SMED30032120

Overview
NameSMED30032120
Smed IDSMED30032120
Length (bp)1063
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30032120 (SMED30032120) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30032120 (SMED30032120) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30032120 (SMED30032120) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30032120 (SMED30032120) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032120

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30032120h1SMcG0015278 dd_Smed_v4_5753_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30032120h1SMcG0015278 dd_Smed_v4_5753_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30032120h1SMcG0015278 dd_Smed_v4_5753_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30032120h1SMcG0015278 dd_Smed_v4_5753_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30032120h1SMcG0015278 dd_Smed_v4_5753_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30032120 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.002135:5826..6888 -5315
Homology
BLAST of SMED30032120 vs. Ensembl Human
Match: DNAJC27 (DnaJ heat shock protein family (Hsp40) member C27 [Source:HGNC Symbol;Acc:HGNC:30290])

HSP 1 Score: 102.449 bits (254), Expect = 1.848e-25
Identity = 59/164 (35.98%), Postives = 90/164 (54.88%), Query Frame = -1
Query:  248 LKVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQT--YSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESFE 733
            +KVI +G+ + GK+ IIK Y +     +Y  TIGIDYG       +    +EI+VNI+D +G P F E R E Y +T  V++VYD+ +  +F  +  WL E +     +  +E I   +  NK D T  R VD   G+   +S   +YFETS+++ + I E F+
Sbjct:   17 IKVISMGNAEVGKSCIIKRYCEKRFVSKYLATIGIDYGVTKVHVRD----REIKVNIFDMAGHPFFYEVRNEFYKDTQGVILVYDVGQKDSFDALDAWLAEMKQELGPHGNMENIIFVVCANKIDCTKHRCVDESEGRLWAESKGFLYFETSAQTGEGINEMFQ 176          
BLAST of SMED30032120 vs. Ensembl Human
Match: DNAJC27 (DnaJ heat shock protein family (Hsp40) member C27 [Source:HGNC Symbol;Acc:HGNC:30290])

HSP 1 Score: 101.679 bits (252), Expect = 2.830e-24
Identity = 59/164 (35.98%), Postives = 90/164 (54.88%), Query Frame = -1
Query:  248 LKVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQT--YSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESFE 733
            +KVI +G+ + GK+ IIK Y +     +Y  TIGIDYG       +    +EI+VNI+D +G P F E R E Y +T  V++VYD+ +  +F  +  WL E +     +  +E I   +  NK D T  R VD   G+   +S   +YFETS+++ + I E F+
Sbjct:   17 IKVISMGNAEVGKSCIIKRYCEKRFVSKYLATIGIDYGVTKVHVRD----REIKVNIFDMAGHPFFYEVRNEFYKDTQGVILVYDVGQKDSFDALDAWLAEMKQELGPHGNMENIIFVVCANKIDCTKHRCVDESEGRLWAESKGFLYFETSAQTGEGINEMFQ 176          
BLAST of SMED30032120 vs. Ensembl Human
Match: RAB1A (RAB1A, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9758])

HSP 1 Score: 95.9005 bits (237), Expect = 8.189e-23
Identity = 51/160 (31.87%), Postives = 87/160 (54.37%), Query Frame = -1
Query:  251 KVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESF 730
            K++LIGD   GK+ ++  + D +  E Y  TIG+D+  +  + +     K I++ IWD +G   F       Y     +++VYD+T   +F N+K WL E   Y++  + ++   ++GNK DLT  ++VD  T K    S    + ETS+K+  N+++SF
Sbjct:   13 KLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDG----KTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKL---LVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSF 165          
BLAST of SMED30032120 vs. Ensembl Human
Match: RAB1A (RAB1A, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9758])

HSP 1 Score: 95.9005 bits (237), Expect = 8.189e-23
Identity = 51/160 (31.87%), Postives = 87/160 (54.37%), Query Frame = -1
Query:  251 KVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESF 730
            K++LIGD   GK+ ++  + D +  E Y  TIG+D+  +  + +     K I++ IWD +G   F       Y     +++VYD+T   +F N+K WL E   Y++  + ++   ++GNK DLT  ++VD  T K    S    + ETS+K+  N+++SF
Sbjct:   13 KLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDG----KTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKL---LVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSF 165          
BLAST of SMED30032120 vs. Ensembl Human
Match: RAB1B (RAB1B, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:18370])

HSP 1 Score: 95.5153 bits (236), Expect = 1.218e-22
Identity = 49/160 (30.63%), Postives = 88/160 (55.00%), Query Frame = -1
Query:  251 KVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESF 730
            K++LIGD   GK+ ++  + D +  E Y  TIG+D+  +  + +     K I++ IWD +G   F       Y     +++VYD+T   ++ N+K WL E   Y++  + ++   ++GNK+DLT  ++VD  T K    S    + ETS+K+  N++++F
Sbjct:   10 KLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDG----KTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKL---LVGNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQAF 162          
BLAST of SMED30032120 vs. Ensembl Celegans
Match: rab-37 (RAB family [Source:UniProtKB/TrEMBL;Acc:A0A0K3ASU7])

HSP 1 Score: 98.9821 bits (245), Expect = 4.060e-24
Identity = 55/169 (32.54%), Postives = 94/169 (55.62%), Query Frame = -1
Query:  236 TWLKVILIGDVQCGKTSIIKSYYDVS-INEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESFEYLIE 739
            T  KV+L+GD   GKT ++  Y D + +N  +  T+GIDY  KL    +    K++++ IWD +G   F       Y + D +++VYD+    +F N + WL++ + Y     E +++ ++GNK DL   R V T+ GK L ++++  + ETS+K+  N+  +F  L E
Sbjct:   28 TTFKVMLLGDSCTGKTCLLIRYKDGAFLNNNFISTVGIDYRNKLITMGD----KKVKLQIWDTAGQERFRSVTTSYYRDADALLLVYDIANRASFENCRNWLSQIKEYGK---EAVQVTLVGNKCDLP--RAVPTDEGKRLAEAYQIPFMETSAKTGFNVDRAFLGLAE 187          
BLAST of SMED30032120 vs. Ensembl Celegans
Match: rab-37 (RAB family [Source:UniProtKB/TrEMBL;Acc:A0A0K3ASU7])

HSP 1 Score: 95.9005 bits (237), Expect = 4.618e-23
Identity = 53/165 (32.12%), Postives = 92/165 (55.76%), Query Frame = -1
Query:  236 VILIGDVQCGKTSIIKSYYDVS-INEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESFEYLIE 727
            V+L+GD   GKT ++  Y D + +N  +  T+GIDY  KL    +    K++++ IWD +G   F       Y + D +++VYD+    +F N + WL++ + Y     E +++ ++GNK DL   R V T+ GK L ++++  + ETS+K+  N+  +F  L E
Sbjct:   20 VMLLGDSCTGKTCLLIRYKDGAFLNNNFISTVGIDYRNKLITMGD----KKVKLQIWDTAGQERFRSVTTSYYRDADALLLVYDIANRASFENCRNWLSQIKEYGK---EAVQVTLVGNKCDLP--RAVPTDEGKRLAEAYQIPFMETSAKTGFNVDRAFLGLAE 175          
BLAST of SMED30032120 vs. Ensembl Celegans
Match: rab-1 (RAB family [Source:UniProtKB/TrEMBL;Acc:Q9UAQ6])

HSP 1 Score: 95.5153 bits (236), Expect = 5.414e-23
Identity = 50/160 (31.25%), Postives = 86/160 (53.75%), Query Frame = -1
Query:  251 KVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESF 730
            K++LIGD   GK+ ++  + D +  E Y  TIG+D+  +  + +     K I++ IWD +G   F       Y     +++VYD+T   TF N+K WL E   Y+   + ++   ++GNK DLT  R V+T+  ++        + ETS+KS  N++++F
Sbjct:   13 KLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDG----KTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDITDQETFNNVKQWLQEIDRYACENVNKL---LVGNKCDLTAKRAVETQAAQDYAGQLGIPFLETSAKSSTNVEQAF 165          
BLAST of SMED30032120 vs. Ensembl Celegans
Match: rab-37 (RAB family [Source:UniProtKB/TrEMBL;Acc:A0A0K3ASU7])

HSP 1 Score: 94.3597 bits (233), Expect = 1.029e-22
Identity = 52/164 (31.71%), Postives = 91/164 (55.49%), Query Frame = -1
Query:  236 ILIGDVQCGKTSIIKSYYDVS-INEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESFEYLIE 724
            +L+GD   GKT ++  Y D + +N  +  T+GIDY  KL    +    K++++ IWD +G   F       Y + D +++VYD+    +F N + WL++ + Y     E +++ ++GNK DL   R V T+ GK L ++++  + ETS+K+  N+  +F  L E
Sbjct:    1 MLLGDSCTGKTCLLIRYKDGAFLNNNFISTVGIDYRNKLITMGD----KKVKLQIWDTAGQERFRSVTTSYYRDADALLLVYDIANRASFENCRNWLSQIKEYGK---EAVQVTLVGNKCDLP--RAVPTDEGKRLAEAYQIPFMETSAKTGFNVDRAFLGLAE 155          
BLAST of SMED30032120 vs. Ensembl Celegans
Match: rab-37 (RAB family [Source:UniProtKB/TrEMBL;Acc:A0A0K3ASU7])

HSP 1 Score: 94.3597 bits (233), Expect = 1.029e-22
Identity = 52/164 (31.71%), Postives = 91/164 (55.49%), Query Frame = -1
Query:  236 ILIGDVQCGKTSIIKSYYDVS-INEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESFEYLIE 724
            +L+GD   GKT ++  Y D + +N  +  T+GIDY  KL    +    K++++ IWD +G   F       Y + D +++VYD+    +F N + WL++ + Y     E +++ ++GNK DL   R V T+ GK L ++++  + ETS+K+  N+  +F  L E
Sbjct:    1 MLLGDSCTGKTCLLIRYKDGAFLNNNFISTVGIDYRNKLITMGD----KKVKLQIWDTAGQERFRSVTTSYYRDADALLLVYDIANRASFENCRNWLSQIKEYGK---EAVQVTLVGNKCDLP--RAVPTDEGKRLAEAYQIPFMETSAKTGFNVDRAFLGLAE 155          
BLAST of SMED30032120 vs. Ensembl Fly
Match: Rab10 (gene:FBgn0015789 transcript:FBtr0077337)

