NCBI gene;Acc:101164862])

HSP 1 Score: 89.3521 bits (220), Expect = 2.327e-17
Identity = 87/379 (22.96%), Postives = 167/379 (44.06%), Query Frame = 3
Query: 3090 MLFREIFHIDPLTKKTDDILIKLNCNVQKCTLSIINNDNGEKTTEIILKRLNFKAFVPNSNGYTLIATTKDVENV---VPWKLKIIGGANNLLPTFIKQELCNDFSIFKIRDYYVPEEDGLLFHQIAKIKLDHPISVFVKLSNPNVSLRLSIYNFDEELYFVEGIGEAYIE--SFLLLKDYFCEEQVDLVRSGSRNSTKLKKGQEKVERYXXXXXXXXXXXXXEGKKVYKYSIRASVNNSTWLLSQDNEEFVNXXXXXXRKNMNEQTLNDNPSKLIQSSEFTKKENVQKILPKTKTKERGQEGVKILKGTEKPITKNNPVDNNTSRPNSTYFESDKQHWTALIISDTCLEDNIQIYKNNEKHDTLCSTKKIWLEMDTLR 4211
            M+FRE+F    L  +   + +K+   V+   L +INND GE+  +++  ++  + F PN +GYT +A     +++     WK+ +IG     LP   ++   N FS+ K ++YY+P +  L+   + +++ +   +V  + S  +V + LSI + D+E     G G   I    FLL +D   E       S  R  T    G+   ++    T              +KY ++A V   +W L +    F N LK  ++K M      D P   +QSS   +++            ++G+       G+++ ++                F+  K HW   ++++    ++I++ K+ E+ D + + K  W +++  R
Sbjct:  561 MVFREVF----LVPRKMLLAVKVFSPVRN-VLHVINNDTGEEV-KLLFTKVPPRVFEPNKSGYTFVAEVWKPQSLPADAKWKMVLIG-TEEPLPKMSRETPLNAFSVKKFQEYYIPNKKNLICRYLVQVRAETMATVQFQTSKSDVVIHLSILDQDKEEVANTGRGHVMIPLFHFLLQRDSTQE------TSQQRLRTDDAAGEADSDQPPLHTLE------------HKYVVQAQVLYGSWPLDKSELTFANMLKDKEKKEMR---APDRPPDELQSSRKAERDG-----------KKGKSAAASTSGSKQDMS----------------FDLTKPHWILRVVTEKTKTESIEVKKDTERSDEIRAIKNSWEKLEPGR 884          

HSP 2 Score: 71.633 bits (174), Expect = 6.007e-12
Identity = 102/494 (20.65%), Postives = 180/494 (36.44%), Query Frame = 3
Query: 1173 NLNENPETLVIASYNSSFNKLQMLSTSKMASRYEALRKIGMPSIYSHPVILNYYRDSPLEKSISPELIPSWKLIRPFIKVDIPQLNDCTTHSAYFDSKNVSNQKDDQSKYIEIQTPFINYKLSKKNNSTKEIFDENLENLKIIPHCTS------KSNNQIMDSENMGSLDSNFGNSNSKLQ------------IPCEFSYENEVLNLRDEERYDFSKGLMKSWIDVDTFFECFEVLYIYHKTETYRYTESLSDFKTTNIDQKEPFYLFTDNIDNSEIIICLSVFCKWFTHNDPYYLPDNANNRNSPSINIVRDKSNNLENDNDPFATDQIQGVFFAENHYWKNFKIGKCLKRAKTNGTKAVSLKFPPGRHCLRIFIQALNGFHCKFISQNQFFFGTEDEIIPLAVECPKRIQSLGIDIISAFKNMISNFSNDEERKSNEIALNNLILDFSKNSHSRAL-TSEFTQVFSQGIIKTIKMCNRELLTSDMIFALRAI 2597
            +L++  E +V AS+            S+MA   E LR+ G+  +    V++   R  PLE   +   +P WKLIRP  K  I             + +     K +Q  +IE+ + +   +   K+ S   +  E    +K    CTS      K +    + +  G+   N  N+  K              IP + S   E      E   D    L ++W+D+  F +CF+ L ++HK   Y ++   S FK   I ++  +YL  D    S+ +I  S    W   ++                                    + + V     H W + +    +   KT   KA  L  P GRH + + ++A  G+H    S+    F  E+  +    +         I I  A   + ++  ++++  +    L          +HS  L   +  +VF   +   ++   R  LT D  FA++ +
Sbjct:    9 SLSDASEVVVCASFYPFQTHCGAYEMSQMAKSAETLRRHGLSLLRGRAVLVTRTRAGPLEPPPTSPPVPRWKLIRPQKKTVITS-----------EPQKTPLPKPEQ--FIEVASLYFFNRFKNKSGSLSGLETELSSTVK--GSCTSLMPISEKEDADCQEFQEPGAAKCNSPNNLQKTTVSVEDIKKDSDNIPNDDSVMAEKEPATKEASADVQPLLSRTWLDLADFVKCFKHLLVFHKPHFYPHSSQRSCFKCPMIRRE--YYLCIDTPQPSQTLISFSALLFWGEESE-----------------------------------KKQEAVLTILPHLWTSMQAQMPVFIIKTTCCKAAVLNLPKGRHLMVVHVRAPVGYHVLLCSKTPLSFEDEETAMAEFTKESACFTEQAIAIYGALSRVAASLGDEQKLPALRETLKKAHCPI---NHSTTLEEQQHHKVFGLAVNHMVREALRRELTPDERFAVQVL 447          
BLAST of Androglobin vs. Ensembl Medaka
Match: capn7 (calpain 7 [Source:NCBI gene;Acc:101162069])

HSP 1 Score: 67.0106 bits (162), Expect = 1.325e-10
Identity = 39/100 (39.00%), Postives = 57/100 (57.00%), Query Frame = 3
Query:  597 IYSLNKVGKGFPQYNPAGKYIVKLFWMGDWRKILVDDTLPFDENDRLLLPVTTITNELWPXXXXXXXXXXXXXXYNFSSNETEFGDFSVIHSLTGWIPQK 896
            IY  N+  +G P+YNP GKY+VKL   G  RK+++DD LP D N  LL   ++  NELW + L +         Y+F  + +       +H+LTGWIP++
Sbjct:  326 IYPQNR--RGEPEYNPCGKYMVKLHLNGVPRKVIIDDFLPVDCNGELLCSYSSNRNELW-VSLIEKAYMKVMGGYDFPGSNSNID----LHALTGWIPER 418          
BLAST of Androglobin vs. Ensembl Medaka
