SMED30032106

Overview
NameSMED30032106
Smed IDSMED30032106
Length (bp)691
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30032106 (SMED30032106) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30032106 (SMED30032106) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30032106 (SMED30032106) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30032106 (SMED30032106) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032106

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30032106SMESG000080319.1 SMESG000080318.1 Contig4429newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30032106SMESG000080319.1 SMESG000080318.1 Contig4429uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30032106SMESG000004344.1 Contig4429newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30032106SMESG000004344.1 Contig4429uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
head regionSMED30032106SMESG000080318.1 SmedASXL_067311SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30032106SMESG000080318.1 dd_Smed_v4_8948_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30032106SMESG000080318.1 dd_Smed_v4_8948_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30032106SMESG000080318.1 dd_Smed_v4_8948_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
posterior muscle cellSMED30032106SMESG000080318.1 dd_Smed_v4_8948_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30032106SMESG000080318.1 dd_Smed_v4_8948_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032106SMESG000080319.1 SMESG000080318.1 Contig4429newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032106SMESG000080319.1 SMESG000080318.1 Contig4429uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032106SMESG000004344.1 Contig4429newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032106SMESG000004344.1 Contig4429uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30032106SMESG000080318.1 dd_Smed_v6_8948_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30032106SMESG000080318.1 dd_Smed_v4_8948_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30032106 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.001133:30911..31639 +3350
Homology
BLAST of SMED30032106 vs. Ensembl Celegans
Match: C30G7.2 (pep chromosome:WBcel235:V:14936898:14939367:1 gene:WBGene00044176.1 transcript:C30G7.2b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C30G7.2)

HSP 1 Score: 82.4185 bits (202), Expect = 3.003e-19
Identity = 53/149 (35.57%), Postives = 71/149 (47.65%), Query Frame = 1
Query:  193 QLSKTDALACYLCDSQNGSNTACEDPLNPAY---------TDKVNLKNPCMQGRPGSIGEFWAQYCIKIKATKSIDKS-TLTIRRCTLDKLTET-------LNHCGLFKLNDIDYEGCISSCTKDACNSSRVPQ-RLDYYFCMLFILFS 585
            + S    + C++C S +G N  CEDP N            +   N   PC   + G  G F A +CIKI   ++ ++S TL IR C LD  T T       ++HCG FK     Y+GC+ SC  D CNSS V    L   F ++F L S
Sbjct:   38 EASGVSGIGCFVCSSFDGENKGCEDPFNSTMDLSSRDRDASAVANYNYPCWAYKKGRHGLFPADHCIKIVGYRADNESKTLVIRTCALDSGTLTADTEIVRISHCGSFKYEGHQYKGCVQSCDTDGCNSSSVHSFLLPLCFLIVFSLLS 186          
BLAST of SMED30032106 vs. Ensembl Celegans
Match: C30G7.2 (pep chromosome:WBcel235:V:14936898:14938942:1 gene:WBGene00044176.1 transcript:C30G7.2a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C30G7.2)

HSP 1 Score: 80.8777 bits (198), Expect = 8.700e-19
Identity = 52/148 (35.14%), Postives = 70/148 (47.30%), Query Frame = 1
Query:  196 LSKTDALACYLCDSQNGSNTACEDPLNPAY---------TDKVNLKNPCMQGRPGSIGEFWAQYCIKIKATKSIDKS-TLTIRRCTLDKLTET-------LNHCGLFKLNDIDYEGCISSCTKDACNSSRVPQ-RLDYYFCMLFILFS 585
            +     + C++C S +G N  CEDP N            +   N   PC   + G  G F A +CIKI   ++ ++S TL IR C LD  T T       ++HCG FK     Y+GC+ SC  D CNSS V    L   F ++F L S
Sbjct:   37 MEGVSGIGCFVCSSFDGENKGCEDPFNSTMDLSSRDRDASAVANYNYPCWAYKKGRHGLFPADHCIKIVGYRADNESKTLVIRTCALDSGTLTADTEIVRISHCGSFKYEGHQYKGCVQSCDTDGCNSSSVHSFLLPLCFLIVFSLLS 184          
BLAST of SMED30032106 vs. Ensembl Fly
Match: CG31323 (gene:FBgn0051323 transcript:FBtr0307339)