HSP 1 Score: 98.2117 bits (243), Expect = 6.486e-24
Identity = 58/166 (34.94%), Postives = 88/166 (53.01%), Query Frame = -1
Query:  233 KVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESFEYLIET 730
            K++LIGD   GKT I+  + D +    +  TIGID+  K  +       K+I++ IWD +G   F       Y     +M+VYD+T   +F NI  WL     ++N   E++E  ILGNK D+T  R+V+ E G+ + +     + ETS+KS  NI+ +F  L E 
Sbjct:   11 KLLLIGDSGVGKTCILFRFSDDAFTSTFISTIGIDFKIKTVELRG----KKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITNEKSFENIVKWLRNIDEHAN---EDVEKMILGNKCDMTDKRVVNKERGEAIAREHGIRFMETSAKSNINIERAFCELAEA 169          
BLAST of SMED30032120 vs. Ensembl Fly
Match: Rab1 (gene:FBgn0285937 transcript:FBtr0084104)

HSP 1 Score: 93.2041 bits (230), Expect = 5.039e-22
Identity = 49/160 (30.63%), Postives = 85/160 (53.12%), Query Frame = -1
Query:  251 KVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESF 730
            K++LIGD   GK+ ++  + D +  E Y  TIG+D+  +  + +     K I++ IWD +G   F       Y     +++VYD T   +F N+K WL E + Y+   + ++   ++GNK+DLT  ++VD  T           + ETS+KS  N++++F
Sbjct:   13 KLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDG----KTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNKL---LVGNKSDLTTKKVVDHTTAAEYAAQLGIPFLETSAKSATNVEQAF 165          
BLAST of SMED30032120 vs. Ensembl Fly
Match: Rab8 (gene:FBgn0262518 transcript:FBtr0308833)

HSP 1 Score: 92.4337 bits (228), Expect = 9.881e-22
Identity = 53/160 (33.12%), Postives = 90/160 (56.25%), Query Frame = -1
Query:  251 KVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESF 730
            K++LIGD   GKT I+  + + + N  +  TIGID+  +  + +N    K+I++ IWD +G   F       Y     +M+VYD+T+  +F NIK W+   +  ++  +E++   +LGNK +LT  R V  E G+ L   +   + ETS+K+  N++E+F
Sbjct:   10 KLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDN----KKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKM---LLGNKCELTDKRQVSKERGEQLAIEYGIKFMETSAKASINVEEAF 162          
BLAST of SMED30032120 vs. Ensembl Fly
Match: Rab8 (gene:FBgn0262518 transcript:FBtr0074921)

HSP 1 Score: 92.4337 bits (228), Expect = 9.881e-22
Identity = 53/160 (33.12%), Postives = 90/160 (56.25%), Query Frame = -1
Query:  251 KVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESF 730
            K++LIGD   GKT I+  + + + N  +  TIGID+  +  + +N    K+I++ IWD +G   F       Y     +M+VYD+T+  +F NIK W+   +  ++  +E++   +LGNK +LT  R V  E G+ L   +   + ETS+K+  N++E+F
Sbjct:   10 KLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDN----KKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKM---LLGNKCELTDKRQVSKERGEQLAIEYGIKFMETSAKASINVEEAF 162          
BLAST of SMED30032120 vs. Ensembl Fly
Match: Rab19 (gene:FBgn0015793 transcript:FBtr0331832)

HSP 1 Score: 90.5077 bits (223), Expect = 5.484e-21
Identity = 53/165 (32.12%), Postives = 89/165 (53.94%), Query Frame = -1
Query:  242 KVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYF--ETSSKSKKNIQESFEYL 730
            K++LIGD   GKT I+  +   +  E +  TIG+D+  K          K+I++ IWD +G   F    +  Y + + V+IVYD+T+  +F+N++ W+ E + Y+      + I ++GNK DL   R VD E  + + Q    + F  ETS+K   N++++F  L
Sbjct:   23 KIVLIGDCGTGKTCIVDRFKTGNYIERHGNTIGVDFSMKTIAVEG----KQIKLQIWDTAGQERFRTITQSYYRSANGVLIVYDITKRSSFSNLQKWIEEVRRYT---ASNVLIILVGNKCDLEEQREVDFEEARQMCQYIPEILFVMETSAKENMNVEDAFRCL 180          
BLAST of SMED30032120 vs. Ensembl Zebrafish
Match: dnajc27 (DnaJ (Hsp40) homolog, subfamily C, member 27 [Source:NCBI gene;Acc:402784])

HSP 1 Score: 103.99 bits (258), Expect = 2.368e-25
Identity = 62/164 (37.80%), Postives = 91/164 (55.49%), Query Frame = -1
Query:  248 LKVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEF--QTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESFE 733
            +KVI +G+ + GK+ IIK Y +     +Y  TIGIDYG    Q  +    +EI+VNI+D +G P F E R E Y ++  V++VYD+    +F  +  WL E   +  S   +E I   +  NK DLT  R+VD   G+   +S    YFETS++S + I E F+
Sbjct:   17 VKVISLGNAEVGKSCIIKRYCEKRFVPKYLATIGIDYGVTKVQVRD----REIKVNIFDMAGHPFFYEVRNEFYKDSQGVILVYDVGLRESFDALDSWLTEMKQEMGSQANMENIIFVVCANKVDLTKRRVVDESEGRLWAESRGFHYFETSAQSGEGINEMFQ 176          
BLAST of SMED30032120 vs. Ensembl Zebrafish
Match: dnajc27 (DnaJ (Hsp40) homolog, subfamily C, member 27 [Source:NCBI gene;Acc:402784])

HSP 1 Score: 103.99 bits (258), Expect = 2.416e-25
Identity = 62/164 (37.80%), Postives = 91/164 (55.49%), Query Frame = -1
Query:  248 LKVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEF--QTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESFE 733
            +KVI +G+ + GK+ IIK Y +     +Y  TIGIDYG    Q  +    +EI+VNI+D +G P F E R E Y ++  V++VYD+    +F  +  WL E   +  S   +E I   +  NK DLT  R+VD   G+   +S    YFETS++S + I E F+
Sbjct:   17 VKVISLGNAEVGKSCIIKRYCEKRFVPKYLATIGIDYGVTKVQVRD----REIKVNIFDMAGHPFFYEVRNEFYKDSQGVILVYDVGLRESFDALDSWLTEMKQEMGSQANMENIIFVVCANKVDLTKRRVVDESEGRLWAESRGFHYFETSAQSGEGINEMFQ 176          
BLAST of SMED30032120 vs. Ensembl Zebrafish
Match: rab10 (RAB10, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-040718-304])

HSP 1 Score: 95.9005 bits (237), Expect = 6.191e-23
Identity = 55/165 (33.33%), Postives = 88/165 (53.33%), Query Frame = -1
Query:  236 KVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESFEYLIE 730
            K++LIGD   GKT ++  + D + N  +  TIGID+  K  +       K+I++ IWD +G   F       Y     +M+VYD+T   +F NI  WL     ++N   E++E  +LGNK D+   R+V    G+ + +     +FETS+K+  NI+++F  L E
Sbjct:   11 KLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQG----KKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITNAKSFENISKWLRNIDEHAN---EDVERMLLGNKCDMEDKRVVPKAKGEQIAKEHGIRFFETSAKANINIEKAFLTLAE 168          
BLAST of SMED30032120 vs. Ensembl Zebrafish
Match: rab1aa (RAB1A, member RAS oncogene family a [Source:ZFIN;Acc:ZDB-GENE-090312-110])

HSP 1 Score: 95.5153 bits (236), Expect = 7.068e-23
Identity = 50/160 (31.25%), Postives = 86/160 (53.75%), Query Frame = -1
Query:  251 KVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESF 730
            K++LIGD   GK+ ++  + D +  E Y  TIG+D+  +  + +     K I++ IWD +G   F       Y     +++VYD+T   +F N+K WL E   Y++  + ++   ++GNK DLT  ++VD    K    S    + ETS+KS  N++++F
Sbjct:   10 KLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDG----KTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKL---LVGNKCDLTTKKVVDYTAAKEFADSLSIPFLETSAKSSTNVEQAF 162          
BLAST of SMED30032120 vs. Ensembl Zebrafish
Match: si:dkey-16l2.16 (si:dkey-16l2.16 [Source:ZFIN;Acc:ZDB-GENE-141219-36])

HSP 1 Score: 95.5153 bits (236), Expect = 1.041e-22
Identity = 54/166 (32.53%), Postives = 89/166 (53.61%), Query Frame = -1
Query:  251 DSHTWLKVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESF 748
            D H   K+++IGD   GK+S++  + D S +  Y  TIG+D+  +  + +     + +++ IWD +G   F       Y NT  V+IVYD+T P +F N+K WLNE     ++  + +   ++GNK D    ++VDT+      +S     FETS+K   N++E F
Sbjct:    5 DYHHLFKLLIIGDSNVGKSSLLLRFADNSFSGSYITTIGVDFKIRTVEIDG----ERVKLQIWDTAGQERFRTITSTYYRNTHGVIIVYDVTNPESFVNVKRWLNEI----SQNCDNVCKILVGNKNDDPSKKLVDTQDAMRFGESVGVRLFETSAKENINVEEMF 162          
BLAST of SMED30032120 vs. Ensembl Xenopus
Match: rab1a (RAB1A, member RAS oncogene family [Source:NCBI gene;Acc:448007])

HSP 1 Score: 95.1301 bits (235), Expect = 1.574e-22
Identity = 50/160 (31.25%), Postives = 87/160 (54.37%), Query Frame = -1
Query:  251 KVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESF 730
            K++LIGD   GK+ ++  + D +  E Y  TIG+D+  +  + +     K I++ IWD +G   F       Y     +++VYD+T   +F N+K WL E   Y++  + ++   ++GNK DLT  ++VD  T K    S    + ETS+K+  N++++F
Sbjct:   13 KLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDG----KTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKL---LVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQAF 165          
BLAST of SMED30032120 vs. Ensembl Xenopus
Match: foxg1 (forkhead box G1 [Source:Xenbase;Acc:XB-GENE-480076])