Match: capn7 (calpain 7 [Source:NCBI gene;Acc:101162069])

HSP 1 Score: 67.0106 bits (162), Expect = 1.353e-10
Identity = 39/100 (39.00%), Postives = 57/100 (57.00%), Query Frame = 3
Query:  597 IYSLNKVGKGFPQYNPAGKYIVKLFWMGDWRKILVDDTLPFDENDRLLLPVTTITNELWPXXXXXXXXXXXXXXYNFSSNETEFGDFSVIHSLTGWIPQK 896
            IY  N+  +G P+YNP GKY+VKL   G  RK+++DD LP D N  LL   ++  NELW + L +         Y+F  + +       +H+LTGWIP++
Sbjct:  246 IYPQNR--RGEPEYNPCGKYMVKLHLNGVPRKVIIDDFLPVDCNGELLCSYSSNRNELW-VSLIEKAYMKVMGGYDFPGSNSNID----LHALTGWIPER 338          
BLAST of Androglobin vs. Planmine SMEST
Match: SMESG000053594.1 (SMESG000053594.1)

HSP 1 Score: 1520.37 bits (3935), Expect = 0.000e+0
Identity = 788/853 (92.38%), Postives = 796/853 (93.32%), Query Frame = 3
Query:   57 MLPKKKEERNKSAQSNSPYHKKLKEGTLTGMNSDGKHARIGIWPEWSEIDINNEKWDIPLKTKEKDKARSPLMTQNLFEDPEGLLKLPSSLKVFKWKRTYEYFTKNPVIVDTEEGIHKFDIFSLNEHLFISETMRWIICQINNLWITSEKKCAXXXXXXXXXXXXXXXNGTHHTWRFWEHIYSLNKVGKGFPQYNPAGKYIVKLFWMGDWRKILVDDTLPFDENDRLLLPVTTITNELWPXXXXXXXXXXXXXXYNFSSNETEFGDFSVIHSLTGWIPQKKIVSKEYRNQIVNDLSKLLNHWTYSNENCNLTGDKNDISNVEDIQHIEVNLDKTDNKEILLXXXXXXXXXXXXXXXXXXXXXXXXXXLFDGKNLNENPETLVIASYNSSFNKLQMLSTSKMASRYEALRKIGMPSIYSHPVILNYYRDSPLEKSISPELIPSWKLIRPFIKVDIPQLNDCTTHSAYFDSKNVSNQKDDQSKYIEIQTPFINYKLSKKNNSTKEIFDENLENLKIIPHCTSKSNNQIMDSENMGSLDSNFGNSNSKLQ-----------------IPCEFSYENEVLNLRDEERYDFSKGLMKSWIDVDTFFECFEVLYIYHKTETYRYTESLSDFKTTNIDQKEPFYLFTDNIDNSEIIICLSVFCKWFTHNDPYYLPDNANNRNSPSINIVRDKSNNLENDNDPFATDQIQGVFFAENHYWKNFKIGKCLKRAKTNGTKAVSLKFPPGRHCLRIFIQALNGFHCKFISQNQFFFGTEDEIIPLAVECPKRIQSLGIDIISAFKNMISNFSNDEERKSNEIALNNLILDFSKNSHSRALTSEFTQVFSQGIIKTIKMCNRELL 2564
            MLPKKKEERNKSAQSNSPYHKKLKEGTLTGMNSDGKHARIGIWPEWSEIDINNEKWDIPLKTKEKDKARSPLMTQNLFEDPEGLLKLPSSLKVFKWKRTYEYFTKNPVIVDTEEGIHKFDIFSLNEHLFISETMRWIICQINNLWITSEKKCAIESSDTQIQDISISSNGTHHTWRFWEHIYSLNKVGKGFPQYNPAGKYIVKLFWMGDWRKILVDDTLPFDENDRLLLPVTTITNELWPLILSKALLKIASLSYNFSSNETEFGDFSVIHSLTGWIPQKKIVSKEYRNQIVNDLSKLLNHWTYSNENCNLTGDKNDISNVEDIQ I     K  +K                         TKSEKLFDGKNLNENPETLVIASYNSSFNKLQMLSTSKMASRYEALRKIGMPSIYSHPVILNYYRDSPLEKSISPELIPSWKLIRPFIKVDIPQLNDCTTHSAYFDSKNVSNQKDDQSKYIEIQTPFINYKLSKKNNSTKE+FDENLENLKIIPHCTSKSNNQIMDSENMGSLDSNFGNSNSKLQ                 +PCEFSYENEVLNLRDEERYDFSKGLMKSWIDVDTFFECFEVLYIYHKTETYRYTESLSDFKTTNIDQKEPFYLFTDNIDNSEIIICLSVFCKWFTHNDPYYLPDNANNRNSPSINIVRDKSNNLENDNDPFATDQIQGVFFAENHYWKNFKIGKCLKRAKTNGTKAVSLKFPPGRHCLRIFIQALNGFHCKFISQNQFFFGTEDEIIPLAVECPKRIQSLGIDIISAFKNMISNFSNDEERKSNEIALNNLILDFSKNSHSRALTSEFTQVFS+ I++ +   N  L+
Sbjct:    1 MLPKKKEERNKSAQSNSPYHKKLKEGTLTGMNSDGKHARIGIWPEWSEIDINNEKWDIPLKTKEKDKARSPLMTQNLFEDPEGLLKLPSSLKVFKWKRTYEYFTKNPVIVDTEEGIHKFDIFSLNEHLFISETMRWIICQINNLWITSEKKCAIESSDTQIQDISISSNGTHHTWRFWEHIYSLNKVGKGFPQYNPAGKYIVKLFWMGDWRKILVDDTLPFDENDRLLLPVTTITNELWPLILSKALLKIASLSYNFSSNETEFGDFSVIHSLTGWIPQKKIVSKEYRNQIVNDLSKLLNHWTYSNENCNLTGDKNDISNVEDIQKINQKKKKEKDK-------------------------TKSEKLFDGKNLNENPETLVIASYNSSFNKLQMLSTSKMASRYEALRKIGMPSIYSHPVILNYYRDSPLEKSISPELIPSWKLIRPFIKVDIPQLNDCTTHSAYFDSKNVSNQKDDQSKYIEIQTPFINYKLSKKNNSTKEMFDENLENLKIIPHCTSKSNNQIMDSENMGSLDSNFGNSNSKLQSKINLIKVNLNEAKNNLVPCEFSYENEVLNLRDEERYDFSKGLMKSWIDVDTFFECFEVLYIYHKTETYRYTESLSDFKTTNIDQKEPFYLFTDNIDNSEIIICLSVFCKWFTHNDPYYLPDNANNRNSPSINIVRDKSNNLENDNDPFATDQIQGVFFAENHYWKNFKIGKCLKRAKTNGTKAVSLKFPPGRHCLRIFIQALNGFHCKFISQNQFFFGTEDEIIPLAVECPKRIQSLGIDIISAFKNMISNFSNDEERKSNEIALNNLILDFSKNSHSRALTSEFTQVFSE-ILEVVIHLNLNLI 827          
BLAST of Androglobin vs. Planmine SMEST
Match: SMESG000053594.1 (SMESG000053594.1)

HSP 1 Score: 1080.47 bits (2793), Expect = 0.000e+0
Identity = 555/558 (99.46%), Postives = 555/558 (99.46%), Query Frame = 3