HSP 1 Score: 84.3445 bits (207), Expect = 4.710e-20
Identity = 48/113 (42.48%), Postives = 64/113 (56.64%), Query Frame = 1
Query:  220 CYLCDSQNGSNTACEDPLNPAYTDKVNLKNPCMQGRPGSIGEFWAQYCIKIKATKSIDKSTLTIRRCTLDKLTET-------LNHCGLFKLNDIDYEGCISSCT-KDACNSSR 534
            C+ C S NG+N AC+DP +  Y+  + L++PCM GR G  G F A  CIKI         T+T+R C LD  T T       ++HCG F  +D    GC+ SC+  DACNS+R
Sbjct:   30 CFKCVSYNGANKACDDPFHNNYSTAI-LESPCMGGRKGRDGLFPATACIKIAGYYDGTGETITVRGCALDSGTLTTDTEIIRMSHCGKFYYDDKYVHGCLQSCSDADACNSAR 141          
BLAST of SMED30032106 vs. Ensembl Fly
Match: CG31323 (gene:FBgn0051323 transcript:FBtr0084988)

HSP 1 Score: 84.3445 bits (207), Expect = 4.710e-20
Identity = 48/113 (42.48%), Postives = 64/113 (56.64%), Query Frame = 1
Query:  220 CYLCDSQNGSNTACEDPLNPAYTDKVNLKNPCMQGRPGSIGEFWAQYCIKIKATKSIDKSTLTIRRCTLDKLTET-------LNHCGLFKLNDIDYEGCISSCT-KDACNSSR 534
            C+ C S NG+N AC+DP +  Y+  + L++PCM GR G  G F A  CIKI         T+T+R C LD  T T       ++HCG F  +D    GC+ SC+  DACNS+R
Sbjct:   30 CFKCVSYNGANKACDDPFHNNYSTAI-LESPCMGGRKGRDGLFPATACIKIAGYYDGTGETITVRGCALDSGTLTTDTEIIRMSHCGKFYYDDKYVHGCLQSCSDADACNSAR 141          
BLAST of SMED30032106 vs. TrEMBL
Match: A0A183L9A0 (Uncharacterized protein OS=Schistosoma margrebowiei OX=48269 PE=4 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 4.603e-29
Identity = 58/130 (44.62%), Postives = 82/130 (63.08%), Query Frame = 1
Query:  205 TDALACYLCDSQNGSNTACEDPLNPAYTDKVNLKNPCMQGRPGSIGEFWAQYCIKIKATKSIDKSTLTIRRCTLDKLTETLNHCGLFKLNDIDYEGCISSCTKDACNSSRVPQ---RLDYYFCMLFILFS 585
            T A+ACY C S N SN  CEDP++      + ++ PC Q  PG  G F+A YC KIK  +  D S+L IRRC++DKLT+   HCG F+L+D  Y GCI++C+KD CN+  +P    R+   FC+L + ++
Sbjct:    5 TTAIACYSCVSMNKSNPPCEDPVSA----HITIQRPCRQTIPGHEGLFYAHYCTKIKGIRQKDGSSLLIRRCSMDKLTDIPTHCGQFQLDDDLYHGCIATCSKDWCNTGDIPSVSVRM-LTFCLLILSYT 129          
BLAST of SMED30032106 vs. TrEMBL
Match: A0A3P7Z3J1 (Uncharacterized protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS375 PE=4 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 4.755e-29
Identity = 58/130 (44.62%), Postives = 82/130 (63.08%), Query Frame = 1
Query:  205 TDALACYLCDSQNGSNTACEDPLNPAYTDKVNLKNPCMQGRPGSIGEFWAQYCIKIKATKSIDKSTLTIRRCTLDKLTETLNHCGLFKLNDIDYEGCISSCTKDACNSSRVPQ---RLDYYFCMLFILFS 585