HSP 1 Score: 95.5153 bits (236), Expect = 1.688e-22
Identity = 48/161 (29.81%), Postives = 92/161 (57.14%), Query Frame = -1
Query:  251 KVILIGDVQCGKTSIIKSYYDVS-INEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESF 730
            KV+L+GD   GKT  +  + D + ++  +  T+GID+ +K+   +      ++++ IWD +G   F       Y +   ++++YD+T   +F NI+ WL +   Y+ +   ++ I +LGNK D+   RI++TE G++L + +   + ETS+KS  N++ +F
Sbjct:   28 KVMLLGDSGVGKTCFLMQFRDGAFLSGAFLATVGIDFRYKIVTVDG----LKVKLQIWDTAGQERFRSVTHAYYRDAQALLLLYDITSKTSFDNIRAWLTDIHEYAQK---DVVIILLGNKNDMDAARIIETEDGESLAKEYGVPFMETSAKSGVNVELAF 181          
BLAST of SMED30032120 vs. Ensembl Xenopus
Match: rab1a (RAB1A, member RAS oncogene family [Source:NCBI gene;Acc:448007])

HSP 1 Score: 95.1301 bits (235), Expect = 1.838e-22
Identity = 50/160 (31.25%), Postives = 87/160 (54.37%), Query Frame = -1
Query:  251 KVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESF 730
            K++LIGD   GK+ ++  + D +  E Y  TIG+D+  +  + +     K I++ IWD +G   F       Y     +++VYD+T   +F N+K WL E   Y++  + ++   ++GNK DLT  ++VD  T K    S    + ETS+K+  N++++F
Sbjct:   14 KLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDG----KTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKL---LVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQAF 166          
BLAST of SMED30032120 vs. Ensembl Xenopus
Match: rab26 (RAB26, member RAS oncogene family [Source:NCBI gene;Acc:780350])

HSP 1 Score: 93.9745 bits (232), Expect = 1.045e-21
Identity = 56/186 (30.11%), Postives = 97/186 (52.15%), Query Frame = -1
Query:  251 SRNSMSKIDEFYEEAKRIVDSHTWLKVILIGDVQCGKTSIIKSYYDVS-INEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESF 805
             R S+S   EFY+ A          KV+L+GD   GKT ++  + D + +   +  T+GID+  K+   +      ++++ IWD +G   F       Y +   ++++YD+T   +F NI+ WL E   Y+ +   ++ I +LGNK D T +R+V  E G+ L + +   + ETS+KS  N+  +F
Sbjct:   42 GRPSLSNSGEFYDIA---------FKVMLVGDSGVGKTCLLVRFKDGAFLAGSFISTVGIDFRNKVLNVDGV----KVKLQIWDTAGQERFRSVTHAYYRDAHALLLLYDVTNKSSFDNIQAWLTEIHEYAQK---DVVIMLLGNKVDSTHERVVKIEDGERLAKEYGVPFMETSAKSGLNVDLAF 211          
BLAST of SMED30032120 vs. Ensembl Xenopus
Match: pknox2 (PBX/knotted 1 homeobox 2 [Source:Xenbase;Acc:XB-GENE-853128])

HSP 1 Score: 90.8929 bits (224), Expect = 5.093e-21
Identity = 52/160 (32.50%), Postives = 87/160 (54.37%), Query Frame = -1
Query:  251 KVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESF 730
            K++LIGD   GKT ++  + + + N  +  TIGID+  +  + +     K+I++ IWD +G   F       Y     +M+VYD+T   +F NIK W+   + +++  +E +   ILGNK D+   R V  E G+ L   +   + ETS+KS  N++E+F
Sbjct:   10 KLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDG----KKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERM---ILGNKCDMNDKRQVSREKGEKLAIDYGIKFLETSAKSSINVEEAF 162          
BLAST of SMED30032120 vs. Ensembl Mouse
Match: Dnajc27 (DnaJ heat shock protein family (Hsp40) member C27 [Source:MGI Symbol;Acc:MGI:2443036])

HSP 1 Score: 100.908 bits (250), Expect = 3.946e-24
Identity = 57/164 (34.76%), Postives = 91/164 (55.49%), Query Frame = -1
Query:  248 LKVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQT--YSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESFE 733
            +KVI +G+ + GK+ IIK Y +     +Y  TIGIDYG    Q  +    +EI+VNI+D +G P F E R E Y +T  V++VYD+ +  +F  +  WL E +     +  ++ I   +  NK D +  R +D   G+   +S   +YFETS+++ + I E F+
Sbjct:   17 IKVISMGNAEVGKSCIIKRYCEKRFVSKYLATIGIDYGVTKVQVRD----REIKVNIFDMAGHPFFFEVRNEFYKDTQGVILVYDVGQKDSFDALDSWLAEMKQELGPHGNMDNIVFVVCANKIDCSKHRCIDESEGRLWAESKGFLYFETSAQTGEGINEMFQ 176          
BLAST of SMED30032120 vs. Ensembl Mouse
Match: Dnajc27 (DnaJ heat shock protein family (Hsp40) member C27 [Source:MGI Symbol;Acc:MGI:2443036])

HSP 1 Score: 100.908 bits (250), Expect = 3.946e-24
Identity = 57/164 (34.76%), Postives = 91/164 (55.49%), Query Frame = -1
Query:  248 LKVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQT--YSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESFE 733
            +KVI +G+ + GK+ IIK Y +     +Y  TIGIDYG    Q  +    +EI+VNI+D +G P F E R E Y +T  V++VYD+ +  +F  +  WL E +     +  ++ I   +  NK D +  R +D   G+   +S   +YFETS+++ + I E F+
Sbjct:   17 IKVISMGNAEVGKSCIIKRYCEKRFVSKYLATIGIDYGVTKVQVRD----REIKVNIFDMAGHPFFFEVRNEFYKDTQGVILVYDVGQKDSFDALDSWLAEMKQELGPHGNMDNIVFVVCANKIDCSKHRCIDESEGRLWAESKGFLYFETSAQTGEGINEMFQ 176          
BLAST of SMED30032120 vs. Ensembl Mouse
Match: Dnajc27 (DnaJ heat shock protein family (Hsp40) member C27 [Source:MGI Symbol;Acc:MGI:2443036])

HSP 1 Score: 100.908 bits (250), Expect = 3.946e-24
Identity = 57/164 (34.76%), Postives = 91/164 (55.49%), Query Frame = -1
Query:  248 LKVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQT--YSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESFE 733
            +KVI +G+ + GK+ IIK Y +     +Y  TIGIDYG    Q  +    +EI+VNI+D +G P F E R E Y +T  V++VYD+ +  +F  +  WL E +     +  ++ I   +  NK D +  R +D   G+   +S   +YFETS+++ + I E F+
Sbjct:   17 IKVISMGNAEVGKSCIIKRYCEKRFVSKYLATIGIDYGVTKVQVRD----REIKVNIFDMAGHPFFFEVRNEFYKDTQGVILVYDVGQKDSFDALDSWLAEMKQELGPHGNMDNIVFVVCANKIDCSKHRCIDESEGRLWAESKGFLYFETSAQTGEGINEMFQ 176          
BLAST of SMED30032120 vs. Ensembl Mouse
Match: Rab1b (RAB1B, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1923558])

HSP 1 Score: 96.2857 bits (238), Expect = 4.628e-23
Identity = 49/160 (30.63%), Postives = 88/160 (55.00%), Query Frame = -1
Query:  251 KVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESF 730
            K++LIGD   GK+ ++  + D +  E Y  TIG+D+  +  + +     K I++ IWD +G   F       Y     +++VYD+T   ++ N+K WL E   Y++  + ++   ++GNK+DLT  ++VD  T K    S    + ETS+K+  N++++F
Sbjct:   10 KLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDG----KTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKL---LVGNKSDLTTKKVVDNTTAKEFADSLGVPFLETSAKNATNVEQAF 162          
BLAST of SMED30032120 vs. Ensembl Mouse
Match: Rab1a (RAB1A, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:97842])