Query: 2817 QKLIKGYYVRKVIMARSPRSNYHDRVVNELNKIKTLIEHNSSEIGNNLLNEIFEIYPQISKHYGLDNDQLNHIKFQEFKGNGILQPVNGFGMLFREIFHIDPLTKKTDDILIKLNCNVQKCTLSIINNDNGEKTTEIILKRLNFKAFVPNSNGYTLIATTKDVENVVPWKLKIIGGANNLLPTFIKQELCNDFSIFKIRDYYVPEEDGLLFHQIAKIKLDHPISVFVKLSNPNVSLRLSIYNFDEELYFVEGIGEAYIESFLLLKDYFCEEQVDLVRSGSRNSTKLKKGQEKVERYXXXXXXXXXXXXXEGKKVYKYSIRASVNNSTWLLSQDNEEFVNXXXXXXRKNMNEQTLNDNPSKLIQSSEFTKKENVQKILPKTKTKERGQEGVKILKGTEKPITKNNPVDNNTSRPNSTYFESDKQHWTALIISDTCLEDNIQIYKNNEKHDTLCSTKKIWLEMDTLRFEKGKQVQMKYNEENQVTDQSDRNSSEKYLDLSLFYPIDISKNDDTFYQSRYNFIDLFRQNHAEWDIWSKNEKVKRIKKINDTFDNYHNQQKI 4490
            QKLIKGYYVRKVIMARSPRSNYHDRVVNELNKIKTLIEHNSSEIGNNLLNEIFEIYPQISKHYGLDNDQLNHIKFQEFKGNGILQPVNGFGMLFREIFHIDPLTKKTDDILIKLNCNVQKCTLSIINNDNGEKTTEIILKRLNFKAFVPNSNGYTLIATTKDVENVVPWKLKIIGGANNLLPTFIKQELCNDFSIFKIRDYYVPEEDGLLFHQIAKIKLDHPISVFVKLSNPNVSLRLSIYNFDEELYFVEGIGEAYIESFLLLKDYFCEEQVDLVRSGSRNSTKLKKGQEKVERYSSKTSGTNSSCSNEGKKVYKYSIRASVNNSTWLLSQDNEEFVNKLKLLKRKNMNEQ LNDNPSKLIQSSEFTKKENVQKILPKTKTKERGQEGVKILKGTEKPITKNNPVDNNTSRPNSTYFESDKQHWTALIISDTCLEDNIQIYKNNEKHDTLCSTKKIWLEMDTLRFEKGKQVQMKYNEENQVTDQSDRNSSEKYLDLSLFYPIDISKNDDTFYQSRYNFIDLFRQNHAEWDIWSKNEKVKRIKKINDT DNYHNQQ I
Sbjct:  717 QKLIKGYYVRKVIMARSPRSNYHDRVVNELNKIKTLIEHNSSEIGNNLLNEIFEIYPQISKHYGLDNDQLNHIKFQEFKGNGILQPVNGFGMLFREIFHIDPLTKKTDDILIKLNCNVQKCTLSIINNDNGEKTTEIILKRLNFKAFVPNSNGYTLIATTKDVENVVPWKLKIIGGANNLLPTFIKQELCNDFSIFKIRDYYVPEEDGLLFHQIAKIKLDHPISVFVKLSNPNVSLRLSIYNFDEELYFVEGIGEAYIESFLLLKDYFCEEQVDLVRSGSRNSTKLKKGQEKVERYSSKTSGTNSSCSNEGKKVYKYSIRASVNNSTWLLSQDNEEFVNKLKLLKRKNMNEQILNDNPSKLIQSSEFTKKENVQKILPKTKTKERGQEGVKILKGTEKPITKNNPVDNNTSRPNSTYFESDKQHWTALIISDTCLEDNIQIYKNNEKHDTLCSTKKIWLEMDTLRFEKGKQVQMKYNEENQVTDQSDRNSSEKYLDLSLFYPIDISKNDDTFYQSRYNFIDLFRQNHAEWDIWSKNEKVKRIKKINDTLDNYHNQQVI 1274          

HSP 2 Score: 922.539 bits (2383), Expect = 0.000e+0
Identity = 494/530 (93.21%), Postives = 496/530 (93.58%), Query Frame = 3
Query:   57 MLPKKKEERNKSAQSNSPYHKKLKEGTLTGMNSDGKHARIGIWPEWSEIDINNEKWDIPLKTKEKDKARSPLMTQNLFEDPEGLLKLPSSLKVFKWKRTYEYFTKNPVIVDTEEGIHKFDIFSLNEHLFISETMRWIICQINNLWITSEKKCAXXXXXXXXXXXXXXXNGTHHTWRFWEHIYSLNKVGKGFPQYNPAGKYIVKLFWMGDWRKILVDDTLPFDENDRLLLPVTTITNELWPXXXXXXXXXXXXXXYNFSSNETEFGDFSVIHSLTGWIPQKKIVSKEYRNQIVNDLSKLLNHWTYSNENCNLTGDKNDISNVEDIQHIEVNLDKTDNKEILLXXXXXXXXXXXXXXXXXXXXXXXXXXLFDGKNLNENPETLVIASYNSSFNKLQMLSTSKMASRYEALRKIGMPSIYSHPVILNYYRDSPLEKSISPELIPSWKLIRPFIKVDIPQLNDCTTHSAYFDSKNVSNQKDDQSKYIEIQTPFINYKLSKKNNSTKEIFDENLENLKIIPHCTSKSNNQIMDSE 1646
            MLPKKKEERNKSAQSNSPYHKKLKEGTLTGMNSDGKHARIGIWPEWSEIDINNEKWDIPLKTKEKDKARSPLMTQNLFEDPEGLLKLPSSLKVFKWKRTYEYFTKNPVIVDTEEGIHKFDIFSLNEHLFISETMRWIICQINNLWITSEKKCAIESSDTQIQDISISSNGTHHTWRFWEHIYSLNKVGKGFPQYNPAGKYIVKLFWMGDWRKILVDDTLPFDENDRLLLPVTTITNELWPLILSKALLKIASLSYNFSSNETEFGDFSVIHSLTGWIPQKKIVSKEYRNQIVNDLSKLLNHWTYSNENCNLTGDKNDISNVEDIQ I     K  +K                          KSEKLFDGKNLNENPETLVIASYNSSFNKLQMLSTSKMASRYEALRKIGMPSIYSHPVILNYYRDSPLEKSISPELIPSWKLIRPFIKVDIPQLNDCTTHSAYFDSKNVSNQKDDQSKYIEIQTPFINYKLSKKNNSTKE+FDENLENLKIIPHCTSKSNNQIMDSE
Sbjct:    1 MLPKKKEERNKSAQSNSPYHKKLKEGTLTGMNSDGKHARIGIWPEWSEIDINNEKWDIPLKTKEKDKARSPLMTQNLFEDPEGLLKLPSSLKVFKWKRTYEYFTKNPVIVDTEEGIHKFDIFSLNEHLFISETMRWIICQINNLWITSEKKCAIESSDTQIQDISISSNGTHHTWRFWEHIYSLNKVGKGFPQYNPAGKYIVKLFWMGDWRKILVDDTLPFDENDRLLLPVTTITNELWPLILSKALLKIASLSYNFSSNETEFGDFSVIHSLTGWIPQKKIVSKEYRNQIVNDLSKLLNHWTYSNENCNLTGDKNDISNVEDIQKINQKKKKEKDKT-------------------------KSEKLFDGKNLNENPETLVIASYNSSFNKLQMLSTSKMASRYEALRKIGMPSIYSHPVILNYYRDSPLEKSISPELIPSWKLIRPFIKVDIPQLNDCTTHSAYFDSKNVSNQKDDQSKYIEIQTPFINYKLSKKNNSTKEMFDENLENLKIIPHCTSKSNNQIMDSE 505          

HSP 3 Score: 437.187 bits (1123), Expect = 6.594e-130
Identity = 211/229 (92.14%), Postives = 216/229 (94.32%), Query Frame = 3