            T A+ACY C S N SN  CEDP++      + ++ PC Q  PG  G F+A YC KIK  +  D S+L IRRC++DKLT+   HCG F+L+D  Y GCI++C+KD CN+  +P    R+   FC+L + ++
Sbjct:    5 TTAIACYSCVSMNKSNPPCEDPVSA----HITIQRPCRQTIPGHEGLFYAHYCTKIKGIRQKDGSSLLIRRCSMDKLTDIPTHCGQFQLDDDLYHGCIATCSKDWCNTGDIPSVSVRM-LTFCLLILSYT 129          
BLAST of SMED30032106 vs. TrEMBL
Match: A0A4Z2CVG4 (Splicing factor 4 OS=Schistosoma japonicum OX=6182 GN=EWB00_007257 PE=4 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 3.378e-27
Identity = 54/112 (48.21%), Postives = 75/112 (66.96%), Query Frame = 1
Query:  193 QLSKTDALACYLCDSQNGSNTACEDPLNPAYTDKVNLKNPCMQGRPGSIGEFWAQYCIKIKATKSIDKSTLTIRRCTLDKLTETLNHCGLFKLNDIDYEGCISSCTKDACNS 528
            +++ T A+ACY C S N SN ACEDP+    + +V ++ PC Q  PG  G F+A YC KIK  +  D S+L IRRC++DKL +   HCG F+L+D  Y GCI++C+KD CN+
Sbjct:   28 EVNITTAIACYSCVSMNRSNPACEDPI----SAEVTIQRPCRQTIPGHKGLFYAHYCSKIKGIRQKDGSSLLIRRCSMDKLADIPTHCGQFQLDDDLYHGCIATCSKDWCNN 135          
BLAST of SMED30032106 vs. TrEMBL
Match: A0A3S5BZ36 (Uncharacterized protein OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS18846 PE=4 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 4.232e-27
Identity = 51/112 (45.54%), Postives = 74/112 (66.07%), Query Frame = 1
Query:  196 LSKTDALACYLCDSQNGSNTACEDPLNPAYTDKVNLKNPCMQGRPGSIGEFWAQYCIKIKATKSIDKSTLTIRRCTLDKLTETLNHCGLFKLNDIDYEGCISSCTKDACNSS 531
            L   DA++CY C+S NGSN  CEDP++      V ++ PCMQG     G F+A++C+KIK  +  D   L +RRC+++KL + + HCG FKLN+  Y GCI++C KD CN++
Sbjct:   27 LLLADAISCYSCNSVNGSNQPCEDPMD----GSVGVEKPCMQGISDHKGLFFARFCLKIKGRRQSDGQLLVMRRCSMEKLADIMTHCGEFKLNEDLYSGCIATCNKDWCNAA 134          
BLAST of SMED30032106 vs. TrEMBL
Match: A0A3P7M0B3 (Uncharacterized protein OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS11619 PE=4 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 2.428e-26
Identity = 50/108 (46.30%), Postives = 70/108 (64.81%), Query Frame = 1
Query:  202 KTDALACYLCDSQNGSNTACEDPLNPAYTDKVNLKNPCMQGRPGSIGEFWAQYCIKIKATKSIDKSTLTIRRCTLDKLTETLNHCGLFKLNDIDYEGCISSCTKDACN 525
            +   LACY+C S NGS   CEDP+       +  + PC QGRPG  G  +A+YC+KIK  +  D  T+ IRRC++DKL +   HCG F+L+D  Y+GCI++CT++ CN
Sbjct:    5 EAQGLACYVCTSVNGSYPDCEDPVK----GSIPFEAPCRQGRPGYEGLSYARYCVKIKGERVSDGQTIYIRRCSMDKLADVPTHCGQFRLSDDLYQGCIATCTQNWCN 108          
BLAST of SMED30032106 vs. Planmine SMEST
Match: SMESG000080318.1 (SMESG000080318.1)