HSP 1 Score: 95.9005 bits (237), Expect = 5.622e-23
Identity = 51/160 (31.87%), Postives = 87/160 (54.37%), Query Frame = -1
Query:  251 KVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESF 730
            K++LIGD   GK+ ++  + D +  E Y  TIG+D+  +  + +     K I++ IWD +G   F       Y     +++VYD+T   +F N+K WL E   Y++  + ++   ++GNK DLT  ++VD  T K    S    + ETS+K+  N+++SF
Sbjct:   13 KLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDG----KTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKL---LVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSF 165          
BLAST of SMED30032120 vs. UniProt/SwissProt
Match: sp|A5D7F5|DJC27_BOVIN (DnaJ homolog subfamily C member 27 OS=Bos taurus OX=9913 GN=DNAJC27 PE=2 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 8.763e-26
Identity = 61/164 (37.20%), Postives = 92/164 (56.10%), Query Frame = -1
Query:  248 LKVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQT--YSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESFE 733
            +KVI +G+ + GK+ IIK Y +     +Y  TIGIDYG    Q  +    +EI+VNI+D +GDP F E R E Y +T  V++VYD+ +  +F  +  WL E +     +  +E I   +  NK D T  R VD   G+   +S   +YFETS+++ + I E F+
Sbjct:   17 IKVISMGNAEVGKSCIIKRYCEKRFVSKYLATIGIDYGVTKVQVRD----REIKVNIFDMAGDPFFYEVRNEFYKDTQGVILVYDVGQKDSFDALDTWLAEMKQDLGPHGNMENIVFAVCANKIDCTKHRCVDESEGRLWAESKGFLYFETSAQTGEGINEMFQ 176          
BLAST of SMED30032120 vs. UniProt/SwissProt
Match: sp|Q6IMK3|DJC27_DANRE (DnaJ homolog subfamily C member 27 OS=Danio rerio OX=7955 GN=dnajc27 PE=2 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 1.824e-24
Identity = 62/164 (37.80%), Postives = 91/164 (55.49%), Query Frame = -1
Query:  248 LKVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEF--QTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESFE 733
            +KVI +G+ + GK+ IIK Y +     +Y  TIGIDYG    Q  +    +EI+VNI+D +G P F E R E Y ++  V++VYD+    +F  +  WL E   +  S   +E I   +  NK DLT  R+VD   G+   +S    YFETS++S + I E F+
Sbjct:   17 VKVISLGNAEVGKSCIIKRYCEKRFVPKYLATIGIDYGVTKVQVRD----REIKVNIFDMAGHPFFYEVRNEFYKDSQGVILVYDVGLRESFDALDSWLTEMKQEMGSQANMENIIFVVCANKVDLTKRRVVDESEGRLWAESRGFHYFETSAQSGEGINEMFQ 176          
BLAST of SMED30032120 vs. UniProt/SwissProt
Match: sp|Q05737|YPTM2_MAIZE (GTP-binding protein YPTM2 OS=Zea mays OX=4577 GN=YPTM2 PE=2 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 3.989e-24
Identity = 53/160 (33.12%), Postives = 90/160 (56.25%), Query Frame = -1
Query:  251 KVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESF 730
            K++LIGD   GK+ ++  + D S  + Y  TIG+D+  +  + +     K I++ IWD +G   F       Y     ++IVYD+T   +F N+K WLNE   Y++  + ++   ++GNK+DLT +++V TET K         + ETS+K+  N+Q++F
Sbjct:   10 KLLLIGDSGVGKSCLLLRFADDSYLDSYISTIGVDFKIRTVEQDG----KTIKLQIWDTAGQERFRTITSSYYRGAHGIIIVYDVTDQESFNNVKQWLNEIDRYASDNVNKL---LVGNKSDLTANKVVATETAKAFADEMGIPFMETSAKNATNVQQAF 162          
BLAST of SMED30032120 vs. UniProt/SwissProt
Match: sp|Q6IML7|DJC27_RAT (DnaJ homolog subfamily C member 27 OS=Rattus norvegicus OX=10116 GN=Dnajc27 PE=2 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 6.487e-24
Identity = 58/164 (35.37%), Postives = 91/164 (55.49%), Query Frame = -1
Query:  248 LKVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQT--YSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESFE 733
            +KVI +G+ + GK+ IIK Y +     +Y  TIGIDYG    Q  +    +EI+VNI+D +G P F E R E Y +T  V++VYD+ +  +F  +  WL E +     +  +E I   +  NK D +  R +D   G+   +S   +YFETS+++ + I E F+
Sbjct:   17 IKVISMGNAEVGKSCIIKRYCEKRFVSKYLATIGIDYGVTKVQVRD----REIKVNIFDMAGHPFFFEVRNEFYKDTQGVILVYDVGQKDSFDALDSWLAEMKQELGPHGNMENIVFVVCANKIDCSKHRCIDESEGRLWAESRGFLYFETSAQTGEGINEMFQ 176          
BLAST of SMED30032120 vs. UniProt/SwissProt
Match: sp|Q5M7D1|DJ27B_XENLA (DnaJ homolog subfamily C member 27-B OS=Xenopus laevis OX=8355 GN=dnajc27-b PE=2 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 8.587e-24
Identity = 61/167 (36.53%), Postives = 93/167 (55.69%), Query Frame = -1
Query:  248 LKVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQTYSNRK-----LEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESFE 733
            +KVI +G+ + GK+ IIK Y +     +Y  TIGIDYG    Q  +    +EI+VNI+D +G P F E R E Y +T  V++VYD+ +  +F ++  WL E +     +     L+ I   +  NK D T  R VD   G+  ++S   +YFETS++S + I E F+
Sbjct:   17 IKVISMGNAEVGKSCIIKRYCEKRFVPKYQATIGIDYGVTKVQIKD----REIKVNIFDMAGHPFFYEVRNEFYKDTQGVILVYDVGQKESFESLDAWLAEMKQELGPQINIDNLDNIVFAVCANKIDSTKHRCVDESEGRLWSESKGFLYFETSAQSGEGINEMFQ 179          
BLAST of SMED30032120 vs. TrEMBL
Match: A0A369S2A8 (DnaJ-like protein subfamily C member 27 OS=Trichoplax sp. H2 OX=287889 GN=TrispH2_007271 PE=4 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 3.093e-34
Identity = 70/184 (38.04%), Postives = 102/184 (55.43%), Query Frame = -1
Query:  230 DEFYEEAKRIVDSHTWLKVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESFEYLIETA 781
            D      K +  S  W K+I +G+   GKTSIIK++ D   ++ Y  T+G+DYGF+++  ++     E  VNIWDFSG  ++ + R ELY  T  V +VYD+T   TF ++  WL EFQ Y   K    +I ++ NK D    R+V  E G    ++  A YFETS+ + + I+E F  LI  A
Sbjct:    6 DHLTHPVKDVAASIKWCKIITLGNAHVGKTSIIKNFCDAGFSDSYQATVGVDYGFRIHSEDDT----ETYVNIWDFSGQNEYCDVRNELYEETKAVFLVYDVTTRATFEDLDSWLREFQKYCETKA---KIAVVANKIDCNQKRVVKKEEGMKWAKNHNAKYFETSAATGQGIKELFGTLISIA 182          
BLAST of SMED30032120 vs. TrEMBL
Match: A0A2C9KSY2 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106068993 PE=4 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 5.515e-34
Identity = 72/183 (39.34%), Postives = 108/183 (59.02%), Query Frame = -1
Query:  224 YEEAKRIVDSHTWLKVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESFEYLIETAII 772
            YE A   V +  W+K+I +G    GKTS+IK + +      Y PT+G+DYGFK+   N      ++RVNIWDFSG  D+LE R ELY  T+ + +V+D+T   TF ++  WL E   YS+      +I I+GNK DL  +R V+    K L Q++K  YFETS+ + + + + F+ ++ T +I
Sbjct:   12 YENA---VANLNWIKIIGVGSCNVGKTSLIKHFCESKFTSNYQPTVGVDYGFKVENINGC----DVRVNIWDFSGSTDYLEVRNELYSKTNGIFLVFDVTNATTFDSLDQWLREITQYSS---NSAQIFIVGNKVDLKHNRSVNQNNLKKLLQNYKCQYFETSAVTGEGVNDMFKAMLTTILI 184          
BLAST of SMED30032120 vs. TrEMBL
Match: A0A2C9KSU4 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106068993 PE=4 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 1.021e-33
Identity = 72/183 (39.34%), Postives = 108/183 (59.02%), Query Frame = -1
Query:  224 YEEAKRIVDSHTWLKVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESFEYLIETAII 772
            YE A   V +  W+K+I +G    GKTS+IK + +      Y PT+G+DYGFK+   N      ++RVNIWDFSG  D+LE R ELY  T+ + +V+D+T   TF ++  WL E   YS+      +I I+GNK DL  +R V+    K L Q++K  YFETS+ + + + + F+ ++ T +I
Sbjct:   23 YENA---VANLNWIKIIGVGSCNVGKTSLIKHFCESKFTSNYQPTVGVDYGFKVENINGC----DVRVNIWDFSGSTDYLEVRNELYSKTNGIFLVFDVTNATTFDSLDQWLREITQYSS---NSAQIFIVGNKVDLKHNRSVNQNNLKKLLQNYKCQYFETSAVTGEGVNDMFKAMLTTILI 195          
BLAST of SMED30032120 vs. TrEMBL
Match: A0A2C9KSX6 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106068993 PE=4 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 3.625e-33
Identity = 71/182 (39.01%), Postives = 107/182 (58.79%), Query Frame = -1
Query:  227 YEEAKRIVDSHTWLKVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESFEYLIETAI 772
            YE A   V +  W+K+I +G    GKTS+IK + +      Y PT+G+DYGFK+   N      ++RVNIWDFSG  D+LE R ELY  T+ + +V+D+T   TF ++  WL E   YS+      +I I+GNK DL  +R V+    K L Q++K  YFETS+ + + + + F+ ++ T +
Sbjct:   23 YENA---VANLNWIKIIGVGSCNVGKTSLIKHFCESKFTSNYQPTVGVDYGFKVENINGC----DVRVNIWDFSGSTDYLEVRNELYSKTNGIFLVFDVTNATTFDSLDQWLREITQYSSN---SAQIFIVGNKVDLKHNRSVNQNNLKKLLQNYKCQYFETSAVTGEGVNDMFKAMLTTIL 194          
BLAST of SMED30032120 vs. TrEMBL
Match: A0A433T6G1 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_015074 PE=4 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 4.681e-33
Identity = 66/182 (36.26%), Postives = 108/182 (59.34%), Query Frame = -1
Query:  227 YEEAKRIVDSHTWLKVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESFEYLIETAI 772
            YE+A   V +  W+KV+ IG+   GKT +IK + +   N  Y PT+G+DYGFK+ + +      ++RV++WD SG  +F + R ELY  TD + +V+D+T   +F  ++ W  E Q +++ K    +I ++GNK+DL + R V +  GK   Q  K  YFETS+ + + +   FE L++T +
Sbjct:   12 YEDA---VSNLIWIKVVGIGNANVGKTCLIKHFCESKFNSGYQPTVGVDYGFKVQEMHG----VDLRVHLWDLSGASEFFDVRNELYSGTDAIFLVFDVTNTSSFEALEQWQREVQRFASGK---PDIFVVGNKSDLKMKRAVTSSDGKKFCQQHKCRYFETSAATGEGVMPMFEALLQTVL 183          
BLAST of SMED30032120 vs. Ensembl Cavefish
Match: dnajc27 (DnaJ (Hsp40) homolog, subfamily C, member 27 [Source:NCBI gene;Acc:402784])

HSP 1 Score: 104.375 bits (259), Expect = 1.493e-25
Identity = 62/164 (37.80%), Postives = 91/164 (55.49%), Query Frame = -1
Query:  248 LKVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEF--QTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESFE 733
            +KVI +G+ + GK+ IIK Y +     +Y  TIGIDYG    Q  +    +EI+VNI+D +G P F E R E Y ++  V++VYD+    +F  +  WL E   +  S   +E I   +  NK DLT  R+VD   G+   +S    YFETS++S + I E F+
Sbjct:   18 VKVISLGNAEVGKSCIIKRYCEKRFVPKYLATIGIDYGVTKVQVRD----REIKVNIFDMAGHPFFYEVRNEFYKDSQGVILVYDVGLRESFDALDSWLTEMKQEMGSQANMESIIFVVCANKVDLTKRRVVDESEGRLWAESRGFHYFETSAQSGEGISEMFQ 177          
BLAST of SMED30032120 vs. Ensembl Cavefish
Match: RAB37 (RAB37, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:30268])