Query: 1848 TYRYTESLSDFKTTNIDQKEPFYLFTDNIDNSEIIICLSVFCKWFTHNDPYYLPDNANNRNSPSINIVRDKSNNLE---NDNDPFATDQIQGVFFAENHYWKNFKIGKCLKRAKTNGTKAVSLKFPPGRHCLRIFIQALNGFHCKFISQNQFFFGTEDEIIPLAVECPKRIQSLGIDIISAFKNMISNFSNDEERKSNEIALNNLILDFSKNSHSRALTSEFTQVFSQG 2525
            T +    + D +TTNIDQKEPFYLFTDNIDNSEIIICLSVFCKWFTHNDPYYLPDNANNRNSPSINIVRDKSNNLE   +DNDPFATDQIQGVFFAENHYWKNFKIGKCLKRAKTNGTKAVSLKFPPGRHCLRIFIQALNGFHCKFISQNQFFFGTEDEIIPLAVECPKRIQSLGIDIISAFKNMISNFSNDEERKSNEIALNNLILDFSKNSHSRALTSEFTQ   +G
Sbjct:  494 TSKSNNQIMDSETTNIDQKEPFYLFTDNIDNSEIIICLSVFCKWFTHNDPYYLPDNANNRNSPSINIVRDKSNNLESNNDDNDPFATDQIQGVFFAENHYWKNFKIGKCLKRAKTNGTKAVSLKFPPGRHCLRIFIQALNGFHCKFISQNQFFFGTEDEIIPLAVECPKRIQSLGIDIISAFKNMISNFSNDEERKSNEIALNNLILDFSKNSHSRALTSEFTQKLIKG 722          
BLAST of Androglobin vs. Planmine SMEST
Match: SMESG000047986.1 (SMESG000047986.1)

HSP 1 Score: 1025.39 bits (2650), Expect = 0.000e+0
Identity = 538/569 (94.55%), Postives = 545/569 (95.78%), Query Frame = 3
Query:  909 KEYRNQIVNDLSKLLNHWTYSNENCNLTGDKNDISNVEDIQHIEVNLDKTDNKEILLXXXXXXXXXXXXXXXXXXXXXXXXXXLFDGKNLNENPETLVIASYNSSFNKLQMLSTSKMASRYEALRKIGMPSIYSHPVILNYYRDSPLEKSISPELIPSWKLIRPFIKVDIPQLNDCTTHSAYFDSKNVSNQKDDQSKYIEIQTPFINYKLSKKNNSTKEIFDENLENLKIIPHCTSKSNNQIMDSENMGSLDSNFGNSNSKLQ-----------------IPCEFSYENEVLNLRDEERYDFSKGLMKSWIDVDTFFECFEVLYIYHKTETYRYTESLSDFKTTNIDQKEPFYLFTDNIDNSEIIICLSVFCKWFTHNDPYYLPDNANNRNSPSINIVRDKSNNLENDNDPFATDQIQGVFFAENHYWKNFKIGKCLKRAKTNGTKAVSLKFPPGRHCLRIFIQALNGFHCKFISQNQFFFGTEDEIIPLAVECPKRIQSLGIDIISAFKNMISNFSNDEERKSNEIALNNLILDFSKNSHSRALTSEFTQVFSQGIIKTIKMCNRELL 2564
            KEYRNQIVNDLSKLLNHWTYSNENCNLTGDKNDISNVEDIQHIEVNLDKTDNKEILLKDKNKKDTKENKPKEKKEKDKTKSEKLFDGKNLNENPETLVIASYNSSFNKLQMLSTSKMASRYEALRKIGMPSIYSHPVILNYYRDSPLEKSISPELIPSWKLIRPFIKVDIPQLNDCTTHSAYFDSKNVSNQKDDQSKYIEIQTPFINYKLSKKNNSTKE+FDENLENLKIIPHCTSKSNNQIMDSENMGSLDSNFGNSNSKLQ                 +PCEFSYENEVLNLRDEERYDFSKGLMKSWIDVDTFFECFEVLYIYHKTETYRYTESLSDFKTTNIDQKEPFYLFTDNIDNSEIIICLSVFCKWFTHNDPYYLPDNANNRNSPSINIVRDKSNNLENDNDPFATDQIQGVFFAENHYWKNFKIGKCLKRAKTNGTKAVSLKFPPGRHCLRIFIQALNGFHCKFISQNQFFFGTEDEIIPLAVECPKRIQSLGIDIISAFKNMISNFSNDEERKSNEIALNNLILDFSKNSHSRALTSEFTQVFS+ I++ +   N  L+
Sbjct:    1 KEYRNQIVNDLSKLLNHWTYSNENCNLTGDKNDISNVEDIQHIEVNLDKTDNKEILLKDKNKKDTKENKPKEKKEKDKTKSEKLFDGKNLNENPETLVIASYNSSFNKLQMLSTSKMASRYEALRKIGMPSIYSHPVILNYYRDSPLEKSISPELIPSWKLIRPFIKVDIPQLNDCTTHSAYFDSKNVSNQKDDQSKYIEIQTPFINYKLSKKNNSTKEMFDENLENLKIIPHCTSKSNNQIMDSENMGSLDSNFGNSNSKLQSKVNLIKVNLNEAKNNLVPCEFSYENEVLNLRDEERYDFSKGLMKSWIDVDTFFECFEVLYIYHKTETYRYTESLSDFKTTNIDQKEPFYLFTDNIDNSEIIICLSVFCKWFTHNDPYYLPDNANNRNSPSINIVRDKSNNLENDNDPFATDQIQGVFFAENHYWKNFKIGKCLKRAKTNGTKAVSLKFPPGRHCLRIFIQALNGFHCKFISQNQFFFGTEDEIIPLAVECPKRIQSLGIDIISAFKNMISNFSNDEERKSNEIALNNLILDFSKNSHSRALTSEFTQVFSE-ILEVVIHLNLNLI 568          
BLAST of Androglobin vs. Planmine SMEST
Match: SMESG000047986.1 (SMESG000047986.1)

HSP 1 Score: 1019.22 bits (2634), Expect = 0.000e+0
Identity = 537/572 (93.88%), Postives = 545/572 (95.28%), Query Frame = 3
Query:  909 KEYRNQIVNDLSKLLNHWTYSNENCNLTGDKNDISNVEDIQHIEVNLDKTDNKEILLXXXXXXXXXXXXXXXXXXXXXXXXXXLFDGKNLNENPETLVIASYNSSFNKLQMLSTSKMASRYEALRKIGMPSIYSHPVILNYYRDSPLEKSISPELIPSWKLIRPFIKVDIPQLNDCTTHSAYFDSKNVSNQKDDQSKYIEIQTPFINYKLSKKNNSTKEIFDENLENLKIIPHCTSKSNNQIMDSENMGSLDSNFGNSNSKLQ-----------------IPCEFSYENEVLNLRDEERYDFSKGLMKSWIDVDTFFECFEVLYIYHKTETYRYTESLSDFKTTNIDQKEPFYLFTDNIDNSEIIICLSVFCKWFTHNDPYYLPDNANNRNSPSINIVRDKSNNLE---NDNDPFATDQIQGVFFAENHYWKNFKIGKCLKRAKTNGTKAVSLKFPPGRHCLRIFIQALNGFHCKFISQNQFFFGTEDEIIPLAVECPKRIQSLGIDIISAFKNMISNFSNDEERKSNEIALNNLILDFSKNSHSRALTSEFTQVFSQGIIKTIKMCNRELL 2564