HSP 1 Score: 283.108 bits (723), Expect = 2.487e-98
Identity = 136/137 (99.27%), Postives = 136/137 (99.27%), Query Frame = 1
Query:  187 DSQLSKTDALACYLCDSQNGSNTACEDPLNPAYTDKVNLKNPCMQGRPGSIGEFWAQYCIKIKATKSIDKSTLTIRRCTLDKLTETLNHCGLFKLNDIDYEGCISSCTKDACNSSRVPQRLDYYFCMLFILFSSQVV 597
            DSQLSKTDALACYLCDSQNGSNTACEDPLNPAYTDKVNLKNPCMQGRPGSIGEFWAQYCIKIKATKSIDKSTLTIRRCTLDKLTETLNHCGLFKLNDIDYEGCISSCTKDACNSSRVPQRLDYYFCML ILFSSQVV
Sbjct:   14 DSQLSKTDALACYLCDSQNGSNTACEDPLNPAYTDKVNLKNPCMQGRPGSIGEFWAQYCIKIKATKSIDKSTLTIRRCTLDKLTETLNHCGLFKLNDIDYEGCISSCTKDACNSSRVPQRLDYYFCMLLILFSSQVV 150          
The following BLAST results are available for this feature:
BLAST of SMED30032106 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30032106 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
C30G7.23.003e-1935.57pep chromosome:WBcel235:V:14936898:14939367:1 gene... [more]
C30G7.28.700e-1935.14pep chromosome:WBcel235:V:14936898:14938942:1 gene... [more]
back to top
BLAST of SMED30032106 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG313234.710e-2042.48gene:FBgn0051323 transcript:FBtr0307339[more]
CG313234.710e-2042.48gene:FBgn0051323 transcript:FBtr0084988[more]
back to top
BLAST of SMED30032106 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30032106 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30032106 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30032106 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30032106 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183L9A04.603e-2944.62Uncharacterized protein OS=Schistosoma margrebowie... [more]
A0A3P7Z3J14.755e-2944.62Uncharacterized protein OS=Schistosoma margrebowie... [more]
A0A4Z2CVG43.378e-2748.21Splicing factor 4 OS=Schistosoma japonicum OX=6182... [more]
A0A3S5BZ364.232e-2745.54Uncharacterized protein OS=Protopolystoma xenopodi... [more]
A0A3P7M0B32.428e-2646.30Uncharacterized protein OS=Dibothriocephalus latus... [more]
back to top
BLAST of SMED30032106 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30032106 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30032106 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30032106 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30032106 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30032106 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000080318.12.487e-9899.27SMESG000080318.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032106 ID=SMED30032106|Name=SMED30032106|organism=Schmidtea mediterranea sexual|type=transcript|length=691bp
CGAATTTTAATATTACTTATTAGTTTGGTAAATTATCCATATTTTTCAAA
GTAACCAATCACATTGACGATACTAATTTCTTTCCCTACTCGATTAGTTG
TCATGGTAAATTATTGATTAATTTTAGAATTAGCATGACAGCTCATAATG
GCGATTGAATTAATTTTATTGTTTATTTTCGCTATTGATTCTCAATTGAG
TAAAACTGATGCGCTTGCCTGTTATTTATGCGATTCTCAGAATGGAAGTA
ATACAGCATGCGAAGATCCTTTAAATCCAGCTTATACTGACAAAGTCAAT
TTAAAAAATCCGTGTATGCAAGGACGTCCCGGTTCTATAGGAGAATTTTG
GGCACAGTATTGTATCAAAATCAAAGCAACGAAGTCCATTGATAAATCTA
CTTTAACGATAAGAAGATGCACACTTGATAAACTAACTGAAACTTTAAAT
CATTGTGGATTATTCAAACTAAATGACATAGATTATGAAGGATGTATTTC
ATCGTGTACAAAAGATGCATGCAATAGTTCTAGAGTTCCACAAAGACTTG
ACTATTATTTTTGTATGCTATTTATCTTATTTTCTTCACAGGTAGTTTAA
TAAGTTATTTGTATTTGATAAAGAATATTTATTTTTAACAAGCAAACTAT
GTAAATTTTACACGACTTATAAATAAATTTTTTAAGATCGG
back to top

protein sequence of SMED30032106-orf-1

>SMED30032106-orf-1 ID=SMED30032106-orf-1|Name=SMED30032106-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=151bp
MAIELILLFIFAIDSQLSKTDALACYLCDSQNGSNTACEDPLNPAYTDKV
NLKNPCMQGRPGSIGEFWAQYCIKIKATKSIDKSTLTIRRCTLDKLTETL
NHCGLFKLNDIDYEGCISSCTKDACNSSRVPQRLDYYFCMLFILFSSQVV
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0000418head
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR38332FAMILY NOT NAMEDcoord: 16..147
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..22
score: 0.652