HSP 1 Score: 99.7525 bits (247), Expect = 3.722e-24
Identity = 48/164 (29.27%), Postives = 93/164 (56.71%), Query Frame = -1
Query:  242 KVILIGDVQCGKTSIIKSYYDVS-INEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESFEYL 730
            KV+L+GD   GKT ++  + D + +   +  T+GID+  K+   +N     ++++ IWD +G   F       Y +   ++++YD+TR  +F NI+ WL E   Y+ +   ++ I +LGNK+D+  +R++  E G+ L + +   + ETS+K+  N++ +F  +
Sbjct:   40 KVMLLGDSAVGKTCVLVRFKDGAFLGGNFIATVGIDFRNKVVSVDN----MKVKLQIWDTAGQERFRSVTHAYYRDAQALLLLYDITRKSSFDNIRAWLTEIHEYAQK---DVVIMLLGNKSDMAAERVIKHEEGQKLAKEYGVPFMETSAKTGLNVELAFHAI 196          
BLAST of SMED30032120 vs. Ensembl Cavefish
Match: ENSAMXT00000056277.1 (ras-related protein Rab-10-like [Source:NCBI gene;Acc:103035127])

HSP 1 Score: 95.5153 bits (236), Expect = 6.159e-23
Identity = 55/165 (33.33%), Postives = 87/165 (52.73%), Query Frame = -1
Query:  236 KVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESFEYLIE 730
            K++LIGD   GKT ++  + D + N  +  TIGID+  K  +       K I++ IWD +G   F       Y     +M+VYD+T   +F NI  WL   + ++N   E++E  +LGNK D+   R+V    G+ +       +FETS+K+  NI+++F  L E
Sbjct:   11 KLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQG----KRIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITNAKSFENITKWLRNIEEHAN---EDVERMLLGNKCDMEDMRVVPKAKGEQIASEHNIRFFETSAKANINIEKAFLMLAE 168          
BLAST of SMED30032120 vs. Ensembl Cavefish
Match: RAB10 (RAB10, member RAS oncogene family [Source:NCBI gene;Acc:103045708])

HSP 1 Score: 95.1301 bits (235), Expect = 9.971e-23
Identity = 55/165 (33.33%), Postives = 88/165 (53.33%), Query Frame = -1
Query:  236 KVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESFEYLIE 730
            K++LIGD   GKT ++  + D + N  +  TIGID+  K  +       K+I++ IWD +G   F       Y     +M+VYD++   +F NI  WL     ++N   E++E  +LGNK D+   RIV    G+ + +     +FETS+K+  NI+++F  L E
Sbjct:   11 KLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQG----KKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDISNAKSFENISKWLRNIDEHAN---EDVERMLLGNKCDMEDKRIVPKAKGEQIAREHGIRFFETSAKANINIEKAFLTLAE 168          
BLAST of SMED30032120 vs. Ensembl Cavefish
Match: rab1ab (ras-related protein Rab-1A [Source:NCBI gene;Acc:103035225])

HSP 1 Score: 94.7449 bits (234), Expect = 1.201e-22
Identity = 50/160 (31.25%), Postives = 87/160 (54.37%), Query Frame = -1
Query:  251 KVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESF 730
            K++LIGD   GK+ ++  + D +  E Y  TIG+D+  +  + +     K I++ IWD +G   F       Y     +++VYD+T   +F N+K WL E   Y++  + ++   ++GNK DLT  ++VD  T K    S    + ETS+K+  N++++F
Sbjct:   10 KLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDG----KTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKL---LVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQAF 162          
BLAST of SMED30032120 vs. Ensembl Sea Lamprey
Match: rab1aa (RAB1A, member RAS oncogene family a [Source:ZFIN;Acc:ZDB-GENE-090312-110])

HSP 1 Score: 95.5153 bits (236), Expect = 1.601e-23
Identity = 50/160 (31.25%), Postives = 88/160 (55.00%), Query Frame = -1
Query:  251 KVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESF 730
            K++LIGD   GK+ ++  + D +  E Y  TIG+D+  +  + +     K I++ IWD +G   F       Y     +++VYD+T   +F N+K WL E   Y++  + ++   ++GNK DLT  ++VD  T K    S +  + ETS+K+  N++++F
Sbjct:   13 KLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDG----KTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKL---LVGNKCDLTTKKVVDYTTAKEFADSLEIPFLETSAKNATNVEQAF 165          
BLAST of SMED30032120 vs. Ensembl Sea Lamprey
Match: dnajc27 (DnaJ (Hsp40) homolog, subfamily C, member 27 [Source:NCBI gene;Acc:402784])

HSP 1 Score: 93.2041 bits (230), Expect = 3.613e-22
Identity = 51/166 (30.72%), Postives = 90/166 (54.22%), Query Frame = -1
Query:  242 LKVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEF--QTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESFEYL 733
            +KVI +G+ + GK+ +IK Y +     +Y  TIGIDYG       +    +E++VNI+D +G P F E R E Y +T   ++V+D+    +F  +  WL E   +   +   +++ + +  NK +    R+VD   G+   +S   +YFETS+++ + + E F+ L
Sbjct:   18 VKVISMGNPEVGKSCLIKRYCEKRFVHKYMATIGIDYGVTKVHVRD----REVKVNIFDMAGHPFFYEVRNEFYKDTQGALLVFDVGSRDSFDALDGWLAEMRHEMGPHGSPDDVLVVVCANKVETGRRRVVDDSEGRLWAESRGFLYFETSAQTGEGVGEMFQTL 179          
BLAST of SMED30032120 vs. Ensembl Sea Lamprey
Match: RAB2B (RAB2B, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:20246])

HSP 1 Score: 91.6633 bits (226), Expect = 5.588e-22
Identity = 51/168 (30.36%), Postives = 90/168 (53.57%), Query Frame = -1
Query:  251 VDSHTWL-KVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESF 751
            V S+ +L K I+IGD   GK+ ++  + D      +  TIG+++G ++         K++++ IWD +G   F    +  Y      ++VYD+TR  TF ++  WL + + +SN  +    I ++GNK+DL   R V  E G+   +    V+ ETS+K+  N++E+F
Sbjct:    5 VMSYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMIAIGG----KQVKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTAWLEDARQHSNSNM---VIMLIGNKSDLESRREVKCEEGEAFAREHGLVFMETSAKTAANVEEAF 165          
BLAST of SMED30032120 vs. Ensembl Sea Lamprey
Match: rab3c (RAB3C, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-040718-263])

HSP 1 Score: 91.6633 bits (226), Expect = 6.095e-22
Identity = 51/166 (30.72%), Postives = 88/166 (53.01%), Query Frame = -1
Query:  236 LKVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESFEYLIE 733
             K+++IG+   GKTS +  Y D S    +  T+GID+  K    N     K I++ IWD +G   +       Y      +++YD+T   +F  +  W  + +TYS    +  ++ ++GNK D+  DR+V TE G+ L +     +FETS+K   N++++FE L++
Sbjct:   30 FKLLIIGNSSVGKTSFLFRYADESFTSAFVSTVGIDFKVKTVYRNE----KRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEDSFNAVSDWSTQIKTYS---WDNAQVVLVGNKCDMEDDRMVPTEQGRQLAEQLGFEFFETSAKDNINVKQTFERLVD 188          
BLAST of SMED30032120 vs. Ensembl Sea Lamprey
Match: rab2a (RAB2A, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-011212-2])

HSP 1 Score: 90.8929 bits (224), Expect = 9.370e-22
Identity = 48/160 (30.00%), Postives = 86/160 (53.75%), Query Frame = -1
Query:  251 KVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESF 730
            K I+IGD   GK+ ++  + D      +  TIG+++G ++   +     K++++ IWD +G   F    +  Y      ++VYD+TR  TF ++  WL + + +SN  +    I ++GNK+DL   R V  E G+   +    V+ ETS+K+  N++E+F
Sbjct:    8 KYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDG----KQVKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNM---VIMLIGNKSDLESRREVKREEGEAFAREHGLVFMETSAKTASNVEEAF 160          
BLAST of SMED30032120 vs. Ensembl Yeast
Match: YPT31 (Rab family GTPase; involved in the exocytic pathway; mediates intra-Golgi traffic or the budding of post-Golgi vesicles from the trans-Golgi; YPT31 has a paralog, YPT32, that arose from the whole genome duplication; localizes to the transitional and late Golgi [Source:SGD;Acc:S000000833])

HSP 1 Score: 86.6557 bits (213), Expect = 2.049e-20
Identity = 47/166 (28.31%), Postives = 89/166 (53.61%), Query Frame = -1
Query:  233 KVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESFEYLIET 730
            K++LIGD   GK++++  +     N +   TIG+++  +  + +     K I+  IWD +G   +       Y      +IVYD+++  ++ N   WL+E +  ++   + + +G++GNK+DL   R V TE  K   Q  + ++ ETS+ + +N+ ++FE LI T
Sbjct:   15 KIVLIGDSGVGKSNLLSRFTKNEFNMDSKSTIGVEFATRTLEIDG----KRIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLSELRENAD---DNVAVGLIGNKSDLAHLRAVPTEESKTFAQENQLLFTETSALNSENVDKAFEELINT 173          
BLAST of SMED30032120 vs. Ensembl Yeast
Match: SEC4 (Rab family GTPase; essential for vesicle-mediated exocytic secretion and autophagy; associates with the exocyst component Sec15p and may regulate polarized delivery of transport vesicles to the exocyst at the plasma membrane [Source:SGD;Acc:S000001889])

HSP 1 Score: 85.1149 bits (209), Expect = 7.586e-20
Identity = 49/161 (30.43%), Postives = 87/161 (54.04%), Query Frame = -1
Query:  251 LKVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESF 733
            +K++LIGD   GK+ ++  + +   N  +  TIGID+  K    N     K++++ +WD +G   F       Y     +++VYD+T   TFTNIK W   F+T +    +E ++ ++GNK+D+   R+V  + G+ L +     + E+S+K+  N+ E F
Sbjct:   21 MKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDING----KKVKLQLWDTAGQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQW---FKTVNEHANDEAQLLLVGNKSDMET-RVVTADQGEALAKELGIPFIESSAKNDDNVNEIF 173          
BLAST of SMED30032120 vs. Ensembl Yeast
Match: YPT32 (Rab family GTPase involved in the exocytic pathway; mediates intra-Golgi traffic or the budding of post-Golgi vesicles from the trans-Golgi; protein abundance increases in response to DNA replication stress; YPT32 has a paralog, YPT31, that arose from the whole genome duplication [Source:SGD;Acc:S000003178])