            KEYRNQIVNDLSKLLNHWTYSNENCNLTGDKNDISNVEDIQHIEVNLDKTDNKEILLKDKNKKDTKENKPKEKKEKDKTKSEKLFDGKNLNENPETLVIASYNSSFNKLQMLSTSKMASRYEALRKIGMPSIYSHPVILNYYRDSPLEKSISPELIPSWKLIRPFIKVDIPQLNDCTTHSAYFDSKNVSNQKDDQSKYIEIQTPFINYKLSKKNNSTKE+FDENLENLKIIPHCTSKSNNQIMDSENMGSLDSNFGNSNSKLQ                 +PCEFSYENEVLNLRDEERYDFSKGLMKSWIDVDTFFECFEVLYIYHKTETYRYTESLSDFKTTNIDQKEPFYLFTDNIDNSEIIICLSVFCKWFTHNDPYYLPDNANNRNSPSINIVRDKSNNLE   +DNDPFATDQIQGVFFAENHYWKNFKIGKCLKRAKTNGTKAVSLKFPPGRHCLRIFIQALNGFHCKFISQNQFFFGTEDEIIPLAVECPKRIQSLGIDIISAFKNMISNFSNDEERKSNEIALNNLILDFSKNSHSRALTSEFTQVFS+ I++ +   N  L+
Sbjct:    1 KEYRNQIVNDLSKLLNHWTYSNENCNLTGDKNDISNVEDIQHIEVNLDKTDNKEILLKDKNKKDTKENKPKEKKEKDKTKSEKLFDGKNLNENPETLVIASYNSSFNKLQMLSTSKMASRYEALRKIGMPSIYSHPVILNYYRDSPLEKSISPELIPSWKLIRPFIKVDIPQLNDCTTHSAYFDSKNVSNQKDDQSKYIEIQTPFINYKLSKKNNSTKEMFDENLENLKIIPHCTSKSNNQIMDSENMGSLDSNFGNSNSKLQSKVNLIKVNLNEAKNNLVPCEFSYENEVLNLRDEERYDFSKGLMKSWIDVDTFFECFEVLYIYHKTETYRYTESLSDFKTTNIDQKEPFYLFTDNIDNSEIIICLSVFCKWFTHNDPYYLPDNANNRNSPSINIVRDKSNNLESNNDDNDPFATDQIQGVFFAENHYWKNFKIGKCLKRAKTNGTKAVSLKFPPGRHCLRIFIQALNGFHCKFISQNQFFFGTEDEIIPLAVECPKRIQSLGIDIISAFKNMISNFSNDEERKSNEIALNNLILDFSKNSHSRALTSEFTQVFSE-ILEVVIHLNLNLI 571          
BLAST of Androglobin vs. Planmine SMEST
Match: SMESG000047986.1 (SMESG000047986.1)

HSP 1 Score: 970.689 bits (2508), Expect = 0.000e+0
Identity = 530/629 (84.26%), Postives = 539/629 (85.69%), Query Frame = 3
Query:  909 KEYRNQIVNDLSKLLNHWTYSNENCNLTGDKNDISNVEDIQHIEVNLDKTDNKEILLXXXXXXXXXXXXXXXXXXXXXXXXXXLFDGKNLNENPETLVIASYNSSFNKLQMLSTSKMASRYEALRKIGMPSIYSHPVILNYYRDSPLEKSISPELIPSWKLIRPFIKVDIPQLNDCTTHSAYFDSKNVSNQKDDQSKYIEIQTPFINYKLSKKNNSTKEIFDENLENLKIIPHCTSKSNNQIMDSENMGSLDSNFGNSNSKLQ-----------------IPCEFSYENEVLNLRDEERYDFSKGLMKSWIDVDTFFECFEVLYIYHKTETYRYTESLSDFKTTNI---------DQKE-------------------------PFYL-------------FTDNID-------------NSEIIICLSVFCKWFTHNDPYYLPDNANNRNSPSINIVRDKSNNLENDNDPFATDQIQGVFFAENHYWKNFKIGKCLKRAKTNGTKAVSLKFPPGRHCLRIFIQALNGFHCKFISQNQFFFGTEDEIIPLAVECPKRIQSLGIDIISAFKNMISNFSNDEERKSNEIALNNLILDFSKNSHSRALTSEFTQVFSQGIIKTIKMCNRELL 2564
            KEYRNQIVNDLSKLLNHWTYSNENCNLTGDKNDISNVEDIQHIEVNLDKTDNKEILLKDKNKKDTKENKPKEKKEKDKTKSEKLFDGKNLNENPETLVIASYNSSFNKLQMLSTSKMASRYEALRKIGMPSIYSHPVILNYYRDSPLEKSISPELIPSWKLIRPFIKVDIPQLNDCTTHSAYFDSKNVSNQKDDQSKYIEIQTPFINYKLSKKNNSTKE+FDENLENLKIIPHCTSKSNNQIMDSENMGSLDSNFGNSNSKLQ                 +PCEFSYENEVLNLRDEERYDFSKGLMKSWIDVDTFFECFEVLYIYHKTETYRYTESLSDFK T++         DQK                          P  L              T NID             NSEIIICLSVFCKWFTHNDPYYLPDNANNRNSPSINIVRDKSNNLENDNDPFATDQIQGVFFAENHYWKNFKIGKCLKRAKTNGTKAVSLKFPPGRHCLRIFIQALNGFHCKFISQNQFFFGTEDEIIPLAVECPKRIQSLGIDIISAFKNMISNFSNDEERKSNEIALNNLILDFSKNSHSRALTSEFTQVFS+ I++ +   N  L+
Sbjct:    1 KEYRNQIVNDLSKLLNHWTYSNENCNLTGDKNDISNVEDIQHIEVNLDKTDNKEILLKDKNKKDTKENKPKEKKEKDKTKSEKLFDGKNLNENPETLVIASYNSSFNKLQMLSTSKMASRYEALRKIGMPSIYSHPVILNYYRDSPLEKSISPELIPSWKLIRPFIKVDIPQLNDCTTHSAYFDSKNVSNQKDDQSKYIEIQTPFINYKLSKKNNSTKEMFDENLENLKIIPHCTSKSNNQIMDSENMGSLDSNFGNSNSKLQSKVNLIKVNLNEAKNNLVPCEFSYENEVLNLRDEERYDFSKGLMKSWIDVDTFFECFEVLYIYHKTETYRYTESLSDFKLTSMITYVNANSRDQKRSVSSNVSSTAKKSKDILRDPILSKSPITLNVNDTLSYNVNNFKTTNIDQKEPFYLFTDNIDNSEIIICLSVFCKWFTHNDPYYLPDNANNRNSPSINIVRDKSNNLENDNDPFATDQIQGVFFAENHYWKNFKIGKCLKRAKTNGTKAVSLKFPPGRHCLRIFIQALNGFHCKFISQNQFFFGTEDEIIPLAVECPKRIQSLGIDIISAFKNMISNFSNDEERKSNEIALNNLILDFSKNSHSRALTSEFTQVFSE-ILEVVIHLNLNLI 628          
The following BLAST results are available for this feature:
BLAST of Androglobin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ADGB3.223e-5723.10androglobin [Source:HGNC Symbol;Acc:HGNC:21212][more]
ADGB4.616e-5424.73androglobin [Source:HGNC Symbol;Acc:HGNC:21212][more]
ADGB7.551e-3543.58androglobin [Source:HGNC Symbol;Acc:HGNC:21212][more]
ADGB9.141e-2836.70androglobin [Source:HGNC Symbol;Acc:HGNC:21212][more]
ADGB2.527e-2527.90androglobin [Source:HGNC Symbol;Acc:HGNC:21212][more]
back to top
BLAST of Androglobin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
clp-22.244e-1229.38CaLPain family [Source:UniProtKB/TrEMBL;Acc:Q2214... [more]
back to top
BLAST of Androglobin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Androglobin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
adgb3.239e-12225.46androglobin [Source:ZFIN;Acc:ZDB-GENE-041001-205][more]
capn74.966e-1140.00calpain 7 [Source:ZFIN;Acc:ZDB-GENE-111111-1][more]
back to top
BLAST of Androglobin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
cyp20a13.264e-1040.00cytochrome P450 family 20 subfamily A member 1 [So... [more]
cyp20a13.415e-1040.00cytochrome P450 family 20 subfamily A member 1 [So... [more]
cyp20a13.449e-1040.00cytochrome P450 family 20 subfamily A member 1 [So... [more]
cyp20a13.478e-1040.00cytochrome P450 family 20 subfamily A member 1 [So... [more]
back to top
BLAST of Androglobin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Adgb1.639e-6924.79androglobin [Source:MGI Symbol;Acc:MGI:3605549][more]
Adgb4.332e-6924.86androglobin [Source:MGI Symbol;Acc:MGI:3605549][more]
Adgb3.401e-6824.72androglobin [Source:MGI Symbol;Acc:MGI:3605549][more]
Adgb5.592e-5545.45androglobin [Source:MGI Symbol;Acc:MGI:3605549][more]
Adgb1.911e-2025.06androglobin [Source:MGI Symbol;Acc:MGI:3605549][more]
back to top
BLAST of Androglobin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|G3UZ78|ADGB_MOUSE3.031e-6824.86Androglobin OS=Mus musculus OX=10090 GN=Adgb PE=1 ... [more]
sp|Q8N7X0|ADGB_HUMAN1.548e-5623.10Androglobin OS=Homo sapiens OX=9606 GN=ADGB PE=2 S... [more]
sp|Q9R1S8|CAN7_MOUSE1.131e-838.00Calpain-7 OS=Mus musculus OX=10090 GN=Capn7 PE=2 S... [more]
sp|Q9Y6W3|CAN7_HUMAN1.284e-838.00Calpain-7 OS=Homo sapiens OX=9606 GN=CAPN7 PE=1 SV... [more]
sp|A0FKG7|CAN7_PIG8.253e-837.00Calpain-7 OS=Sus scrofa OX=9823 GN=CAPN7 PE=2 SV=1[more]
back to top
BLAST of Androglobin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1L8G7V61.043e-13527.86Calpain catalytic domain-containing protein OS=Xen... [more]
A0A0K1NWP21.387e-13027.32Androglobin OS=Callorhinchus milii OX=7868 PE=2 SV... [more]
A0A4W3IEI01.393e-13027.42Calpain catalytic domain-containing protein OS=Cal... [more]
A0A4D9EIY76.827e-12727.41Putative tubulin polyglutamylase TTLL2 OS=Platyste... [more]
A0A3Q0CHX95.682e-12326.84androglobin OS=Mesocricetus auratus OX=10036 GN=Ad... [more]
back to top
BLAST of Androglobin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000014829.23.004e-4722.94pep primary_assembly:Astyanax_mexicanus-2.0:3:6958... [more]
ENSAMXT00000052548.15.547e-2345.05pep primary_assembly:Astyanax_mexicanus-2.0:3:6955... [more]
ENSAMXT00000031082.11.569e-1742.86pep primary_assembly:Astyanax_mexicanus-2.0:3:6955... [more]
capn76.906e-1139.00calpain 7 [Source:NCBI gene;Acc:103047868][more]
capn78.093e-1139.00calpain 7 [Source:NCBI gene;Acc:103047868][more]
back to top
BLAST of Androglobin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Androglobin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Androglobin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO440281.269e-5832.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO308641.248e-3022.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO273571.068e-1750.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO457972.727e-1036.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Androglobin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSORLT00000017755.23.332e-2234.15pep primary_assembly:ASM223467v1:24:8578805:858076... [more]
ENSORLT00000037529.12.327e-1722.96androglobin [Source:NCBI gene;Acc:101164862][more]
capn71.325e-1039.00calpain 7 [Source:NCBI gene;Acc:101162069][more]