HSP 1 Score: 83.5741 bits (205), Expect = 2.406e-19
Identity = 46/164 (28.05%), Postives = 86/164 (52.44%), Query Frame = -1
Query:  239 KVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESFEYLI 730
            K++LIGD   GK++++  +     N E   TIG+++  +  +  N    K+I+  IWD +G   +       Y      +IVYD+++  ++ N   WL E +  ++   + + +G++GNK+DL   R V T+  KN     + ++ ETS+ +  N+ ++F  LI
Sbjct:   15 KIVLIGDSGVGKSNLLSRFTTDEFNIESKSTIGVEFATRTIEVEN----KKIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENAD---DNVAVGLIGNKSDLAHLRAVPTDEAKNFAMENQMLFTETSALNSDNVDKAFRELI 171          
BLAST of SMED30032120 vs. Ensembl Yeast
Match: YPT1 (Rab family GTPase; involved in the ER-to-Golgi step of the secretory pathway; complex formation with the Rab escort protein Mrs6p is required for prenylation of Ypt1p by type II protein geranylgeranyltransferase (Bet2p-Bet4p); binds to unspliced HAC1 mRNA; regulates the unfolded protein response (UPR) by promoting the decay of HAC1 RNA; localizes to the early Golgi, the transitional Golgi and ER membranes, pre-autophagosomal structures, and cytoplasmic vesicles [Source:SGD;Acc:S000001856])

HSP 1 Score: 83.1889 bits (204), Expect = 2.608e-19
Identity = 45/160 (28.12%), Postives = 85/160 (53.12%), Query Frame = -1
Query:  251 KVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESF 730
            K++LIG+   GK+ ++  + D +   +Y  TIG+D+  K  + +     K +++ IWD +G   F       Y  +  ++IVYD+T   +F  +K+WL E   Y+   + ++   ++GNK DL   R+V+ +  K    + K  + ETS+    N++++F
Sbjct:   10 KLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDG----KTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKL---LVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAF 162          
BLAST of SMED30032120 vs. Ensembl Yeast
Match: VPS21 (Endosomal Rab family GTPase; required for endocytic transport and sorting of vacuolar hydrolases; required for endosomal localization of the CORVET complex; required with YPT52 for MVB biogenesis and sorting; involved in autophagy and ionic stress tolerance; geranylgeranylation required for membrane association; protein abundance increases in response to DNA replication stress; mammalian Rab5 homolog; VPS21 has a paralog, YPT53, that arose from the whole genome duplication [Source:SGD;Acc:S000005615])

HSP 1 Score: 82.0333 bits (201), Expect = 8.205e-19
Identity = 51/169 (30.18%), Postives = 88/169 (52.07%), Query Frame = -1
Query:  251 SHTWLKVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKE-IRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQTYSNRKLEEIEIGILGNKTDL---TLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESF 745
            S T +K++L+G+   GK+SI+  +      E   PTIG  +   L Q     IN+  ++  IWD +G   F       Y N    ++VYD+T+P +F   + W+ E    +++   +I I ++GNK D+     +R V  E G+ L +    ++FETS+K+ +N+ + F
Sbjct:    4 SVTSIKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAF---LTQ--RVTINEHTVKFEIWDTAGQERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELHEQASK---DIIIALVGNKIDMLQEGGERKVAREEGEKLAEEKGLLFFETSAKTGENVNDVF 164          
BLAST of SMED30032120 vs. Ensembl Nematostella
Match: EDO47471 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMA6])

HSP 1 Score: 104.76 bits (260), Expect = 9.146e-27
Identity = 59/165 (35.76%), Postives = 92/165 (55.76%), Query Frame = -1
Query:  236 KVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESFEYLIE 730
            K++LIGD   GKT I+  + D + N  +  TIGID+  K  +       K+I++ IWD +G   F       Y     +M+VYD+T+  TF NI  WL   + ++N   E++E  ILGNK D+   RIV  E G+ + +     + ETS+K+  NI+++F+YL +
Sbjct:   11 KLLLIGDSGVGKTCILFRFSDDAFNTTFISTIGIDFKIKTIEMQG----KKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITQEKTFDNISKWLRNIEEHAN---EDVEKMILGNKCDMDDRRIVSRERGEQIAREHGIRFLETSAKTNINIEQAFQYLAQ 168          
BLAST of SMED30032120 vs. Ensembl Nematostella
Match: EDO49958 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RER3])

HSP 1 Score: 101.293 bits (251), Expect = 2.629e-25
Identity = 57/177 (32.20%), Postives = 96/177 (54.24%), Query Frame = -1
Query:  224 LKVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFK--LYQSNNP-----AINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESFEYLIETAII 733
            +K + +GD   GKTSI+  Y D S N ++  T+GID+  K  ++   NP        + I + +WD +G   F       + +    ++V+DLT   +F NI+ WL++ QT++    E  +I +LGNK DL  DR+VD    + L  +    YFETS+ + +N+ +S E L++  ++
Sbjct:   12 IKFLALGDSGVGKTSILYQYTDESFNPKFISTVGIDFREKRVVHHPLNPDGERSTRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLVFDLTHEQSFVNIRNWLSQLQTHA--YCENPDIVLLGNKADLEDDRVVDEAEARALADNLGLKYFETSAATGQNVTKSVEALLDQVMV 186          
BLAST of SMED30032120 vs. Ensembl Nematostella
Match: EDO28309 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6U5])

HSP 1 Score: 100.138 bits (248), Expect = 2.838e-25
Identity = 57/173 (32.95%), Postives = 94/173 (54.34%), Query Frame = -1
Query:  236 LKVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFK--LYQSNNP-----AINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESFEYLIE 733
            +K + +GD   GKTSI+  Y D S N ++  T+GID+  K  ++   NP        + I + +WD +G   F       + +    ++V+DLT   +F NI+ WL++ QT++    E  +I +LGNK DL  DR+VD    + L  +    YFETS+ + +N+ +S E L++
Sbjct:   12 IKFLALGDSGVGKTSILYQYTDESFNPKFISTVGIDFREKRVVHHPLNPDGERSTRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLVFDLTHEQSFVNIRNWLSQLQTHA--YCENPDIVLLGNKADLEDDRVVDEAEARALADNLGLKYFETSAATGQNVTKSVEALLD 182          
BLAST of SMED30032120 vs. Ensembl Nematostella
Match: EDO28399 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL89])

HSP 1 Score: 98.2117 bits (243), Expect = 8.178e-25
Identity = 57/169 (33.73%), Postives = 87/169 (51.48%), Query Frame = -1
Query:  236 LKVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQTYSNRKLEEIEIGILGNKTDLTLD---RIVDTETGKNLTQSWKAVYFETSSKSKKNIQESFEYLIE 733
             KV+ IGD   GK+S +  +        +  TIG+D+  K    N   I     + +WD +G   F    K+ +   D ++I YD+T   +FTN+K W+   +  +   + ++   +LGNKTDL  D   R+V T  GKNL   + A+Y ETS+K+  NIQE+   L E
Sbjct:    2 FKVVFIGDSGVGKSSFLHRFCHDQWKPSFTATIGVDFQIKTMNVNGQCI----AIQLWDTAGQERFRSITKQYFRKADGILIFYDVTAESSFTNLKSWMVSVEEGAEEGVAKM---VLGNKTDLAEDEESRVVKTIDGKNLANQYDALYMETSAKTGNNIQEAMYKLAE 163          
BLAST of SMED30032120 vs. Ensembl Nematostella
Match: EDO47822 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL89])

HSP 1 Score: 98.2117 bits (243), Expect = 8.178e-25
Identity = 57/169 (33.73%), Postives = 87/169 (51.48%), Query Frame = -1
Query:  236 LKVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQTYSNRKLEEIEIGILGNKTDLTLD---RIVDTETGKNLTQSWKAVYFETSSKSKKNIQESFEYLIE 733
             KV+ IGD   GK+S +  +        +  TIG+D+  K    N   I     + +WD +G   F    K+ +   D ++I YD+T   +FTN+K W+   +  +   + ++   +LGNKTDL  D   R+V T  GKNL   + A+Y ETS+K+  NIQE+   L E
Sbjct:    2 FKVVFIGDSGVGKSSFLHRFCHDQWKPSFTATIGVDFQIKTMNVNGQCI----AIQLWDTAGQERFRSITKQYFRKADGILIFYDVTAESSFTNLKSWMVSVEEGAEEGVAKM---VLGNKTDLAEDEESRVVKTIDGKNLANQYDALYMETSAKTGNNIQEAMYKLAE 163          
BLAST of SMED30032120 vs. Ensembl Medaka
Match: dnajc27 (DnaJ heat shock protein family (Hsp40) member C27 [Source:NCBI gene;Acc:101174982])

HSP 1 Score: 103.605 bits (257), Expect = 3.058e-25
Identity = 61/164 (37.20%), Postives = 91/164 (55.49%), Query Frame = -1
Query:  248 LKVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEF--QTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESFE 733
            +KVI +G+ + GK+ IIK Y +     +Y  TIGIDYG    Q  +    +EI+VNI+D +G P F E R E Y ++  V++VYD+    +F  +  WL E   +  S   ++ I   +  NK DLT  R+VD   G+   +S    YFETS++S + I E F+
Sbjct:   16 VKVISLGNAEVGKSCIIKRYCEKRFVPKYLATIGIDYGVTKVQVRD----REIKVNIFDMAGHPFFYEVRNEFYKDSQGVLLVYDVGVRESFEALDSWLGEMKQEMGSQANMDSIVFIVCANKVDLTKRRVVDEGEGRLWAESRGFHYFETSAQSGEGINEMFQ 175          
BLAST of SMED30032120 vs. Ensembl Medaka
Match: rab3db (ras-related protein Rab-3D [Source:NCBI gene;Acc:101163330])