capn71.353e-1039.00calpain 7 [Source:NCBI gene;Acc:101162069][more]
back to top
BLAST of Androglobin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000053594.10.000e+092.38SMESG000053594.1[more]
SMESG000053594.16.594e-13099.46SMESG000053594.1[more]
SMESG000047986.10.000e+094.55SMESG000047986.1[more]
SMESG000047986.10.000e+093.88SMESG000047986.1[more]
SMESG000047986.10.000e+084.26SMESG000047986.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032126 ID=SMED30032126|Name=Androglobin|organism=Schmidtea mediterranea sexual|type=transcript|length=4608bp
TTTTTGAGCATCAGTATTTAACAGAATTTTAATTATAGAAGATAAAGAAT
ATAAATATGTTACCAAAAAAAAAAGAAGAACGCAATAAATCAGCTCAGTC
GAATTCTCCTTATCATAAAAAGTTAAAAGAAGGGACTTTAACAGGCATGA
ATAGTGACGGAAAACATGCTAGAATAGGTATTTGGCCGGAGTGGTCAGAA
ATTGATATTAATAATGAAAAATGGGATATCCCTCTGAAAACAAAAGAAAA
AGATAAAGCGAGATCTCCACTAATGACACAGAACTTATTTGAAGATCCAG
AAGGACTGTTGAAACTTCCGTCCTCATTAAAAGTATTCAAATGGAAGAGA
ACATATGAATATTTCACAAAAAATCCAGTAATTGTCGATACTGAAGAAGG
AATTCACAAATTTGATATTTTCTCCTTGAACGAACATTTATTTATTTCCG
AAACAATGCGATGGATAATTTGTCAAATAAATAATTTATGGATAACCTCT
GAAAAGAAATGTGCTATTGAATCTTCTGATACTCAAATCCAAGATATCAG
TATAAGCTCCAATGGAACTCATCATACATGGAGGTTTTGGGAGCATATTT
ACTCTTTAAATAAAGTTGGAAAAGGATTTCCACAGTATAATCCAGCTGGA
AAATACATCGTTAAATTATTTTGGATGGGAGATTGGCGTAAAATTTTAGT
CGATGACACTTTACCATTCGATGAGAATGACAGACTTTTATTACCAGTTA
CTACAATCACCAATGAACTTTGGCCACTCATTTTAAGTAAGGCATTATTA
AAAATTGCTTCGTTGAGCTACAATTTTTCTTCAAATGAGACCGAATTTGG
AGATTTTAGTGTTATTCATTCACTGACTGGCTGGATTCCTCAAAAGAAAA
TAGTGAGTAAGGAGTATCGAAATCAAATAGTGAATGATTTAAGCAAGCTA
TTGAATCACTGGACTTATTCAAATGAAAATTGTAATTTGACAGGAGATAA
AAATGATATTAGTAATGTTGAAGATATTCAACATATTGAAGTTAATTTGG
ATAAAACTGATAATAAAGAAATTCTATTAAAAGATAAAAATAAAAAAGAT
ACAAAAGAAAATAAACCAAAAGAAAAAAAAGAAAAAGATAAAACTAAATC
GGAAAAATTGTTTGACGGAAAAAATTTAAACGAAAATCCGGAAACTTTAG
TGATAGCTTCATACAATTCTTCATTCAATAAACTTCAAATGTTATCTACT
TCGAAAATGGCTAGTCGCTATGAAGCTCTGAGAAAAATTGGAATGCCCTC
AATTTATTCCCACCCAGTGATTTTAAATTATTATCGCGATAGTCCTCTGG
AAAAATCTATTTCTCCTGAATTAATACCATCTTGGAAATTAATAAGACCA
TTTATTAAAGTTGATATACCTCAACTCAATGATTGTACAACACATAGTGC
ATATTTTGATTCTAAAAACGTATCTAATCAAAAGGATGATCAATCAAAAT
ACATTGAAATTCAAACACCTTTTATAAATTACAAATTATCTAAAAAAAAT
AATTCAACCAAAGAAATATTTGATGAAAACTTAGAAAACTTGAAAATAAT
TCCTCATTGCACCAGTAAATCAAATAATCAAATTATGGATTCCGAAAATA
TGGGCTCCTTAGATAGCAATTTTGGAAATTCCAATTCAAAGTTACAAATA
CCATGTGAATTTTCGTATGAAAATGAAGTTTTAAATTTAAGGGATGAAGA
AAGATACGATTTTAGTAAAGGATTGATGAAAAGTTGGATAGATGTTGATA
CATTTTTTGAGTGTTTCGAAGTTCTTTATATTTATCATAAAACAGAAACG
TATCGATACACGGAAAGTTTATCAGATTTTAAGACGACCAATATCGATCA
GAAGGAACCATTTTATTTATTTACTGATAATATTGATAATTCAGAAATTA
TAATTTGTTTATCTGTTTTTTGTAAATGGTTCACGCATAATGATCCATAT
TATTTACCAGACAATGCCAATAATAGAAATTCCCCGTCCATAAATATTGT
TCGAGACAAGTCAAACAATTTGGAAAATGATAACGATCCTTTTGCTACTG
ATCAAATTCAAGGGGTATTTTTTGCTGAAAATCACTATTGGAAAAATTTT
AAAATTGGAAAATGCTTGAAAAGAGCCAAAACTAATGGTACTAAAGCTGT
TTCATTGAAATTTCCTCCAGGAAGGCATTGTTTAAGAATTTTTATTCAAG
CTTTAAATGGATTTCATTGTAAATTTATTTCACAAAACCAATTCTTTTTC
GGTACAGAAGATGAAATAATTCCTTTAGCCGTGGAATGCCCAAAAAGAAT
ACAGAGTCTTGGAATAGATATAATCTCTGCCTTTAAAAATATGATTTCCA
ATTTTTCTAATGACGAAGAAAGAAAATCAAATGAAATAGCATTAAACAAT
TTAATTCTAGATTTTAGTAAAAATAGTCACTCCAGAGCATTGACTTCAGA
ATTTACTCAGGTTTTCAGTCAAGGTATTATAAAAACTATCAAAATGTGTA
ATAGAGAACTTCTTACTTCTGACATGATTTTTGCACTTCGTGCTATAATT
TTAGACTTTCAAAGTTATATTACTTTGACTATTTCCAACAAACAAAATAA
TAACTCAAGCAGAAATTCTGCTAAAATTCCACCAATCAATTCTAAAATTG
ATAATAGGAAACAATCGTCCACAAAATCACTAACGAATATTGAAAATAAA
GAAGAAAAAAGAAATGAATTTTTTGGAGATTATTCTTCTCGTGATATGTT
GTACATTATACGATTGCAGAAACTAATTAAAGGATATTACGTTAGAAAAG
TCATAATGGCTCGCAGTCCTCGATCAAATTATCACGATCGGGTTGTAAAC
GAGCTCAATAAAATTAAAACTTTAATTGAACATAATAGTTCTGAAATTGG
CAATAATCTTTTAAATGAAATTTTTGAAATATATCCTCAAATTTCAAAAC
ATTATGGATTGGATAATGATCAATTAAATCATATAAAGTTCCAGGAATTT