HSP 1 Score: 100.138 bits (248), Expect = 1.565e-24
Identity = 54/179 (30.17%), Postives = 96/179 (53.63%), Query Frame = -1
Query:  236 YEEAKRIVDSHTWLKVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESFEYLIE 772
            +++ K   D +   K+++IG+   GKTS++  Y D S N  Y  T+GID+  K    N     K I++ IWD +G   +       Y   D  +++YD+T   +F  ++ W  + Q YS++  + I   ++GNK D+  DR++  E G+ L      ++FE S+K   N+++ FE+L++
Sbjct:    1 FKKKKADPDFNHMFKLLIIGNSSVGKTSVLFRYADDSFNPAYVSTVGIDFKVKTVFRN----EKRIKLQIWDTAGQERYRSITTAYYRGADGFLLMYDITNQESFNAVRDWATQVQHYSSKNAQVI---LVGNKCDMEDDRLITREDGQRLADERGFLFFEASAKENINVKQVFEHLVD 172          
BLAST of SMED30032120 vs. Ensembl Medaka
Match: rab3db (ras-related protein Rab-3D [Source:NCBI gene;Acc:101163330])

HSP 1 Score: 99.3673 bits (246), Expect = 3.272e-24
Identity = 53/171 (30.99%), Postives = 92/171 (53.80%), Query Frame = -1
Query:  236 DSHTWLKVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESFEYLIE 748
            D +   K+++IG+   GKTS++  Y D S N  Y  T+GID+  K    N     K I++ IWD +G   +       Y   D  +++YD+T   +F  ++ W  + Q YS++  + I   ++GNK D+  DR++  E G+ L      ++FE S+K   N+++ FE+L++
Sbjct:   17 DFNHMFKLLIIGNSSVGKTSVLFRYADDSFNPAYVSTVGIDFKVKTVFRNE----KRIKLQIWDTAGQERYRSITTAYYRGADGFLLMYDITNQESFNAVRDWATQVQHYSSKNAQVI---LVGNKCDMEDDRLITREDGQRLADERGFLFFEASAKENINVKQVFEHLVD 180          
BLAST of SMED30032120 vs. Ensembl Medaka
Match: rab3db (ras-related protein Rab-3D [Source:NCBI gene;Acc:101163330])

HSP 1 Score: 98.9821 bits (245), Expect = 4.215e-24
Identity = 53/171 (30.99%), Postives = 92/171 (53.80%), Query Frame = -1
Query:  236 DSHTWLKVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESFEYLIE 748
            D +   K+++IG+   GKTS++  Y D S N  Y  T+GID+  K    N     K I++ IWD +G   +       Y   D  +++YD+T   +F  ++ W  + Q YS++  + I   ++GNK D+  DR++  E G+ L      ++FE S+K   N+++ FE+L++
Sbjct:   16 DFNHMFKLLIIGNSSVGKTSVLFRYADDSFNPAYVSTVGIDFKVKTVFRNE----KRIKLQIWDTAGQERYRSITTAYYRGADGFLLMYDITNQESFNAVRDWATQVQHYSSKNAQVI---LVGNKCDMEDDRLITREDGQRLADERGFLFFEASAKENINVKQVFEHLVD 179          
BLAST of SMED30032120 vs. Ensembl Medaka
Match: rab3db (ras-related protein Rab-3D [Source:NCBI gene;Acc:101163330])

HSP 1 Score: 99.3673 bits (246), Expect = 4.465e-24
Identity = 53/171 (30.99%), Postives = 92/171 (53.80%), Query Frame = -1
Query:  236 DSHTWLKVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESFEYLIE 748
            D +   K+++IG+   GKTS++  Y D S N  Y  T+GID+  K    N     K I++ IWD +G   +       Y   D  +++YD+T   +F  ++ W  + Q YS++  + I   ++GNK D+  DR++  E G+ L      ++FE S+K   N+++ FE+L++
Sbjct:   30 DFNHMFKLLIIGNSSVGKTSVLFRYADDSFNPAYVSTVGIDFKVKTVFRNE----KRIKLQIWDTAGQERYRSITTAYYRGADGFLLMYDITNQESFNAVRDWATQVQHYSSKNAQVI---LVGNKCDMEDDRLITREDGQRLADERGFLFFEASAKENINVKQVFEHLVD 193          
BLAST of SMED30032120 vs. Planmine SMEST
Match: SMESG000021415.1 (SMESG000021415.1)

HSP 1 Score: 385.571 bits (989), Expect = 4.577e-136
Identity = 190/190 (100.00%), Postives = 190/190 (100.00%), Query Frame = -1
Query:  224 MSKIDEFYEEAKRIVDSHTWLKVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESFEYLIETAII 793
            MSKIDEFYEEAKRIVDSHTWLKVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESFEYLIETAII
Sbjct:    1 MSKIDEFYEEAKRIVDSHTWLKVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESFEYLIETAII 190          
BLAST of SMED30032120 vs. Planmine SMEST
Match: SMESG000026178.1 (SMESG000026178.1)

HSP 1 Score: 102.834 bits (255), Expect = 9.514e-26
Identity = 56/163 (34.36%), Postives = 91/163 (55.83%), Query Frame = -1
Query:  242 KVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESFEYL 730
            K++LIGD   GKTS++  + + + N  +  TIGID+  +    N     K+I++ IWD +G   F       Y     +M+VYD+T   +F NI  W++    ++N  +E++   +LGNK D+   R V T+TG+ L QS    + ETS+K+ +N+ E+F  L
Sbjct:   10 KLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDING----KKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKM---LLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQL 165          
BLAST of SMED30032120 vs. Planmine SMEST
Match: SMESG000077710.1 (SMESG000077710.1)

HSP 1 Score: 100.523 bits (249), Expect = 5.090e-25
Identity = 59/163 (36.20%), Postives = 87/163 (53.37%), Query Frame = -1
Query:  242 KVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESFEYL 730
            K++LIGD   GKT ++ SY D + +  Y  TIGID+  K  +       K+I++ IWD +G   F       Y     +M+VYD+T   +F NI  WL   +T+++   E +E+ I+ NK D+   R V  E G+    S    Y ETS+K+  NI E+FE L
Sbjct:    4 KLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFKIKTIEIGG----KKIKLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHAS---ETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEEL 159          
BLAST of SMED30032120 vs. Planmine SMEST
Match: SMESG000077710.1 (SMESG000077710.1)

HSP 1 Score: 100.908 bits (250), Expect = 5.609e-25
Identity = 59/163 (36.20%), Postives = 87/163 (53.37%), Query Frame = -1
Query:  242 KVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESFEYL 730
            K++LIGD   GKT ++ SY D + +  Y  TIGID+  K  +       K+I++ IWD +G   F       Y     +M+VYD+T   +F NI  WL   +T+++   E +E+ I+ NK D+   R V  E G+    S    Y ETS+K+  NI E+FE L
Sbjct:   11 KLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFKIKTIEIGG----KKIKLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHAS---ETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEEL 166          
BLAST of SMED30032120 vs. Planmine SMEST
Match: SMESG000072655.1 (SMESG000072655.1)

HSP 1 Score: 99.3673 bits (246), Expect = 1.522e-24
Identity = 55/160 (34.38%), Postives = 90/160 (56.25%), Query Frame = -1
Query:  251 KVILIGDVQCGKTSIIKSYYDVSINEEYFPTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIVMIVYDLTRPITFTNIKLWLNEFQTYSNRKLEEIEIGILGNKTDLTLDRIVDTETGKNLTQSWKAVYFETSSKSKKNIQESF 730
            K++LIGD   GK+S++  + D + +  +  TIG+D+  K+   +N  I    ++ IWD +G   F       Y     ++IVYD+T P +F +I  WL E QT +   L  +   ++GNKTD+  +R+V T  GK L    +A++ ETS+K  KN+++ F
Sbjct:   13 KILLIGDSAVGKSSLLIRFADNTFDSTFIATIGVDFKDKIINIDNEVI----KLQIWDTAGQERFRTITSTYYRGAAGIIIVYDVTNPKSFVSITKWLEEAQTNAGGNLVFM---LVGNKTDMVDNRVVTTVDGKKLANEHQALFLETSAKDNKNVEDVF 165          
The following BLAST results are available for this feature:
BLAST of SMED30032120 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNAJC271.848e-2535.98DnaJ heat shock protein family (Hsp40) member C27 ... [more]
DNAJC272.830e-2435.98DnaJ heat shock protein family (Hsp40) member C27 ... [more]
RAB1A8.189e-2331.88RAB1A, member RAS oncogene family [Source:HGNC Sym... [more]
RAB1A8.189e-2331.88RAB1A, member RAS oncogene family [Source:HGNC Sym... [more]
RAB1B1.218e-2230.63RAB1B, member RAS oncogene family [Source:HGNC Sym... [more]
back to top
BLAST of SMED30032120 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab-374.060e-2432.54RAB family [Source:UniProtKB/TrEMBL;Acc:A0A0K3ASU... [more]
rab-374.618e-2332.12RAB family [Source:UniProtKB/TrEMBL;Acc:A0A0K3ASU... [more]
rab-15.414e-2331.25RAB family [Source:UniProtKB/TrEMBL;Acc:Q9UAQ6][more]
rab-371.029e-2231.71RAB family [Source:UniProtKB/TrEMBL;Acc:A0A0K3ASU... [more]
rab-371.029e-2231.71RAB family [Source:UniProtKB/TrEMBL;Acc:A0A0K3ASU... [more]
back to top
BLAST of SMED30032120 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rab106.486e-2434.94gene:FBgn0015789 transcript:FBtr0077337[more]
Rab15.039e-2230.63gene:FBgn0285937 transcript:FBtr0084104[more]
Rab89.881e-2233.13gene:FBgn0262518 transcript:FBtr0308833[more]
Rab89.881e-2233.13gene:FBgn0262518 transcript:FBtr0074921[more]
Rab195.484e-2132.12gene:FBgn0015793 transcript:FBtr0331832[more]
back to top
BLAST of SMED30032120 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnajc272.368e-2537.80DnaJ (Hsp40) homolog, subfamily C, member 27 [Sour... [more]
dnajc272.416e-2537.80DnaJ (Hsp40) homolog, subfamily C, member 27 [Sour... [more]
rab106.191e-2333.33RAB10, member RAS oncogene family [Source:ZFIN;Acc... [more]
rab1aa7.068e-2331.25RAB1A, member RAS oncogene family a [Source:ZFIN;A... [more]
si:dkey-16l2.161.041e-2232.53si:dkey-16l2.16 [Source:ZFIN;Acc:ZDB-GENE-141219-3... [more]
back to top
BLAST of SMED30032120 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab1a1.574e-2231.25RAB1A, member RAS oncogene family [Source:NCBI gen... [more]
foxg11.688e-2229.81forkhead box G1 [Source:Xenbase;Acc:XB-GENE-480076... [more]
rab1a1.838e-2231.25RAB1A, member RAS oncogene family [Source:NCBI gen... [more]
rab261.045e-2130.11RAB26, member RAS oncogene family [Source:NCBI gen... [more]
pknox25.093e-2132.50PBX/knotted 1 homeobox 2 [Source:Xenbase;Acc:XB-GE... [more]
back to top
BLAST of SMED30032120 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dnajc273.946e-2434.76DnaJ heat shock protein family (Hsp40) member C27 ... [more]
Dnajc273.946e-2434.76DnaJ heat shock protein family (Hsp40) member C27 ... [more]
Dnajc273.946e-2434.76DnaJ heat shock protein family (Hsp40) member C27 ... [more]
Rab1b4.628e-2330.63RAB1B, member RAS oncogene family [Source:MGI Symb... [more]
Rab1a5.622e-2331.88RAB1A, member RAS oncogene family [Source:MGI Symb... [more]
back to top
BLAST of SMED30032120 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A5D7F5|DJC27_BOVIN8.763e-2637.20DnaJ homolog subfamily C member 27 OS=Bos taurus O... [more]
sp|Q6IMK3|DJC27_DANRE1.824e-2437.80DnaJ homolog subfamily C member 27 OS=Danio rerio ... [more]
sp|Q05737|YPTM2_MAIZE3.989e-2433.13GTP-binding protein YPTM2 OS=Zea mays OX=4577 GN=Y... [more]
sp|Q6IML7|DJC27_RAT6.487e-2435.37DnaJ homolog subfamily C member 27 OS=Rattus norve... [more]
sp|Q5M7D1|DJ27B_XENLA8.587e-2436.53DnaJ homolog subfamily C member 27-B OS=Xenopus la... [more]
back to top
BLAST of SMED30032120 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A369S2A83.093e-3438.04DnaJ-like protein subfamily C member 27 OS=Trichop... [more]
A0A2C9KSY25.515e-3439.34Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A2C9KSU41.021e-3339.34Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A2C9KSX63.625e-3339.01Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A433T6G14.681e-3336.26Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
back to top
BLAST of SMED30032120 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnajc271.493e-2537.80DnaJ (Hsp40) homolog, subfamily C, member 27 [Sour... [more]
RAB373.722e-2429.27RAB37, member RAS oncogene family [Source:HGNC Sym... [more]
ENSAMXT00000056277.16.159e-2333.33ras-related protein Rab-10-like [Source:NCBI gene;... [more]
RAB109.971e-2333.33RAB10, member RAS oncogene family [Source:NCBI gen... [more]
rab1ab1.201e-2231.25ras-related protein Rab-1A [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of SMED30032120 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab1aa1.601e-2331.25RAB1A, member RAS oncogene family a [Source:ZFIN;A... [more]
dnajc273.613e-2230.72DnaJ (Hsp40) homolog, subfamily C, member 27 [Sour... [more]
RAB2B5.588e-2230.36RAB2B, member RAS oncogene family [Source:HGNC Sym... [more]
rab3c6.095e-2230.72RAB3C, member RAS oncogene family [Source:ZFIN;Acc... [more]
rab2a9.370e-2230.00RAB2A, member RAS oncogene family [Source:ZFIN;Acc... [more]
back to top
BLAST of SMED30032120 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
YPT312.049e-2028.31Rab family GTPase; involved in the exocytic pathwa... [more]
SEC47.586e-2030.43Rab family GTPase; essential for vesicle-mediated ... [more]
YPT322.406e-1928.05Rab family GTPase involved in the exocytic pathway... [more]
YPT12.608e-1928.13Rab family GTPase; involved in the ER-to-Golgi ste... [more]
VPS218.205e-1930.18Endosomal Rab family GTPase; required for endocyti... [more]
back to top
BLAST of SMED30032120 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO474719.146e-2735.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO499582.629e-2532.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO283092.838e-2532.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO283998.178e-2533.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478228.178e-2533.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30032120 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnajc273.058e-2537.20DnaJ heat shock protein family (Hsp40) member C27 ... [more]
rab3db1.565e-2430.17ras-related protein Rab-3D [Source:NCBI gene;Acc:1... [more]
rab3db3.272e-2430.99ras-related protein Rab-3D [Source:NCBI gene;Acc:1... [more]
rab3db4.215e-2430.99ras-related protein Rab-3D [Source:NCBI gene;Acc:1... [more]
rab3db4.465e-2430.99ras-related protein Rab-3D [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of SMED30032120 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000021415.14.577e-136100.00SMESG000021415.1[more]
SMESG000026178.19.514e-2634.36SMESG000026178.1[more]
SMESG000077710.15.090e-2536.20SMESG000077710.1[more]
SMESG000077710.15.609e-2536.20SMESG000077710.1[more]
SMESG000072655.11.522e-2434.38SMESG000072655.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032120 ID=SMED30032120|Name=SMED30032120|organism=Schmidtea mediterranea sexual|type=transcript|length=1063bp
CAAATGCATTATTATTCAAACGAGCTAAAACCTAAACATTACATCTGGAT
TCCGTAAAGCCACCGCAAACGGACATGAAGTTTAAAACAGGAATGATAGT
CGAAATTTATAGTAAAAATATCAAATTAATCTGAAATGAGTTCATAGGAA
AATTGCATTTTTGGACAATTTTTCAATAAAAATCTAAACTTCATAATAAA
TGTTAATGCTTTTTCAATTTTTTTATTATTGCTGTTTCAATTAGATACTC
AAAAGATTCTTGAATATTTTTCTTTGATTTTGACGATGTTTCAAAATAGA
CAGCTTTCCAGGATTGTGTGAGATTTTTCCCTGTTTCTGTGTCAACTATT
CTATCAAGTGTCAAATCAGTCTTATTTCCCAGAATTCCGATTTCAATTTC
CTCAAGTTTCCGGTTGCTATAGGTCTGAAATTCGTTAAGCCACAGTTTAA
TATTTGTGAAAGTTATCGGCCGGGTCAAATCGTACACAATCATTACTATA
TCTGTATTGATATATAGCTCTTTTCGTGTTTCAAGGAAATCAGGATCACC
GGAAAAATCCCAAATGTTCACACGAATCTCTTTATTTATCGCGGGATTGT
TTGACTGATACAATTTAAATCCGTAGTCAATTCCTATTGTTGGGAAATAT
TCTTCATTTATTGACACATCGTAGTAGCTTTTGATGATTGAGGTTTTGCC
GCACTGAACGTCACCGATCAAGATCACCTTCAACCAGGTGTGACTGTCGA
CAATTCGTTTCGCTTCCTCATAGAACTCGTCAATTTTACTCATAGAATTC
CTGGAAAATTCGCAGACTTGATAAAAATCAATAGCGATTGAAAGTGAATT
ATAGAGAAACAGATTAGCATACAATGTAAAGTAGAGTGCAAAATTAGCAA
AAATGCACTGATATTGACACACAATTTGTTTGTAATGAAAATTTTGCAGA
CTATTATGACATTTTAGTTTTTTTTAACATATTTGTTAGAAATTCTGATA
TTTCTACAGTTGCTGGTGTATGAATGAGAGATGGGGAAATTTTGTTCAGA
TTTGTTATGTACT
back to top

protein sequence of SMED30032120-orf-1

>SMED30032120-orf-1 ID=SMED30032120-orf-1|Name=SMED30032120-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=197bp
MSKIDEFYEEAKRIVDSHTWLKVILIGDVQCGKTSIIKSYYDVSINEEYF
PTIGIDYGFKLYQSNNPAINKEIRVNIWDFSGDPDFLETRKELYINTDIV
MIVYDLTRPITFTNIKLWLNEFQTYSNRKLEEIEIGILGNKTDLTLDRIV
DTETGKNLTQSWKAVYFETSSKSKKNIQESFEYLIETAIIKKLKKH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR005225Small_GTP-bd_dom
IPR027417P-loop_NTPase
IPR001806Small_GTPase
Vocabulary: molecular function
TermDefinition
GO:0003924GTPase activity
GO:0005525GTP binding
Vocabulary: biological process
TermDefinition
GO:0007264small GTPase mediated signal transduction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00449RASTRNSFRMNGcoord: 44..60
score: 30.29
coord: 131..144
score: 40.09
coord: 66..88
score: 22.36
coord: 166..188
score: 30.98
coord: 21..42
score: 33.09
NoneNo IPR availableSMARTSM00175rab_sub_5coord: 21..191
e-value: 1.3E-19
score: 81.2
NoneNo IPR availableSMARTSM00173ras_sub_4coord: 18..191
e-value: 1.2E-6
score: -15.6
NoneNo IPR availableSMARTSM00174rho_sub_3coord: 23..191
e-value: 7.8E-10
score: 6.9
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 8..196
e-value: 1.5E-44
score: 153.5
NoneNo IPR availablePANTHERPTHR24073FAMILY NOT NAMEDcoord: 19..189
NoneNo IPR availablePANTHERPTHR24073:SF269DNAJ HOMOLOG SUBFAMILY C MEMBER 27coord: 19..189
NoneNo IPR availablePROSITEPS51419RABcoord: 16..196
score: 19.628
NoneNo IPR availableCDDcd00154Rabcoord: 21..186
e-value: 1.34082E-46
score: 148.758
IPR001806Small GTPasePFAMPF00071Rascoord: 22..188
e-value: 4.6E-38
score: 130.4
IPR005225Small GTP-binding protein domainTIGRFAMTIGR00231TIGR00231coord: 22..184
e-value: 2.0E-16
score: 58.1
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 21..187