AAAGGGAATGGAATATTGCAACCCGTTAATGGATTTGGGATGTTATTCCG
AGAAATATTTCATATTGATCCTCTCACTAAGAAAACTGATGACATACTAA
TTAAATTAAATTGTAATGTTCAAAAATGTACTTTATCCATAATTAATAAC
GATAACGGAGAAAAAACTACAGAAATTATTCTAAAACGATTAAATTTCAA
GGCATTTGTTCCCAATAGTAATGGTTATACTTTGATAGCCACAACTAAAG
ATGTCGAAAATGTTGTTCCGTGGAAACTGAAAATAATAGGTGGTGCTAAT
AATTTGTTACCAACTTTCATAAAACAAGAACTATGCAATGATTTTTCCAT
TTTCAAAATCAGGGATTATTATGTTCCAGAAGAAGATGGATTATTATTTC
ATCAAATTGCTAAGATAAAACTCGATCATCCTATATCGGTTTTTGTCAAG
TTATCTAATCCGAATGTTTCTTTGCGTTTATCTATATATAATTTTGATGA
AGAATTATATTTTGTTGAAGGCATCGGAGAAGCGTATATAGAATCATTTT
TACTCTTGAAAGACTATTTTTGTGAAGAACAAGTTGATTTAGTGCGTTCT
GGGTCAAGGAATTCAACAAAATTGAAAAAGGGCCAAGAAAAAGTTGAAAG
ATATTCTTCTAAAACCTCTGGGACTAATAGTTCATGTAGTAATGAGGGAA
AAAAAGTTTATAAATATTCAATTCGAGCTTCCGTCAATAATTCTACATGG
CTTTTATCTCAAGATAATGAAGAATTTGTTAATAAGTTGAAATTATTGAA
AAGAAAGAACATGAATGAACAAACATTAAACGATAATCCAAGCAAATTAA
TTCAAAGTTCAGAATTTACGAAAAAGGAAAATGTTCAAAAGATCCTACCA
AAAACCAAAACTAAAGAAAGGGGTCAAGAAGGAGTTAAAATATTGAAAGG
TACCGAAAAACCAATTACAAAGAATAACCCTGTTGATAACAATACTTCTC
GACCAAATTCGACTTATTTTGAATCTGATAAACAACATTGGACTGCTTTA
ATTATTAGTGACACTTGTTTAGAAGATAACATCCAAATATATAAGAATAA
TGAAAAACATGATACATTGTGTTCTACTAAAAAAATATGGTTAGAGATGG
ATACTTTGAGATTTGAAAAGGGTAAACAAGTTCAAATGAAGTACAATGAA
GAAAATCAAGTTACAGATCAAAGCGATAGGAACTCATCCGAGAAATATTT
AGATTTATCATTGTTTTATCCAATTGATATATCGAAAAATGATGACACTT
TCTATCAGTCAAGATATAATTTTATTGATTTATTTCGTCAAAACCATGCC
GAATGGGACATATGGAGCAAAAATGAAAAAGTTAAAAGAATTAAAAAAAT
TAATGATACTTTCGATAATTATCATAACCAACAGAAAATCGTTAATTCTA
ACCGGCTTATATACTTCAAAATTAGGGAGAAAATAAAACACGAATAATTT
AATGTGAATCCTAATATATTTTCAATGTCAATTTTTAAATAGCAAATCGT
TAATCGGC
back to top

protein sequence of SMED30032126-orf-1

>SMED30032126-orf-1 ID=SMED30032126-orf-1|Name=SMED30032126-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1497bp
MLPKKKEERNKSAQSNSPYHKKLKEGTLTGMNSDGKHARIGIWPEWSEID
INNEKWDIPLKTKEKDKARSPLMTQNLFEDPEGLLKLPSSLKVFKWKRTY
EYFTKNPVIVDTEEGIHKFDIFSLNEHLFISETMRWIICQINNLWITSEK
KCAIESSDTQIQDISISSNGTHHTWRFWEHIYSLNKVGKGFPQYNPAGKY
IVKLFWMGDWRKILVDDTLPFDENDRLLLPVTTITNELWPLILSKALLKI
ASLSYNFSSNETEFGDFSVIHSLTGWIPQKKIVSKEYRNQIVNDLSKLLN
HWTYSNENCNLTGDKNDISNVEDIQHIEVNLDKTDNKEILLKDKNKKDTK
ENKPKEKKEKDKTKSEKLFDGKNLNENPETLVIASYNSSFNKLQMLSTSK
MASRYEALRKIGMPSIYSHPVILNYYRDSPLEKSISPELIPSWKLIRPFI
KVDIPQLNDCTTHSAYFDSKNVSNQKDDQSKYIEIQTPFINYKLSKKNNS
TKEIFDENLENLKIIPHCTSKSNNQIMDSENMGSLDSNFGNSNSKLQIPC
EFSYENEVLNLRDEERYDFSKGLMKSWIDVDTFFECFEVLYIYHKTETYR
YTESLSDFKTTNIDQKEPFYLFTDNIDNSEIIICLSVFCKWFTHNDPYYL
PDNANNRNSPSINIVRDKSNNLENDNDPFATDQIQGVFFAENHYWKNFKI
GKCLKRAKTNGTKAVSLKFPPGRHCLRIFIQALNGFHCKFISQNQFFFGT
EDEIIPLAVECPKRIQSLGIDIISAFKNMISNFSNDEERKSNEIALNNLI
LDFSKNSHSRALTSEFTQVFSQGIIKTIKMCNRELLTSDMIFALRAIILD
FQSYITLTISNKQNNNSSRNSAKIPPINSKIDNRKQSSTKSLTNIENKEE
KRNEFFGDYSSRDMLYIIRLQKLIKGYYVRKVIMARSPRSNYHDRVVNEL
NKIKTLIEHNSSEIGNNLLNEIFEIYPQISKHYGLDNDQLNHIKFQEFKG
NGILQPVNGFGMLFREIFHIDPLTKKTDDILIKLNCNVQKCTLSIINNDN
GEKTTEIILKRLNFKAFVPNSNGYTLIATTKDVENVVPWKLKIIGGANNL
LPTFIKQELCNDFSIFKIRDYYVPEEDGLLFHQIAKIKLDHPISVFVKLS
NPNVSLRLSIYNFDEELYFVEGIGEAYIESFLLLKDYFCEEQVDLVRSGS
RNSTKLKKGQEKVERYSSKTSGTNSSCSNEGKKVYKYSIRASVNNSTWLL
SQDNEEFVNKLKLLKRKNMNEQTLNDNPSKLIQSSEFTKKENVQKILPKT
KTKERGQEGVKILKGTEKPITKNNPVDNNTSRPNSTYFESDKQHWTALII
SDTCLEDNIQIYKNNEKHDTLCSTKKIWLEMDTLRFEKGKQVQMKYNEEN
QVTDQSDRNSSEKYLDLSLFYPIDISKNDDTFYQSRYNFIDLFRQNHAEW
DIWSKNEKVKRIKKINDTFDNYHNQQKIVNSNRLIYFKIREKIKHE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR001300Peptidase_C2_calpain_cat
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
Vocabulary: molecular function
TermDefinition
GO:0004198calcium-dependent cysteine-type endopeptidase activity
GO:0019825oxygen binding
GO:0020037heme binding
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular