Protein kinase domain-containing protein

Overview
NameProtein kinase domain-containing protein
Smed IDSMED30032093
Length (bp)3118
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein kinase domain-containing protein (SMED30032093) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30032093) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein kinase domain-containing protein (SMED30032093) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30032093) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032093

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 20

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30032093SMESG000024489.1 dd_Smed_v4_5366_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30032093SMESG000024489.1 dd_Smed_v4_5366_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30032093SMESG000024489.1 dd_Smed_v4_5366_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30032093SMESG000024489.1 dd_Smed_v4_5366_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30032093SMESG000024489.1 dd_Smed_v4_5366_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30032093SMESG000024489.1 dd_Smed_v4_5366_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30032093SMESG000024489.1 dd_Smed_v4_5366_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30032093SMESG000024489.1 dd_Smed_v4_4401_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30032093SMESG000024489.1 dd_Smed_v4_4401_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30032093SMESG000024489.1 dd_Smed_v4_4401_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30032093SMESG000024489.1 dd_Smed_v4_4401_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30032093SMESG000024489.1 dd_Smed_v4_4401_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30032093SMESG000024489.1 SMESG000024487.1 dd_Smed_v4_5789_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30032093SMESG000024489.1 SMESG000024487.1 dd_Smed_v4_5789_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30032093SMESG000024489.1 SMESG000024487.1 dd_Smed_v4_5789_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30032093SMESG000024489.1 SMESG000024487.1 dd_Smed_v4_5789_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032093SMESG000024489.1 SMESG000024487.1 SMESG000024485.1 Contig36627uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032093SMESG000024489.1 SMESG000024487.1 SMESG000024485.1 Contig36627newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032093SMESG000024489.1 Contig35718newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032093SMESG000024489.1 Contig35718uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 121.709 bits (304), Expect = 8.320e-28
Identity = 87/278 (31.29%), Postives = 140/278 (50.36%), Query Frame = 1
Query: 1441 NFDLGKEIARGGFGIVFHCQEKISGKNVILKKL--------IDKKLTSFYRDIFISYHLNQAEHLVNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPINP-----ISKELNELINLCLTVNPDERPTGEELMKSEFFK 2235
            N+  GK + +G FG V+ C +  +G+ +  K++          K++++   +I +  +L Q E +V  +  ++D  + ++ + M YM GGS    ++  LK +  L E    K + QIL  ++ LH   ++H DIK  NI+ D  GN K  D+G +K   RL+    S     S  GT Y+++PEVI GE Y  K D+WS G  +VEM+T KPP  WA        +  + K   +P NP     IS+   + +     V   +RP+ EEL+   F +
Sbjct:  361 NWRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKNL-QHERIVQYYGCLRDRAEKTLTIFMEYMPGGS----VKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASK---RLQTICMSGTGMRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPP--WAEYE----AMAAIFKIATQPTNPQLPSHISEHGRDFLRRIF-VEARQRPSAEELLTHHFAQ 623          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 121.709 bits (304), Expect = 9.196e-28
Identity = 87/278 (31.29%), Postives = 140/278 (50.36%), Query Frame = 1
Query: 1441 NFDLGKEIARGGFGIVFHCQEKISGKNVILKKL--------IDKKLTSFYRDIFISYHLNQAEHLVNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPINP-----ISKELNELINLCLTVNPDERPTGEELMKSEFFK 2235
            N+  GK + +G FG V+ C +  +G+ +  K++          K++++   +I +  +L Q E +V  +  ++D  + ++ + M YM GGS    ++  LK +  L E    K + QIL  ++ LH   ++H DIK  NI+ D  GN K  D+G +K   RL+    S     S  GT Y+++PEVI GE Y  K D+WS G  +VEM+T KPP  WA        +  + K   +P NP     IS+   + +     V   +RP+ EEL+   F +
Sbjct:  357 NWRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKNL-QHERIVQYYGCLRDRAEKTLTIFMEYMPGGS----VKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASK---RLQTICMSGTGMRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPP--WAEYE----AMAAIFKIATQPTNPQLPSHISEHGRDFLRRIF-VEARQRPSAEELLTHHFAQ 619          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 121.709 bits (304), Expect = 1.102e-27
Identity = 87/278 (31.29%), Postives = 140/278 (50.36%), Query Frame = 1
Query: 1441 NFDLGKEIARGGFGIVFHCQEKISGKNVILKKL--------IDKKLTSFYRDIFISYHLNQAEHLVNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPINP-----ISKELNELINLCLTVNPDERPTGEELMKSEFFK 2235
            N+  GK + +G FG V+ C +  +G+ +  K++          K++++   +I +  +L Q E +V  +  ++D  + ++ + M YM GGS    ++  LK +  L E    K + QIL  ++ LH   ++H DIK  NI+ D  GN K  D+G +K   RL+    S     S  GT Y+++PEVI GE Y  K D+WS G  +VEM+T KPP  WA        +  + K   +P NP     IS+   + +     V   +RP+ EEL+   F +
Sbjct:  388 NWRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKNL-QHERIVQYYGCLRDRAEKTLTIFMEYMPGGS----VKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASK---RLQTICMSGTGMRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPP--WAEYE----AMAAIFKIATQPTNPQLPSHISEHGRDFLRRIF-VEARQRPSAEELLTHHFAQ 650          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 121.324 bits (303), Expect = 1.401e-27
Identity = 87/278 (31.29%), Postives = 140/278 (50.36%), Query Frame = 1
Query: 1441 NFDLGKEIARGGFGIVFHCQEKISGKNVILKKL--------IDKKLTSFYRDIFISYHLNQAEHLVNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPINP-----ISKELNELINLCLTVNPDERPTGEELMKSEFFK 2235
            N+  GK + +G FG V+ C +  +G+ +  K++          K++++   +I +  +L Q E +V  +  ++D  + ++ + M YM GGS    ++  LK +  L E    K + QIL  ++ LH   ++H DIK  NI+ D  GN K  D+G +K   RL+    S     S  GT Y+++PEVI GE Y  K D+WS G  +VEM+T KPP  WA        +  + K   +P NP     IS+   + +     V   +RP+ EEL+   F +
Sbjct:  392 NWRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKNL-QHERIVQYYGCLRDRAEKTLTIFMEYMPGGS----VKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASK---RLQTICMSGTGMRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPP--WAEYE----AMAAIFKIATQPTNPQLPSHISEHGRDFLRRIF-VEARQRPSAEELLTHHFAQ 654          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 121.324 bits (303), Expect = 1.401e-27
Identity = 87/278 (31.29%), Postives = 140/278 (50.36%), Query Frame = 1
Query: 1441 NFDLGKEIARGGFGIVFHCQEKISGKNVILKKL--------IDKKLTSFYRDIFISYHLNQAEHLVNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPINP-----ISKELNELINLCLTVNPDERPTGEELMKSEFFK 2235
            N+  GK + +G FG V+ C +  +G+ +  K++          K++++   +I +  +L Q E +V  +  ++D  + ++ + M YM GGS    ++  LK +  L E    K + QIL  ++ LH   ++H DIK  NI+ D  GN K  D+G +K   RL+    S     S  GT Y+++PEVI GE Y  K D+WS G  +VEM+T KPP  WA        +  + K   +P NP     IS+   + +     V   +RP+ EEL+   F +
Sbjct:  392 NWRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKNL-QHERIVQYYGCLRDRAEKTLTIFMEYMPGGS----VKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASK---RLQTICMSGTGMRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPP--WAEYE----AMAAIFKIATQPTNPQLPSHISEHGRDFLRRIF-VEARQRPSAEELLTHHFAQ 654          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: pak-2 (Serine/threonine-protein kinase pak-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EFU0])

HSP 1 Score: 114.005 bits (284), Expect = 4.491e-26
Identity = 84/274 (30.66%), Postives = 136/274 (49.64%), Query Frame = 1
Query: 1456 KEIARGGFGIVFHCQEKISGKNVILKKLID----KKLTSFYRDIFISYHLNQAEH--LVNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPF----HWAGIGRVSLELTKMKKYKFKPINPISKELNELINLCLTVNPDERPTGEELMKSEFFKDCLH 2247
            K+I  G  G+V     KIS K ++  K ++    ++    + ++ I   L Q +H  +V  F       D  + + M +M GGSLT  +         + E  I  IS Q+L  ++ LH  KVIH DIK D+I+   +G  K  D+G    +      ++   R+ S  GT Y+ A EVI  E Y  + DIWSFG++L+EMV G+PPF     +  + R+  E     + +F     +S EL+EL++ C+  + ++R   ++L++  FF    H
Sbjct:  233 KQIGEGSTGVV-EAAYKISTKQIVAVKRMNLRKQQRRELLFNEVSI---LRQYQHPNIVRFFS--SHLVDDELWVVMEFMEGGSLTDIVTATR-----MTEPQIATISRQVLGALDFLHARKVIHRDIKSDSILLKRDGTVKLTDFGFCGQL------SEEVPRRRSLVGTPYWTAAEVIAREPYDTRADIWSFGIMLIEMVEGEPPFFNDQPFQAMKRIRDE----HEARFSRHAKVSVELSELLSHCIVKDVNKRWPAKDLLRHPFFAKAQH 485          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: pak-2 (Serine/threonine-protein kinase pak-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EFU0])

HSP 1 Score: 114.005 bits (284), Expect = 4.823e-26
Identity = 82/270 (30.37%), Postives = 133/270 (49.26%), Query Frame = 1
Query: 1456 KEIARGGFGIVFHCQEKISGKNVILKKLID----KKLTSFYRDIFISYHLNQAEH--LVNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPINPISKELNELINLCLTVNPDERPTGEELMKSEFFKDCLH 2247
            K+I  G  G+V     KIS K ++  K ++    ++    + ++ I   L Q +H  +V  F       D  + + M +M GGSLT  +         + E  I  IS Q+L  ++ LH  KVIH DIK D+I+   +G  K  D+G    +      ++   R+ S  GT Y+ A EVI  E Y  + DIWSFG++L+EMV G+PPF      +    +    + +F     +S EL+EL++ C+  + ++R   ++L++  FF    H
Sbjct:  235 KQIGEGSTGVV-EAAYKISTKQIVAVKRMNLRKQQRRELLFNEVSI---LRQYQHPNIVRFFS--SHLVDDELWVVMEFMEGGSLTDIVTATR-----MTEPQIATISRQVLGALDFLHARKVIHRDIKSDSILLKRDGTVKLTDFGFCGQL------SEEVPRRRSLVGTPYWTAAEVIAREPYDTRADIWSFGIMLIEMVEGEPPFFNDQPFQAMKRIRDEHEARFSRHAKVSVELSELLSHCIVKDVNKRWPAKDLLRHPFFAKAQH 487          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: max-2 (Serine/threonine-protein kinase max-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ3])

HSP 1 Score: 107.842 bits (268), Expect = 1.265e-25
Identity = 75/269 (27.88%), Postives = 131/269 (48.70%), Query Frame = 1
Query: 1450 LGKEIARGGFGIVFHCQEKISGKNVILKKLIDKKLTSFYRDIFIS--YHLNQAEH--LVNGFE-IVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPINPISKELNELINLCLTVNPDERPTGEELMKSEFFKDC 2241
            + K+I  G  G VF      S   V +K++  K  T   +++ ++    + Q  H  LVN  E  + D +D  + + M Y+ GG+LT  + +       L E  I  +  + L  ++ LH   ++H DIK DN++    G  K  D G    +       Q   ++++  GT Y+++PE++  + Y+YK DIWS G++ +EM+ G+PP+      +    + +  K + K  + +S E N  ++ CL V+PD+R    EL+   F K  
Sbjct:    1 MKKQIGVGASGTVFVANVAGSTDVVAVKRMAFK--TQPKKEMLLTEIKVMKQYRHPNLVNYIESYLVDADD--LWVVMDYLEGGNLTDVVVKT-----ELDEGQIAAVLQECLKALHFLHRHSIVHRDIKSDNVLLGMNGEVKLTDMGFCAQI-------QPGSKRDTVVGTPYWMSPEILNKKQYNYKVDIWSLGIMALEMIDGEPPYLRETPLKAIYLIAQNGKPEIKQRDRLSSEFNNFLDKCLVVDPDQRADTTELLAHPFLKKA 253          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: max-2 (Serine/threonine-protein kinase max-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ3])

HSP 1 Score: 110.923 bits (276), Expect = 1.760e-25
Identity = 76/274 (27.74%), Postives = 134/274 (48.91%), Query Frame = 1
Query: 1435 LENFDLGKEIARGGFGIVFHCQEKISGKNVILKKLIDKKLTSFYRDIFIS--YHLNQAEH--LVNGFE-IVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPINPISKELNELINLCLTVNPDERPTGEELMKSEFFKDC 2241
            L  +++ K+I  G  G VF      S   V +K++  K  T   +++ ++    + Q  H  LVN  E  + D +D  + + M Y+ GG+LT  + +       L E  I  +  + L  ++ LH   ++H DIK DN++    G  K  D G    +       Q   ++++  GT Y+++PE++  + Y+YK DIWS G++ +EM+ G+PP+      +    + +  K + K  + +S E N  ++ CL V+PD+R    EL+   F K  
Sbjct:  153 LGKYEMKKQIGVGASGTVFVANVAGSTDVVAVKRMAFK--TQPKKEMLLTEIKVMKQYRHPNLVNYIESYLVDADD--LWVVMDYLEGGNLTDVVVKT-----ELDEGQIAAVLQECLKALHFLHRHSIVHRDIKSDNVLLGMNGEVKLTDMGFCAQI-------QPGSKRDTVVGTPYWMSPEILNKKQYNYKVDIWSLGIMALEMIDGEPPYLRETPLKAIYLIAQNGKPEIKQRDRLSSEFNNFLDKCLVVDPDQRADTTELLAHPFLKKA 410          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: max-2 (Serine/threonine-protein kinase max-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ3])

HSP 1 Score: 108.612 bits (270), Expect = 5.225e-24
Identity = 76/274 (27.74%), Postives = 134/274 (48.91%), Query Frame = 1
Query: 1435 LENFDLGKEIARGGFGIVFHCQEKISGKNVILKKLIDKKLTSFYRDIFIS--YHLNQAEH--LVNGFE-IVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPINPISKELNELINLCLTVNPDERPTGEELMKSEFFKDC 2241
            L  +++ K+I  G  G VF      S   V +K++  K  T   +++ ++    + Q  H  LVN  E  + D +D  + + M Y+ GG+LT  + +       L E  I  +  + L  ++ LH   ++H DIK DN++    G  K  D G    +       Q   ++++  GT Y+++PE++  + Y+YK DIWS G++ +EM+ G+PP+      +    + +  K + K  + +S E N  ++ CL V+PD+R    EL+   F K  
Sbjct:  328 LGKYEMKKQIGVGASGTVFVANVAGSTDVVAVKRMAFK--TQPKKEMLLTEIKVMKQYRHPNLVNYIESYLVDADD--LWVVMDYLEGGNLTDVVVKT-----ELDEGQIAAVLQECLKALHFLHRHSIVHRDIKSDNVLLGMNGEVKLTDMGFCAQI-------QPGSKRDTVVGTPYWMSPEILNKKQYNYKVDIWSLGIMALEMIDGEPPYLRETPLKAIYLIAQNGKPEIKQRDRLSSEFNNFLDKCLVVDPDQRADTTELLAHPFLKKA 585          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Pak3 (gene:FBgn0044826 transcript:FBtr0330047)

HSP 1 Score: 122.865 bits (307), Expect = 1.560e-28
Identity = 77/272 (28.31%), Postives = 135/272 (49.63%), Query Frame = 1
Query: 1438 ENFDLGKEIARGGFGIVFHCQEKISGKNVILKKLIDKKLTS----FYRDIFISYHLNQAEHLVNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPINPISKELNELINLCLTVNPDERPTGEELMKSEFFKDC 2241
            E +   +E+ +G  GIVF   + +  ++ +  K ID K  S       +I +    N  ++LVN  +      +  + + M YM GG LT  + + +     ++E+ I  +  + L  I+ LH   +IH DIK DN++   +G+ K  D+G   ++E  E       ++++  GT Y++APEV+  + Y  K DIWS G++ +EM+ G+PP+ +    R    +    +   K  + +S  L + ++ CL V  D R T +EL+   F  DC
Sbjct:  291 ERYKTTQEVGKGASGIVFIAAD-LQNESQVAVKTIDMKNQSSKDLILTEIRVLKDFNH-KNLVNFLDAYLLEPEDQLWVVMEYMDGGPLTDVVTETV-----MKERQIACVCRETLYAISFLHAKGIIHRDIKSDNVLLGMDGSVKVTDFGFCANIEGDE-------KRQTMVGTPYWMAPEVVTRKKYGKKVDIWSIGIMAIEMIEGQPPYLYETPLRALYLIAANGRPDIKSWDKLSPNLQDFLDRCLQVEVDRRATADELLSHPFLNDC 548          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Pak3 (gene:FBgn0044826 transcript:FBtr0083312)

HSP 1 Score: 122.479 bits (306), Expect = 1.643e-28
Identity = 77/272 (28.31%), Postives = 135/272 (49.63%), Query Frame = 1
Query: 1438 ENFDLGKEIARGGFGIVFHCQEKISGKNVILKKLIDKKLTS----FYRDIFISYHLNQAEHLVNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPINPISKELNELINLCLTVNPDERPTGEELMKSEFFKDC 2241
            E +   +E+ +G  GIVF   + +  ++ +  K ID K  S       +I +    N  ++LVN  +      +  + + M YM GG LT  + + +     ++E+ I  +  + L  I+ LH   +IH DIK DN++   +G+ K  D+G   ++E  E       ++++  GT Y++APEV+  + Y  K DIWS G++ +EM+ G+PP+ +    R    +    +   K  + +S  L + ++ CL V  D R T +EL+   F  DC
Sbjct:  291 ERYKTTQEVGKGASGIVFIAAD-LQNESQVAVKTIDMKNQSSKDLILTEIRVLKDFNH-KNLVNFLDAYLLEPEDQLWVVMEYMDGGPLTDVVTETV-----MKERQIACVCRETLYAISFLHAKGIIHRDIKSDNVLLGMDGSVKVTDFGFCANIEGDE-------KRQTMVGTPYWMAPEVVTRKKYGKKVDIWSIGIMAIEMIEGQPPYLYETPLRALYLIAANGRPDIKSWDKLSPNLQDFLDRCLQVEVDRRATADELLSHPFLNDC 548          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Pak3 (gene:FBgn0044826 transcript:FBtr0305003)

HSP 1 Score: 122.479 bits (306), Expect = 1.643e-28
Identity = 77/272 (28.31%), Postives = 135/272 (49.63%), Query Frame = 1
Query: 1438 ENFDLGKEIARGGFGIVFHCQEKISGKNVILKKLIDKKLTS----FYRDIFISYHLNQAEHLVNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPINPISKELNELINLCLTVNPDERPTGEELMKSEFFKDC 2241
            E +   +E+ +G  GIVF   + +  ++ +  K ID K  S       +I +    N  ++LVN  +      +  + + M YM GG LT  + + +     ++E+ I  +  + L  I+ LH   +IH DIK DN++   +G+ K  D+G   ++E  E       ++++  GT Y++APEV+  + Y  K DIWS G++ +EM+ G+PP+ +    R    +    +   K  + +S  L + ++ CL V  D R T +EL+   F  DC
Sbjct:  291 ERYKTTQEVGKGASGIVFIAAD-LQNESQVAVKTIDMKNQSSKDLILTEIRVLKDFNH-KNLVNFLDAYLLEPEDQLWVVMEYMDGGPLTDVVTETV-----MKERQIACVCRETLYAISFLHAKGIIHRDIKSDNVLLGMDGSVKVTDFGFCANIEGDE-------KRQTMVGTPYWMAPEVVTRKKYGKKVDIWSIGIMAIEMIEGQPPYLYETPLRALYLIAANGRPDIKSWDKLSPNLQDFLDRCLQVEVDRRATADELLSHPFLNDC 548          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Nek2 (gene:FBgn0029970 transcript:FBtr0071142)

HSP 1 Score: 110.538 bits (275), Expect = 2.283e-24
Identity = 76/284 (26.76%), Postives = 146/284 (51.41%), Query Frame = 1
Query: 1399 QGGGILFEKMKRLENFDLGKEIARGGFGIVFHCQEKISG-----KNVILKKLIDKKLTSFYRDIFISYHLNQAEHLVNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQI----NELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPINPI-SKELNELINLCLTVNPDERPTGEELMK 2220
            +  G+ F + K L+++++   +  G FG  +  ++K +G     K +   +L + K  +   +I +   L Q  ++V  +  + +    S+ + M   +GG L   +++   Q +  +E +I ++ +Q+   +    N++    ++H DIKP NI  D  GNAK  D+GLA+ + R +  A       S  GT +Y++PE++KG  Y  K+D+W+ G ++ EM   +PPF      ++S    K+ + +F  I  I S +L E+I   L V+ ++RP  E +++
Sbjct:    5 ESAGMDFSQ-KTLQDYEVLAVMGNGSFGTCYKVRDKSTGELFAWKGMNYDELDEAKCDALVSEISVLRQL-QHPNIVQYYHHLVNREAKSVYIVMECCAGGDLAQIVQRARSQRQRFEEPYIWRVLFQLCRALQVCHNKIPNGTILHRDIKPANIFLDAAGNAKLGDFGLARMLRRDQSFA------ASFVGTPHYMSPELVKGRKYDRKSDVWAVGCLVYEMCALRPPFRGRAFDQLS---EKIAQGEFSRIPAIYSTDLQEIIAFMLAVDHEQRPGIEVIIR 277          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: mbt (gene:FBgn0025743 transcript:FBtr0074285)

HSP 1 Score: 109.383 bits (272), Expect = 4.280e-24
Identity = 78/278 (28.06%), Postives = 128/278 (46.04%), Query Frame = 1
Query: 1438 ENFDLGKEIARGGFGIVFHCQEKISGKNVILKKLIDKKLTS---FYRDIFIS---YHLNQAEHLVNGFEIVQDYNDGSIN----LAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPINPISKELNELINLCLTVNPDERPTGEELMKSEFFKDC 2241
            EN D   +I  G  G V    +K +G+ V +KK+  +K       + ++ I    +H N          IV+ Y+   +N    + M Y+ GG+LT  +         + E+ I  +  Q L  +  LH   VIH DIK D+I+   +G  K  D+G    V      +Q   +++S  GT Y+++PEVI    Y  + DIWS G++++EMV G+PPF      +    +  M+    K  + +S  L   ++  L  +P +R T  EL+   F +  
Sbjct:  366 ENLDHFNKIGEGSTGTVCIATDKSTGRQVAVKKMDLRKQQRRELLFNEVVIMRDYHHPN----------IVETYSSFLVNDELWVVMEYLEGGALTDIVTHSR-----MDEEQIATVCKQCLKALAYLHSQGVIHRDIKSDSILLAADGRVKLSDFGFCAQV------SQELPKRKSLVGTPYWMSPEVISRLPYGPEVDIWSLGIMVIEMVDGEPPFFNEPPLQAMRRIRDMQPPNLKNAHKVSPRLQSFLDRMLVRDPAQRATAAELLAHPFLRQA 622          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:ZFIN;Acc:ZDB-GENE-070910-1])

HSP 1 Score: 129.028 bits (323), Expect = 2.645e-30
Identity = 87/272 (31.99%), Postives = 141/272 (51.84%), Query Frame = 1
Query: 1453 GKEIARGGFGIVFHCQEKISGKNVILKKL--------IDKKLTSFYRDIFISYHLNQAEHLVNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPINP-----ISKELNELINLCLTVNPDERPTGEELMKSEF 2229
            GK + +G FG V+ C +  +G+ +  K++          K++++   +I +  +L+  E +V  +  ++D+N+ ++ + M YM GGS    ++  LK +  L E    K + QIL  ++ LH   ++H DIK  NI+ D  GN K  D+G +K   RL+    S     S  GT Y+++PEVI GE Y  K D+WS G  +VEM+T KPP  WA        +  + K   +P NP     IS+   + +  C+ V    RP+ EEL++  F
Sbjct:  347 GKLLGQGAFGRVYLCYDVDTGRELAAKQVHFDPASPETSKEVSALECEIQLLKNLHH-ERIVQYYGCLRDHNEKTLTIFMEYMPGGS----VKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASK---RLQTICMSSTGVRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPP--WAEFE----AMAAIFKIATQPTNPQLPSHISEHTRDFLR-CIFVEAKYRPSAEELLRHPF 603          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:ZFIN;Acc:ZDB-GENE-070910-1])

HSP 1 Score: 128.642 bits (322), Expect = 3.567e-30
Identity = 87/272 (31.99%), Postives = 141/272 (51.84%), Query Frame = 1
Query: 1453 GKEIARGGFGIVFHCQEKISGKNVILKKL--------IDKKLTSFYRDIFISYHLNQAEHLVNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPINP-----ISKELNELINLCLTVNPDERPTGEELMKSEF 2229
            GK + +G FG V+ C +  +G+ +  K++          K++++   +I +  +L+  E +V  +  ++D+N+ ++ + M YM GGS    ++  LK +  L E    K + QIL  ++ LH   ++H DIK  NI+ D  GN K  D+G +K   RL+    S     S  GT Y+++PEVI GE Y  K D+WS G  +VEM+T KPP  WA        +  + K   +P NP     IS+   + +  C+ V    RP+ EEL++  F
Sbjct:  365 GKLLGQGAFGRVYLCYDVDTGRELAAKQVHFDPASPETSKEVSALECEIQLLKNLHH-ERIVQYYGCLRDHNEKTLTIFMEYMPGGS----VKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASK---RLQTICMSSTGVRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPP--WAEFE----AMAAIFKIATQPTNPQLPSHISEHTRDFLR-CIFVEAKYRPSAEELLRHPF 621          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:ZFIN;Acc:ZDB-GENE-070910-1])

HSP 1 Score: 128.257 bits (321), Expect = 4.591e-30
Identity = 87/272 (31.99%), Postives = 141/272 (51.84%), Query Frame = 1
Query: 1453 GKEIARGGFGIVFHCQEKISGKNVILKKL--------IDKKLTSFYRDIFISYHLNQAEHLVNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPINP-----ISKELNELINLCLTVNPDERPTGEELMKSEF 2229
            GK + +G FG V+ C +  +G+ +  K++          K++++   +I +  +L+  E +V  +  ++D+N+ ++ + M YM GGS    ++  LK +  L E    K + QIL  ++ LH   ++H DIK  NI+ D  GN K  D+G +K   RL+    S     S  GT Y+++PEVI GE Y  K D+WS G  +VEM+T KPP  WA        +  + K   +P NP     IS+   + +  C+ V    RP+ EEL++  F
Sbjct:  359 GKLLGQGAFGRVYLCYDVDTGRELAAKQVHFDPASPETSKEVSALECEIQLLKNLHH-ERIVQYYGCLRDHNEKTLTIFMEYMPGGS----VKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASK---RLQTICMSSTGVRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPP--WAEFE----AMAAIFKIATQPTNPQLPSHISEHTRDFLR-CIFVEAKYRPSAEELLRHPF 615          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-120215-96])

HSP 1 Score: 120.939 bits (302), Expect = 1.110e-27
Identity = 86/276 (31.16%), Postives = 141/276 (51.09%), Query Frame = 1
Query: 1441 NFDLGKEIARGGFGIVFHCQEKISGKNVILKKL--------IDKKLTSFYRDIFISYHLNQAEHLVNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPINP-----ISKELNELINLCLTVNPDERPTGEELMKSEF 2229
            N+ LGK + +G FG VF C +  +G+ + +K++          K++++   +I +  +L   E +V  +  ++D ++ ++++ M YM GGS    I+  LK +  L E    K + QIL  +  LH   ++H DIK  NI+ D  GN K  D+G ++   RL+    S    +S  GT Y+++PEVI GE Y  K DIWS G  +VEM+T +PP  WA        +  + K   +P NP     +S    + +     V   +RP  E+L++  F
Sbjct:  353 NWRLGKLLGQGAFGRVFLCYDADTGRELAVKQVQFDPDSPETSKEVSALECEIQLLKNLFH-ERIVQYYGCLRDTHEKTLSIFMEYMPGGS----IKDQLKSYGALTENVTRKYTRQILEGVCYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASR---RLQTICLSGTGIKSVTGTPYWMSPEVISGEGYGRKADIWSIGCTVVEMLTQRPP--WAEFE----AMAAIFKIATQPTNPTLPPHVSDHCRDFLKRIF-VETKQRPAAEDLLRHTF 613          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-120215-96])

HSP 1 Score: 120.553 bits (301), Expect = 1.440e-27
Identity = 86/276 (31.16%), Postives = 141/276 (51.09%), Query Frame = 1
Query: 1441 NFDLGKEIARGGFGIVFHCQEKISGKNVILKKL--------IDKKLTSFYRDIFISYHLNQAEHLVNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPINP-----ISKELNELINLCLTVNPDERPTGEELMKSEF 2229
            N+ LGK + +G FG VF C +  +G+ + +K++          K++++   +I +  +L   E +V  +  ++D ++ ++++ M YM GGS    I+  LK +  L E    K + QIL  +  LH   ++H DIK  NI+ D  GN K  D+G ++   RL+    S    +S  GT Y+++PEVI GE Y  K DIWS G  +VEM+T +PP  WA        +  + K   +P NP     +S    + +     V   +RP  E+L++  F
Sbjct:  361 NWRLGKLLGQGAFGRVFLCYDADTGRELAVKQVQFDPDSPETSKEVSALECEIQLLKNLFH-ERIVQYYGCLRDTHEKTLSIFMEYMPGGS----IKDQLKSYGALTENVTRKYTRQILEGVCYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASR---RLQTICLSGTGIKSVTGTPYWMSPEVISGEGYGRKADIWSIGCTVVEMLTQRPP--WAEFE----AMAAIFKIATQPTNPTLPPHVSDHCRDFLKRIF-VETKQRPAAEDLLRHTF 621          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: samd8 (sterile alpha motif domain containing 8 [Source:Xenbase;Acc:XB-GENE-1012742])

HSP 1 Score: 122.479 bits (306), Expect = 4.473e-28
Identity = 85/276 (30.80%), Postives = 141/276 (51.09%), Query Frame = 1
Query: 1441 NFDLGKEIARGGFGIVFHCQEKISGKNVILKKL--------IDKKLTSFYRDIFISYHLNQAEHLVNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPINP-----ISKELNELINLCLTVNPDERPTGEELMKSEF 2229
            N+  GK + +G FG V+ C +  +G+ +  K++          K++++   +I +  +L+  + +V  +  ++D  + ++ + M YM GGS    ++  LK +  L E    + + QIL  ++ LH   ++H DIK  NI+ D  GN K  D+G +K   RL+    S     S  GT Y+++PEVI GE Y  K D+WS G  +VEM+T KPP  WA        +  + K   +P NP      S++  + +   L V   +RPT EEL++  F
Sbjct:  364 NWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVQFDPDSPETSKEVSALECEIQLLKNLHH-DRIVQYYGSLRDKGEKTLTIFMEYMPGGS----VKDQLKAYGALTENVTRRYTRQILEGVSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASK---RLQTICMSGTGIRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPP--WAEYE----AMAAIFKIATQPTNPQLPPNTSEQCRDFVKRIL-VEARQRPTAEELIRHPF 624          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: samd8 (sterile alpha motif domain containing 8 [Source:Xenbase;Acc:XB-GENE-1012742])

HSP 1 Score: 122.094 bits (305), Expect = 5.175e-28
Identity = 85/276 (30.80%), Postives = 141/276 (51.09%), Query Frame = 1
Query: 1441 NFDLGKEIARGGFGIVFHCQEKISGKNVILKKL--------IDKKLTSFYRDIFISYHLNQAEHLVNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPINP-----ISKELNELINLCLTVNPDERPTGEELMKSEF 2229
            N+  GK + +G FG V+ C +  +G+ +  K++          K++++   +I +  +L+  + +V  +  ++D  + ++ + M YM GGS    ++  LK +  L E    + + QIL  ++ LH   ++H DIK  NI+ D  GN K  D+G +K   RL+    S     S  GT Y+++PEVI GE Y  K D+WS G  +VEM+T KPP  WA        +  + K   +P NP      S++  + +   L V   +RPT EEL++  F
Sbjct:  346 NWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVQFDPDSPETSKEVSALECEIQLLKNLHH-DRIVQYYGSLRDKGEKTLTIFMEYMPGGS----VKDQLKAYGALTENVTRRYTRQILEGVSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASK---RLQTICMSGTGIRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPP--WAEYE----AMAAIFKIATQPTNPQLPPNTSEQCRDFVKRIL-VEARQRPTAEELIRHPF 606          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: MAP3K2 (mitogen-activated protein kinase kinase kinase 2 [Source:NCBI gene;Acc:100493570])

HSP 1 Score: 121.324 bits (303), Expect = 1.039e-27
Identity = 88/276 (31.88%), Postives = 141/276 (51.09%), Query Frame = 1
Query: 1441 NFDLGKEIARGGFGIVFHCQEKISGKNVILKKL--------IDKKLTSFYRDIFISYHLNQAEHLVNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPINP-----ISKELNELINLCLTVNPDERPTGEELMKSEF 2229
            N+ LGK + +G FG V+ C +  +G+ + +K++          K++ +   +I +  +L   E +V  +  ++D  + ++++ M YM GGS    I+  LK +  L E    K + QIL  ++ LH   ++H DIK  NI+ D  GN K  D+G +K   RL+    S    +S  GT Y+++PEVI GE Y  K DIWS G  +VEM+T KPP  WA        +  + K   +P NP     +S+   + +     V    RP+ EEL++  F
Sbjct:  338 NWRLGKLLGQGAFGRVYLCYDADTGRELAVKQVQFDPDSLETSKEVNALECEIQLLKNLLH-ERIVQYYGCLRDSQEKTLSIFMEYMPGGS----IKDQLKAYGALTEFVTRKYTRQILEGVHYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASK---RLQTICLSGTGMKSVTGTPYWMSPEVISGEGYGRKADIWSVGCTVVEMLTEKPP--WAEFE----AMAAIFKIATQPTNPQLPAHVSEHCRDFLKRIF-VEAKVRPSSEELLRHTF 598          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: MAP3K2 (mitogen-activated protein kinase kinase kinase 2 [Source:NCBI gene;Acc:100493570])

HSP 1 Score: 121.324 bits (303), Expect = 1.234e-27
Identity = 88/276 (31.88%), Postives = 141/276 (51.09%), Query Frame = 1
Query: 1441 NFDLGKEIARGGFGIVFHCQEKISGKNVILKKL--------IDKKLTSFYRDIFISYHLNQAEHLVNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPINP-----ISKELNELINLCLTVNPDERPTGEELMKSEF 2229
            N+ LGK + +G FG V+ C +  +G+ + +K++          K++ +   +I +  +L   E +V  +  ++D  + ++++ M YM GGS    I+  LK +  L E    K + QIL  ++ LH   ++H DIK  NI+ D  GN K  D+G +K   RL+    S    +S  GT Y+++PEVI GE Y  K DIWS G  +VEM+T KPP  WA        +  + K   +P NP     +S+   + +     V    RP+ EEL++  F
Sbjct:  366 NWRLGKLLGQGAFGRVYLCYDADTGRELAVKQVQFDPDSLETSKEVNALECEIQLLKNLLH-ERIVQYYGCLRDSQEKTLSIFMEYMPGGS----IKDQLKAYGALTEFVTRKYTRQILEGVHYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASK---RLQTICLSGTGMKSVTGTPYWMSPEVISGEGYGRKADIWSVGCTVVEMLTEKPP--WAEFE----AMAAIFKIATQPTNPQLPAHVSEHCRDFLKRIF-VEAKVRPSSEELLRHTF 626          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: dennd1a (DENN domain containing 1A [Source:Xenbase;Acc:XB-GENE-5729862])

HSP 1 Score: 117.472 bits (293), Expect = 1.681e-26
Identity = 83/276 (30.07%), Postives = 141/276 (51.09%), Query Frame = 1
Query: 1438 ENFDLGKEIARGGFGIVFHCQEKISGKNVILKKL--------IDKKLTSFYRDIFISYHLNQAEHLVNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPFH----WAGIGRVSLELTKMKKYKFKPINPISKELNELINLCLTVNPDERPTGEELMKSEF 2229
            EN+ LGK + RG FG V+ C +   G+ + +K++          K++ +   +I +   L++ E +V  +  ++D  +  +++ + YM GGS    I+  LK +  L E    + + QIL  ++ LH   ++H DIK  NI+ D  GN K  D+G +K ++ +     S    +S  GT Y+++PEVI GE Y  K D+WS    +VEM+T KPP+      A I +++ + TK +       + +S    + +     V    RPT EEL++  F
Sbjct:  352 ENWRLGKLLGRGAFGEVYLCYDVDKGRELAVKQVPFDPDSQETSKEVNALECEIQL-LKLHRHERIVQYYGCLRDPTERKLSIFVEYMPGGS----IKDQLKAYGALTENVTRRYTRQILQGVSYLHGNMIVHRDIKGANILRDSAGNVKLGDFGASKRIQTI---CMSGTGIKSVTGTPYWMSPEVISGEGYGRKADVWSVACTVVEMLTEKPPWSEYEAMAAIFKIATQPTKPRL-----PDTVSDACRDFMKQIF-VEEKRRPTAEELLRHLF 613          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:MGI Symbol;Acc:MGI:1346874])

HSP 1 Score: 119.013 bits (297), Expect = 4.527e-27
Identity = 87/278 (31.29%), Postives = 139/278 (50.00%), Query Frame = 1
Query: 1441 NFDLGKEIARGGFGIVFHCQEKISGKNVILKKL--------IDKKLTSFYRDIFISYHLNQAEHLVNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPINP-----ISKELNELINLCLTVNPDERPTGEELMKSEFFK 2235
            N+  GK + +G FG V+ C +  +G+ +  K++          K++++   +I +  +L Q E +V  +  ++D  +  + + M YM GGS    ++  LK +  L E    K + QIL  ++ LH   ++H DIK  NI+ D  GN K  D+G +K   RL+    S     S  GT Y+++PEVI GE Y  K D+WS G  +VEM+T KPP  WA        +  + K   +P NP     IS+   + +     V   +RP+ EEL+   F +
Sbjct:  361 NWRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKNL-QHERIVQYYGCLRDRAEKILTIFMEYMPGGS----VKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASK---RLQTICMSGTGIRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPP--WAEYE----AMAAIFKIATQPTNPQLPSHISEHGRDFLRRIF-VEARQRPSAEELLTHHFAQ 623          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Nek7 (NIMA (never in mitosis gene a)-related expressed kinase 7 [Source:MGI Symbol;Acc:MGI:1890645])

HSP 1 Score: 111.309 bits (277), Expect = 3.618e-26
Identity = 77/263 (29.28%), Postives = 130/263 (49.43%), Query Frame = 1
Query: 1435 LENFDLGKEIARGGFGIVFHCQEKISGKNVILKK-----LIDKKLTS-FYRDIFISYHLNQAEHLVNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPI--NPISKELNELINLCLTVNPDERP 2199
            L NF + K+I RG F  V+     + G  V LKK     L+D K  +   ++I +   LN    +      ++D     +N+ +     G L+  I+   KQ + + E+ + K   Q+ + ++ +H  +V+H DIKP N+     G  K  D GL +        A S        GT YY++PE I    Y++K+DIWS G +L EM   + PF+   +   SL   K+++  + P+  +  S+EL +L+N+C+  +P++RP
Sbjct:   31 LANFRIEKKIGRGQFSEVYRASCLLDGVPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIED---NELNIVLELADAGDLSRMIKHFKKQKRLIPERTVWKYFVQLCSALDHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLV------GTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSL-CKKIEQCDYPPLPSDHYSEELRQLVNICINPDPEKRP 283          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Nek7 (NIMA (never in mitosis gene a)-related expressed kinase 7 [Source:MGI Symbol;Acc:MGI:1890645])

HSP 1 Score: 111.309 bits (277), Expect = 3.618e-26
Identity = 77/263 (29.28%), Postives = 130/263 (49.43%), Query Frame = 1
Query: 1435 LENFDLGKEIARGGFGIVFHCQEKISGKNVILKK-----LIDKKLTS-FYRDIFISYHLNQAEHLVNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPI--NPISKELNELINLCLTVNPDERP 2199
            L NF + K+I RG F  V+     + G  V LKK     L+D K  +   ++I +   LN    +      ++D     +N+ +     G L+  I+   KQ + + E+ + K   Q+ + ++ +H  +V+H DIKP N+     G  K  D GL +        A S        GT YY++PE I    Y++K+DIWS G +L EM   + PF+   +   SL   K+++  + P+  +  S+EL +L+N+C+  +P++RP
Sbjct:   31 LANFRIEKKIGRGQFSEVYRASCLLDGVPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIED---NELNIVLELADAGDLSRMIKHFKKQKRLIPERTVWKYFVQLCSALDHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLV------GTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSL-CKKIEQCDYPPLPSDHYSEELRQLVNICINPDPEKRP 283          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:MGI Symbol;Acc:MGI:1346873])

HSP 1 Score: 115.161 bits (287), Expect = 6.615e-26
Identity = 87/276 (31.52%), Postives = 139/276 (50.36%), Query Frame = 1
Query: 1441 NFDLGKEIARGGFGIVFHCQEKISGKNVILKKL--------IDKKLTSFYRDIFISYHLNQAEHLVNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPINP-----ISKELNELINLCLTVNPDERPTGEELMKSEF 2229
            N+ LGK + +G FG V+ C +  +G+ + +K++          K++ +   +I +  +L   E +V  +  ++D  + ++++ M YM GGS    I+  LK +  L E    K + QIL  ++ LH   ++H DIK  NI+ D  GN K  D+G +K   RL+    S    +S  GT Y+++PEVI GE Y  K DIWS    +VEM+T KPP  WA        +  + K   +P NP     +S    + +     V    RP+ EEL++  F
Sbjct:  355 NWRLGKLLGQGAFGRVYLCYDVDTGRELAVKQVQFNPESPETSKEVNALECEIQLLKNLLH-ERIVQYYGCLRDPQEKTLSIFMEYMPGGS----IKDQLKAYGALTENVTRKYTRQILEGVHYLHSNMIVHRDIKGANILRDSTGNIKLGDFGASK---RLQTICLSGTGMKSVTGTPYWMSPEVISGEGYGRKADIWSVACTVVEMLTEKPP--WAEFE----AMAAIFKIATQPTNPKLPPHVSDYTRDFLKRIF-VEAKLRPSAEELLRHMF 615          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Myo3a (myosin IIIA [Source:MGI Symbol;Acc:MGI:2183924])

HSP 1 Score: 113.62 bits (283), Expect = 3.724e-25
Identity = 82/294 (27.89%), Postives = 143/294 (48.64%), Query Frame = 1
Query: 1393 PFQGGGILFEKMKR-LENFDLGKEIARGGFGIVFHCQEKISGKNVILKKL-----IDKKLTSFYRDIFISYHLNQAEHLVNGFEIV---QDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGE-----LYSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPINPISKELNELINLCLTVNPDERPTGEELMKSEFF 2232
            P  G  I+F+      + +++ + I +G +G VF    K SG+   +K L     ID+++ + Y    I   L+   ++V  + I       N   + L +   +GGS+T  ++  LK+ + + E  I  I ++ L  +  LH  K IH D+K +NI+   EG  K +D+G++  +      + +R R  +S GT +++APEVI  E      Y  + D WS G+  +E+  G PP       R   ++ +    K +     S E N+ I+ CLT + ++RPT  +L+K +F 
Sbjct:    3 PLIGKTIIFDNFPDPSDTWEIIETIGKGTYGKVFKVLNKKSGQKAAVKILDPIHDIDEEIEAEYN---ILRTLSDHPNVVRFYGIYFKKDKINGDKLWLVLELCNGGSVTDLVKGFLKRGERMSEPVIAYILHEALMGLQHLHSNKTIHRDVKGNNILLTTEGGVKLVDFGVSAQL------SSTRHRLNTSVGTPFWMAPEVIACEQQLDTTYDARCDTWSLGITAIELGDGDPPLAELHPMRALFKIPRNPPPKLRQPELWSAEFNDFISKCLTKDYEKRPTVSDLLKHKFI 287          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q10407|MKH1_SCHPO (MAP kinase kinase kinase mkh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mkh1 PE=3 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 1.978e-28
Identity = 94/299 (31.44%), Postives = 154/299 (51.51%), Query Frame = 1
Query: 1453 GKEIARGGFGIVF-----HCQEKISGKNVILKKLIDKKLTSFYRDIFISY-----------HLNQAEHLVNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKG--ELYSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKP---INPISKELNELINLCLTVNPDERPTGEELMKSEFFKDCLHK*HFIITLLYSII 2286
            G+ I  G +G VF     +  E I+ K V + + I+ +     +DI  S            HLN  ++L  GFE  +      I++ + Y+SGGS    I +CL+ +   +E+ +  +S Q+L  ++ LH   +IH D+K DN++ D +G  K  D+G++KH + +     +     S  G+I+++APEVI    + YS K D+WS G V++EM+ G+ P+      +   +L   KK    P   ++ +S E  + +N C TVN D RPT EEL+   F K C  + +F  T LY ++
Sbjct:  828 GELIGNGTYGKVFLAMNINTGELIAVKQVEIPQTINGRHDQLRKDIVDSINAEISMIADLDHLNIVQYL--GFEKTE----TDISIFLEYVSGGS----IGRCLRNYGPFEEQLVRFVSRQVLYGLSYLHSKGIIHRDLKADNLLIDFDGVCKISDFGISKHSDNVYDNDANL----SMQGSIFWMAPEVIHNDHQGYSAKVDVWSLGCVVLEMLAGRRPWSTDEAIQAMFKLGTEKKAPPIPSELVSQVSPEAIQFLNACFTVNADVRPTAEELLNHPFMK-CDEEFNFKDTNLYDML 1111          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q99759|M3K3_HUMAN (Mitogen-activated protein kinase kinase kinase 3 OS=Homo sapiens OX=9606 GN=MAP3K3 PE=1 SV=2)

HSP 1 Score: 121.709 bits (304), Expect = 3.995e-27
Identity = 87/278 (31.29%), Postives = 140/278 (50.36%), Query Frame = 1
Query: 1441 NFDLGKEIARGGFGIVFHCQEKISGKNVILKKL--------IDKKLTSFYRDIFISYHLNQAEHLVNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPINP-----ISKELNELINLCLTVNPDERPTGEELMKSEFFK 2235
            N+  GK + +G FG V+ C +  +G+ +  K++          K++++   +I +  +L Q E +V  +  ++D  + ++ + M YM GGS    ++  LK +  L E    K + QIL  ++ LH   ++H DIK  NI+ D  GN K  D+G +K   RL+    S     S  GT Y+++PEVI GE Y  K D+WS G  +VEM+T KPP  WA        +  + K   +P NP     IS+   + +     V   +RP+ EEL+   F +
Sbjct:  361 NWRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKNL-QHERIVQYYGCLRDRAEKTLTIFMEYMPGGS----VKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASK---RLQTICMSGTGMRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPP--WAEYE----AMAAIFKIATQPTNPQLPSHISEHGRDFLRRIF-VEARQRPSAEELLTHHFAQ 623          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9S7U9|M2K2_ARATH (Mitogen-activated protein kinase kinase 2 OS=Arabidopsis thaliana OX=3702 GN=MKK2 PE=1 SV=2)

HSP 1 Score: 117.087 bits (292), Expect = 8.506e-27
Identity = 82/275 (29.82%), Postives = 134/275 (48.73%), Query Frame = 1
Query: 1435 LENFDLGKEIARGGFGIVFHCQEKISGKNVILKKLIDKKLTSFYRDIFISYHLNQAEHLVNGFEIVQD-YNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECK-VIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPFH-------WAGIGRVSLELTKMKKYKFKPINPISKELNELINLCLTVNPDERPTGEELMKSEFF 2232
            L + D+ K I +G  G+V   Q K +G+   LK +      +  + I     +NQ+    N     Q  Y++G+I+L + YM GGSL  +    LK  K + + ++  I  Q+L  +  LH  + +IH D+KP N++ +  G  K  D+G++  +    G A +        GT  Y++PE I G  Y  K+DIWS G+V++E  TGK P+        W  +  + +E    +     P    S EL+  I+ CL  +P+ R + +ELM+  F 
Sbjct:   67 LSDLDMVKVIGKGSSGVVQLVQHKWTGQFFALKVIQLNIDEAIRKAIAQELKINQSSQCPNLVTSYQSFYDNGAISLILEYMDGGSLADF----LKSVKAIPDSYLSAIFRQVLQGLIYLHHDRHIIHRDLKPSNLLINHRGEVKITDFGVSTVMTNTAGLANTFV------GTYNYMSPERIVGNKYGNKSDIWSLGLVVLECATGKFPYAPPNQEETWTSVFEL-MEAIVDQPPPALPSGNFSPELSSFISTCLQKDPNSRSSAKELMEHPFL 330          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|P32491|MKK2_YEAST (MAP kinase kinase MKK2/SSP33 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MKK2 PE=1 SV=2)

HSP 1 Score: 119.398 bits (298), Expect = 1.086e-26
Identity = 86/267 (32.21%), Postives = 138/267 (51.69%), Query Frame = 1
Query: 1462 IARGGFGIVFHCQEKISGKNVILKKLIDKKLT--SFYRDIFISYHLNQA---EHLVNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPF-------HWAGIGRVSLELTKMKKYKFKPINPI--SKELNELINLCLTVNPDERPTGEELMK 2220
            +  G  G V  C+ K +GK V   K I+   T   + + IF     N++   +++V  + +  D    SI +AM YM G SL +  +  LK+   + E+ I KI+  +L  ++ LHE KVIH DIKP NI+ + +G  K  D+G++   E +   A +        GT +Y+APE I+G+ YS   D+WS G+ L+E+  G+ PF       + A I  +++ LT   + K +P   I  SK     I+ CL  +  ERP+  +++K
Sbjct:  220 LGEGAGGSVAKCRLK-NGKKVFALKTINTMNTDPEYQKQIFRELQFNKSFKSDYIVQYYGMFTDEQSSSIYIAMEYMGGKSLEATYKNLLKRGGRISERVIGKIAESVLRGLSYLHERKVIHRDIKPQNILLNEKGEIKLCDFGVSG--EAVNSLAMTFT------GTSFYMAPERIQGQPYSVTCDVWSLGLTLLEVAGGRFPFESDKITQNVAPIELLTMILTFSPQLKDEPELDISWSKTFRSFIDYCLKKDARERPSPRQMLK 477          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q61084|M3K3_MOUSE (Mitogen-activated protein kinase kinase kinase 3 OS=Mus musculus OX=10090 GN=Map3k3 PE=1 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 3.167e-26
Identity = 87/278 (31.29%), Postives = 139/278 (50.00%), Query Frame = 1
Query: 1441 NFDLGKEIARGGFGIVFHCQEKISGKNVILKKL--------IDKKLTSFYRDIFISYHLNQAEHLVNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPINP-----ISKELNELINLCLTVNPDERPTGEELMKSEFFK 2235
            N+  GK + +G FG V+ C +  +G+ +  K++          K++++   +I +  +L Q E +V  +  ++D  +  + + M YM GGS    ++  LK +  L E    K + QIL  ++ LH   ++H DIK  NI+ D  GN K  D+G +K   RL+    S     S  GT Y+++PEVI GE Y  K D+WS G  +VEM+T KPP  WA        +  + K   +P NP     IS+   + +     V   +RP+ EEL+   F +
Sbjct:  361 NWRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKNL-QHERIVQYYGCLRDRAEKILTIFMEYMPGGS----VKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASK---RLQTICMSGTGIRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPP--WAEYE----AMAAIFKIATQPTNPQLPSHISEHGRDFLRRIF-VEARQRPSAEELLTHHFAQ 623          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A1R2CRM4 (Protein kinase domain-containing protein OS=Stentor coeruleus OX=5963 GN=SteCoe_5689 PE=3 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 4.221e-33
Identity = 90/272 (33.09%), Postives = 153/272 (56.25%), Query Frame = 1
Query: 1453 GKEIARGGFGIVFHCQEKISGKNVILK--------KLIDKKLTSFYRDIFISYHLNQAEHLVNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPF-HWAGIGRVSLELTKMKKYKFKPINPISKE-LNELINLCLTVNPDERPTGEELMKSEFFKD 2238
            G  I  G +  V+ C   I+G+ + LK        + I+++     ++I +   LN  E++V+ ++     +  S+++ + Y+ GGSL S     L ++K L+   I   S Q+L  +N LH+ K+IH D+KP N++    G  K  D+G +K  + LE         +S  G+ Y++APEV++ E +S+  DIWSFG +L+EMV+GKPP+ +++   +  +EL  + K    P  P ++  L E+I  C+  NP+ERP+  EL++SEFFK+
Sbjct:   64 GDLIGEGAYAKVYQCLNIITGELLALKTFYISENPRKIEREFQQMRKEIRVLKTLNH-ENVVHYYQADLSEDLKSVDILLEYVPGGSLKS----ILIKYKSLEISVIKNYSRQLLRGLNYLHDNKIIHRDLKPANVLISPTGMLKLTDFGSSKQFDDLESNLS-----KSLKGSPYWMAPEVVRMEGHSFSADIWSFGCILIEMVSGKPPWSNYSNDSKAVMEL--ISKEGLLPDIPSTEPLLQEIITHCVNRNPNERPSPPELLESEFFKN 323          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A085ML90 (Protein kinase domain-containing protein OS=Trichuris suis OX=68888 GN=M513_01219 PE=3 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 1.532e-31
Identity = 95/293 (32.42%), Postives = 147/293 (50.17%), Query Frame = 1
Query: 1375 QMNDGDPFQGGGILFEKMKRLENFDLGKEIARGGFGIVFHCQEK----ISGKNVILKKLI--DKKLTSFYRDIFISYHLNQAEHL-VNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPINPISKELNELINLCLTVNPDERPTGEELMKSEFF 2232
            +M    P      +   M  L++FDLG+++ RG FG VF  +EK    I    V+ K  +   K      R+I I  HL     L + G+     ++D  + L + Y + G L S + Q  K  + L   ++     Q++  +N LH  KVIH D+K +NI+   +G  K  D+G A H            R+E+  GT+ YL PE++ G  +  + DIWS G+++ EM+TGKPPF+ +         T++ K  FK  + +S E  +LI+  L +NPDERP+ EE+ K  F 
Sbjct:   75 EMVPSKPAAMAAEVKRHMWTLDDFDLGRQLGRGRFGRVFLAREKERQFIVALKVLFKSTVMKAKMENQVRREIEIQAHLKHPNILRLYGYF----HDDARVYLVLEYAAKGELYSMLTQAGKFTEDLTANYMA----QVVDAVNYLHTKKVIHRDLKLENILLSKDGKIKISDFGWAVHA--------PSSRRETLCGTVDYLPPEMVGGMQHDARVDIWSLGVLMYEMLTGKPPFYCSDQRETC---TRILKCTFKIPDEVSDEAKDLISKLLRLNPDERPSLEEVTKHPFI 348          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A085NMY2 (Protein kinase domain-containing protein OS=Trichuris suis OX=68888 GN=M514_01219 PE=3 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 1.634e-31
Identity = 97/297 (32.66%), Postives = 148/297 (49.83%), Query Frame = 1
Query: 1375 QMNDGDPFQGGGILFEKMKRLENFDLGKEIARGGFGIVFHCQEK----ISGKNVILKKLI--DKKLTSFYRDIFISYHLNQAEHL-VNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCL----QEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPINPISKELNELINLCLTVNPDERPTGEELMKSEFF 2232
            +M    P      +   M  L++FDLG+++ RG FG VF  +EK    I    V+ K  +   K      R+I I  HL     L + G+     ++D  + L + Y + G L S + Q  K  + L    Q   I+    Q++  +N LH  KVIH D+K +NI+   +G  K  D+G A H            R+E+  GT+ YL PE++ G  +  + DIWS G+++ EM+TGKPPF+ +         T++ K  FK  + +S E  +LI+  L +NPDERP+ EE+ K  F 
Sbjct:   75 EMVPSKPAAMAAEVKRHMWTLDDFDLGRQLGRGRFGRVFLAREKERQFIVALKVLFKSTVMKAKMENQVRREIEIQAHLKHPNILRLYGYF----HDDARVYLVLEYAAKGELYSMLTQAGKFTEDLTANVQSNSILFYMAQVVDAVNYLHTKKVIHRDLKLENILLSKDGKIKISDFGWAVHA--------PSSRRETLCGTVDYLPPEMVGGMQHDARVDIWSLGVLMYEMLTGKPPFYCSDQRETC---TRILKCTFKIPDEVSDEAKDLISKLLRLNPDERPSLEEVTKHPFI 356          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A1R2CWZ9 (Protein kinase domain-containing protein OS=Stentor coeruleus OX=5963 GN=SteCoe_3518 PE=3 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 2.485e-31
Identity = 85/271 (31.37%), Postives = 150/271 (55.35%), Query Frame = 1
Query: 1453 GKEIARGGFGIVFHCQEKISGKNVILK--------KLIDKKLTSFYRDIFISYHLNQAEHLVNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPF-HWAGIGRVSLELTKMKKYKFKPINPISKELNELINLCLTVNPDERPTGEELMKSEFFKD 2238
            G  I  G +  V+ C   ++G+ + LK        + I+++     ++I +   LN  E++V+ ++     +  S+++ + Y+ GGSL S     L ++K L+   I   S Q+L  +  LH+ K+IH D+KP N++    G  K  D+G +K  + LE    SR  K    G+ Y++APEV++ E +S+  D+WSFG +L+EM +GKPP+ +++   ++ +EL   K+     I      L E+I  C+  NP+ERP+ +EL++ +FFK+
Sbjct:   64 GDLIGEGAYAKVYQCLNIVTGELLALKTFYISENPRKIEREFQQMRKEIRVLKALNH-ENVVHYYQADLSEDLKSVDILLEYVPGGSLKS----ILVKYKSLEISVIRNYSRQLLEGLKYLHDNKIIHRDLKPANVLISPTGVLKLTDFGSSKQFDDLESNL-SRSLK----GSPYWMAPEVVRMEGHSFSADVWSFGCILIEMTSGKPPWSNYSNDSKIVMELIS-KEGSLPDIPSTEPLLQEIITQCVNRNPNERPSPQELLEKDFFKN 323          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: S9UAZ3 (Protein kinase OS=Angomonas deanei OX=59799 GN=AGDE_11629 PE=4 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 5.178e-31
Identity = 91/288 (31.60%), Postives = 154/288 (53.47%), Query Frame = 1
Query: 1414 LFEKMKRLENFDLGKEIARGGFGIVFHC----QEKISGKNVILKKLIDKK-LTSFYRDIFISYHLNQAEHLVNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGE-LYSYKTDIWSFGMVLVEMVTGKPPFH-----WAGIGRVSLELTKMKKYKFKPINPISKELNELINLCLTVNPDERPTGEELMKSEFFKDCL 2244
            +F   K LEN+   K I +G FG VF      Q  +  K V L  +++K+ L   + +I +   + Q  ++V  +  +QD +  +IN+ M  ++GGSL S I    K++K +  K + + +YQI+  +  LHEC ++H DIK DN++   +G  K  D+G +K ++ +     +     +  GT Y++APEVIK E  Y  K+DIWS G  +VEM+TG+PP+      WA + +++   T +     K I+P   +L  L+  C   +P +RPT  ++++  F    +
Sbjct:   59 VFLSEKDLENWQKVKTIGKGSFGAVFEALLANQRTVCVKVVELGSIVEKEELEKLHNEIALMKRM-QHPNIVQYYGSLQDTSKNTINIFMELVTGGSLNSVI----KKFKTIPRKTLQQWTYQIVLGVKYLHECGIVHRDIKGDNVLVTPDGIIKLADFGCSKSIDDV---CSATHGCSTMVGTPYWMAPEVIKCEGGYGAKSDIWSIGCTIVEMLTGRPPWPECNSMWAAVYKIA-NSTGLPTEIPKDIDP---QLMNLLEKCFERDPRKRPTAAQMLEHPFLAGVM 334          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:103034596])

HSP 1 Score: 125.176 bits (313), Expect = 3.634e-29
Identity = 86/272 (31.62%), Postives = 140/272 (51.47%), Query Frame = 1
Query: 1453 GKEIARGGFGIVFHCQEKISGKNVILKKL--------IDKKLTSFYRDIFISYHLNQAEHLVNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPINPI-----SKELNELINLCLTVNPDERPTGEELMKSEF 2229
            GK + +G FG V+ C +  +G+ +  K++          K++++   +I +  +L+  E +V  +  ++D+N+ ++ + M YM GGS    ++  LK +  L E    K + QIL  ++ LH   ++H DIK  NI+ D  GN K  D+G +K   RL+    S     S  GT Y+++PEVI G+ Y  K D+WS G  +VEM+T KPP  WA        +  + K   +P NPI     S++  + I     V    RP+ EEL++  F
Sbjct:  359 GKLLGQGAFGRVYLCYDVDTGRELAAKQVQFDPASPETSKEVSTLECEIQLLKNLHH-ERIVQYYGCLRDHNEKTLTIFMEYMPGGS----VKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASK---RLQTICMSSTGVRSVTGTPYWMSPEVISGDGYGRKADVWSLGCTVVEMLTEKPP--WAEYE----AMAAIFKIATQPTNPILPSHTSEQTRDFIRRIF-VEAKHRPSAEELLRHPF 615          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:103034596])

HSP 1 Score: 125.176 bits (313), Expect = 3.634e-29
Identity = 86/272 (31.62%), Postives = 140/272 (51.47%), Query Frame = 1
Query: 1453 GKEIARGGFGIVFHCQEKISGKNVILKKL--------IDKKLTSFYRDIFISYHLNQAEHLVNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPINPI-----SKELNELINLCLTVNPDERPTGEELMKSEF 2229
            GK + +G FG V+ C +  +G+ +  K++          K++++   +I +  +L+  E +V  +  ++D+N+ ++ + M YM GGS    ++  LK +  L E    K + QIL  ++ LH   ++H DIK  NI+ D  GN K  D+G +K   RL+    S     S  GT Y+++PEVI G+ Y  K D+WS G  +VEM+T KPP  WA        +  + K   +P NPI     S++  + I     V    RP+ EEL++  F
Sbjct:  359 GKLLGQGAFGRVYLCYDVDTGRELAAKQVQFDPASPETSKEVSTLECEIQLLKNLHH-ERIVQYYGCLRDHNEKTLTIFMEYMPGGS----VKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASK---RLQTICMSSTGVRSVTGTPYWMSPEVISGDGYGRKADVWSLGCTVVEMLTEKPP--WAEYE----AMAAIFKIATQPTNPILPSHTSEQTRDFIRRIF-VEAKHRPSAEELLRHPF 615          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:103034596])

HSP 1 Score: 125.176 bits (313), Expect = 3.634e-29
Identity = 86/272 (31.62%), Postives = 140/272 (51.47%), Query Frame = 1
Query: 1453 GKEIARGGFGIVFHCQEKISGKNVILKKL--------IDKKLTSFYRDIFISYHLNQAEHLVNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPINPI-----SKELNELINLCLTVNPDERPTGEELMKSEF 2229
            GK + +G FG V+ C +  +G+ +  K++          K++++   +I +  +L+  E +V  +  ++D+N+ ++ + M YM GGS    ++  LK +  L E    K + QIL  ++ LH   ++H DIK  NI+ D  GN K  D+G +K   RL+    S     S  GT Y+++PEVI G+ Y  K D+WS G  +VEM+T KPP  WA        +  + K   +P NPI     S++  + I     V    RP+ EEL++  F
Sbjct:  359 GKLLGQGAFGRVYLCYDVDTGRELAAKQVQFDPASPETSKEVSTLECEIQLLKNLHH-ERIVQYYGCLRDHNEKTLTIFMEYMPGGS----VKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASK---RLQTICMSSTGVRSVTGTPYWMSPEVISGDGYGRKADVWSLGCTVVEMLTEKPP--WAEYE----AMAAIFKIATQPTNPILPSHTSEQTRDFIRRIF-VEAKHRPSAEELLRHPF 615          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:NCBI gene;Acc:103026704])

HSP 1 Score: 119.783 bits (299), Expect = 1.817e-27
Identity = 87/276 (31.52%), Postives = 141/276 (51.09%), Query Frame = 1
Query: 1441 NFDLGKEIARGGFGIVFHCQEKISGKNVILKKL--------IDKKLTSFYRDIFISYHLNQAEHLVNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPINP-----ISKELNELINLCLTVNPDERPTGEELMKSEF 2229
            N+ LGK + +G FG VF C +  +G+ + +K++          K++++   +I +  +L   E +V  +  ++D ++ ++++ M YM GGS    I+  LK +  L E    K + QIL  +  LH   ++H DIK  NI+ D  GN K  D+G ++   RL+    S    +S  GT Y+++PEVI GE Y  K DIWS G  +VEM+T +PP  WA        +  + K   +P NP     +S    + +     V   +RP  EEL++  F
Sbjct:  358 NWRLGKLLGQGAFGRVFLCYDADTGRELAVKQVQFDPDSPETSKEVSALECEIQLLKNLFH-ERIVQYYGCLRDTHERTLSIFMEYMPGGS----IKDQLKSYGALTENVTRKYTRQILEGVCYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASR---RLQTICLSGTGIKSVTGTPYWMSPEVISGEGYGRKADIWSVGCTVVEMLTLRPP--WAEFE----AMAAIFKIATQPTNPALPAHVSDHCRDFLKRIF-VETKQRPAAEELLRHIF 618          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: map3k19 (mitogen-activated protein kinase kinase kinase 19 [Source:ZFIN;Acc:ZDB-GENE-081104-140])

HSP 1 Score: 113.235 bits (282), Expect = 3.432e-27
Identity = 80/272 (29.41%), Postives = 137/272 (50.37%), Query Frame = 1
Query: 1453 GKEIARGGFGIVFHCQEKISGKNVILKKLI---------DKKLTSFYRDIFISYHLNQAEHL-VNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPINP--ISKELNELINLCLTVNPDERPTGEELMKSEFF 2232
            G+ + RG +G V+ C     G+ + +K+++         +K+ +   R++ +   L   EH  + GF +     D  I++ M Y+ GGS++S     L ++  L EK     + Q+L  +  LHE +VIH D+K +N++    G  K ID+G A+ + RL     +    +S  GT Y++APEVI    +  K+D+WS G  + EM TGKPP   A +G+++       +    P  P   S+E    +  CL +N  +RP+  +L++  F 
Sbjct:   19 GEVLGRGAYGTVY-CGLTSQGQLIAVKQVLLDVSTSETAEKEYSRLEREVDL---LKNLEHPNIVGF-LGTALTDNVISIFMEYVPGGSISS----VLNRFGPLPEKVFALYTRQVLEGVAYLHENRVIHRDLKGNNLMLMPTGVVKLIDFGCARRLNRLTHSGGNSDLLKSVHGTPYWMAPEVINETGHGKKSDVWSIGCTVFEMATGKPPL--AHMGKMAALFYIGARKGLMPPLPDDFSEEAKSFVKACL-INQKQRPSAADLLRHPFI 278          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-120215-96])

HSP 1 Score: 119.398 bits (298), Expect = 5.909e-28
Identity = 84/276 (30.43%), Postives = 141/276 (51.09%), Query Frame = 1
Query: 1441 NFDLGKEIARGGFGIVFHCQEKISGKNVILKKL--------IDKKLTSFYRDIFISYHLNQAEHLVNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPINP-----ISKELNELINLCLTVNPDERPTGEELMKSEF 2229
            N+  GK + +G FG V+ C +  +G+ + +K++          K++ +   +I +  +L Q E +V  F  ++D    ++++ M YM GGS    I+  L+ +  L E    K + QIL  ++ LH   ++H DIK  NI+ D  GN K  D+G +K ++ +  +  + +   S  GT Y+++PEVI GE Y  K DIWS G  +VEM+T KPP  WA        +  + K   +P +P      S+   +L+     V    RP+ E+L++  F
Sbjct:  358 NWQRGKLLGQGAFGRVYLCYDADTGRELAVKQVQFDPGSVETSKEVNALECEIQLLKNL-QHERIVQYFGCLRDPQQKTLSIFMEYMPGGS----IKDQLRAYGALTENVTRKYTRQILEGVSFLHGNMIVHRDIKGANILRDSTGNVKLGDFGASKRLQTICSQGTAMR---SVTGTPYWMSPEVINGEGYGRKADIWSVGCTVVEMLTEKPP--WAEFE----AMAAIFKIATQPTDPRLPLHASEHARDLLRRIF-VEAKLRPSAEDLLRHPF 618          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: slka (STE20-like kinase a [Source:ZFIN;Acc:ZDB-GENE-050411-66])

HSP 1 Score: 104.375 bits (259), Expect = 7.230e-23
Identity = 80/270 (29.63%), Postives = 129/270 (47.78%), Query Frame = 1
Query: 1459 EIARGGFGIVFHCQEKISGKNVILKKLIDKKLTSFYRDIFISYH-LNQAEH-----LVNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGL-AKHVERLEGKAQSRKRKESSPGTIYYLAPEVI-----KGELYSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPINPISKELNELINLCLTVNPDERPTGEELMKSEFF 2232
            E+  G FG V+  Q K SG  +   K+I+ K      D  +    L   +H     L+N F     Y +  + + + +  GG++ + +   L+  + L E  I  +  Q+L  +N LH  ++IH D+K  NI+   EG+ K  D+G+ AK+   L+       R++S  GT Y++APEV+     K   Y YK DIWS G+ L+E+   +PP H     RV L++ K         +  S E  + +  CL  NP+ R    +L++  F 
Sbjct:   38 ELGDGAFGKVYKAQNKESG-VLAAAKVIETKSEEELEDYMVEIEILALCDHPNIVGLLNAF-----YYENKLWIFIEFCPGGAVDAIM---LELERGLAEPQIRVVCKQMLEALNYLHTHRIIHRDLKAGNILLTFEGDVKLADFGVSAKNTRTLQ-------RRDSFIGTPYWMAPEVVMCETMKDAPYDYKADIWSLGITLIELAQMEPPNHELNPMRVMLKIAKNDPPSLSFPSKWSAEFTDFLKKCLDKNPETRWNALQLLQHSFI 291          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: nek2 (NIMA-related kinase 2 [Source:ZFIN;Acc:ZDB-GENE-040426-752])

HSP 1 Score: 98.9821 bits (245), Expect = 5.758e-22
Identity = 64/219 (29.22%), Postives = 114/219 (52.05%), Query Frame = 1
Query: 1606 HLVNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECK-----VIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPIN-PISKELNELINLCLTVNPDERPTGEELMKSEFFKDCL 2244
            ++V  F+ + D ++ ++ + M Y   G L S I +C +  + L+E+ ++++  Q++  + E H        V+H D+KP N+  D   N K  D+GLA+ ++     A++        GT YY++PE      Y+ K+DIWS G +L E+    PPF      +++    K+K+ KF+ I    S ELNE+I+  L +    RP+ E++M+     + L
Sbjct:   35 NIVRYFDRIIDRSNTTLYIVMEYCECGDLASLISRCRRDRRFLEEEFVLRVLAQLVLALRECHRRTAGGRTVLHRDLKPANVFLDARHNVKLGDFGLARILQHDTSFAKT------FVGTPYYMSPEQFSRMSYNEKSDIWSLGCLLYELCALVPPFTAMNQKQLA---EKIKEGKFRRIPYRYSDELNEIISKMLNLKDYLRPSIEQIMQYGLLAEVL 244          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: map2k6 (mitogen-activated protein kinase kinase 6 [Source:NCBI gene;Acc:65239])

HSP 1 Score: 96.6709 bits (239), Expect = 1.096e-21
Identity = 72/267 (26.97%), Postives = 126/267 (47.19%), Query Frame = 1
Query: 1459 EIARGGFGIVFHCQEKISGKNVILKKLI----DKKLTSFYRDIFISYHLNQAEHLVNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELH-ECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGEL----YSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPINPISKELNELINLCLTVNPDERPTGEELMKSEFF 2232
            E+ RG +G+V   +   SG  + +K++      ++      D+ IS       + V  +  +  + +G + + M  M   SL  + ++ +++   + E  + KIS  I+  +  LH +  VIH D+KP N++ + +G+ K  D+G++ ++     K           G   Y+APE I  E+    Y+ K+DIWS G+ ++E+   K P+   G     L+    +     P    S E  +   LCL  NP+ERPT  ELM + FF
Sbjct:   71 ELGRGAYGVVERVRHTPSGTIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPYTVTFYGAL--FREGDVWICMELMDT-SLDKFYKKVIEKGLTIPEDILGKISVAIVKALEHLHSKLSVIHRDVKPSNVLINTQGHVKMCDFGISGYLVDSVAKTLDA-------GCKPYMAPERINPEINQKGYNVKSDIWSLGITMIELAILKFPYESWGTPFQQLKQVVEEPSPQLPPENFSPEFVDFSTLCLKKNPNERPTYAELMDNTFF 327          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: pak4 (p21 protein (Cdc42/Rac)-activated kinase 4 [Source:ZFIN;Acc:ZDB-GENE-040704-69])

HSP 1 Score: 98.2117 bits (243), Expect = 2.937e-21
Identity = 74/274 (27.01%), Postives = 127/274 (46.35%), Query Frame = 1
Query: 1435 LENFDLGKEIARGGFGIVFHCQEKISGKNVILKKLIDKKLTS---FYRDIFI--SYHLNQAEHLVNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPINPISKELNELINLCLTVNPDERPTGEELMKSEFFKDC 2241
            LENF    +I  G  G+V    ++ SG+ V +KK+  +K       + ++ I   YH      + N + +  +     + + M ++ GG+LT  +         + E+ I  +   +L  +  LH   VIH DIK D+I+   +G  K  D+G    V      ++   R++S  GT Y++APEVI    Y  + D+WS G++++EMV G+PP+      +    +      K K I   S  L   ++  L  +P  R T  EL++  F ++ 
Sbjct:  419 LENF---IKIGEGSTGVVCLAVDRRSGRQVAVKKMHLRKQQRRELLFNEVVIMREYHHENVVDMYNSYLVADE-----LWVVMEFLEGGALTDIVTHTR-----MNEEQIATVCVSVLRALAYLHGQGVIHRDIKSDSILLTADGRIKLSDFGFCAQV------SKEVTRRKSLVGTPYWMAPEVISRLPYGPEVDVWSLGIMVIEMVDGEPPYFNEPPLQAMRRIRDNVPPKMKNIQKASPLLRGFLDQMLVRDPALRATALELLQHPFLQNA 673          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: MKK2 (MAPKK involved in the protein kinase C signaling pathway; involved in control of cell integrity; upon activation by Bck1p phosphorylates downstream target, Slt2p; functionally redundant with Mkk1p; MKK2 has a paralog, MKK1, that arose from the whole genome duplication [Source:SGD;Acc:S000006061])

HSP 1 Score: 119.398 bits (298), Expect = 1.564e-28
Identity = 86/267 (32.21%), Postives = 138/267 (51.69%), Query Frame = 1
Query: 1462 IARGGFGIVFHCQEKISGKNVILKKLIDKKLT--SFYRDIFISYHLNQA---EHLVNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPF-------HWAGIGRVSLELTKMKKYKFKPINPI--SKELNELINLCLTVNPDERPTGEELMK 2220
            +  G  G V  C+ K +GK V   K I+   T   + + IF     N++   +++V  + +  D    SI +AM YM G SL +  +  LK+   + E+ I KI+  +L  ++ LHE KVIH DIKP NI+ + +G  K  D+G++   E +   A +        GT +Y+APE I+G+ YS   D+WS G+ L+E+  G+ PF       + A I  +++ LT   + K +P   I  SK     I+ CL  +  ERP+  +++K
Sbjct:  220 LGEGAGGSVAKCRLK-NGKKVFALKTINTMNTDPEYQKQIFRELQFNKSFKSDYIVQYYGMFTDEQSSSIYIAMEYMGGKSLEATYKNLLKRGGRISERVIGKIAESVLRGLSYLHERKVIHRDIKPQNILLNEKGEIKLCDFGVSG--EAVNSLAMTFT------GTSFYMAPERIQGQPYSVTCDVWSLGLTLLEVAGGRFPFESDKITQNVAPIELLTMILTFSPQLKDEPELDISWSKTFRSFIDYCLKKDARERPSPRQMLK 477          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: MKK1 (MAPKK involved in the protein kinase C signaling pathway; involved in control of cell integrity; upon activation by Bck1p phosphorylates downstream target, Slt2p; functionally redundant with Mkk2p; MKK1 has a paralog, MKK2, that arose from the whole genome duplication [Source:SGD;Acc:S000005757])

HSP 1 Score: 113.62 bits (283), Expect = 1.170e-26
Identity = 91/308 (29.55%), Postives = 150/308 (48.70%), Query Frame = 1
Query: 1372 DQMNDGDPFQGGGILFEKMK-RLENFDLGKEIARGGFGIVFHCQEKISGKNVILKKLIDKKLT--SFYRDIFISYHLN---QAEHLVNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPFH----WAGIGRVSLE---LTKMKKYKFKPINPI--SKELNELINLCLTVNPDERPTGEELMKSEFFKDCLHK 2250
            + + D D     G  +  +K R+E   +   +  G  G V  C+ K +G  +   K+I+   T   + + IF     N   Q+E++V  + +  D  + SI +AM YM G SL +  +  L++   + EK + KI+  +L  ++ LHE KVIH DIKP NI+ +  G  K  D+G++   E +   A +        GT +Y+APE I+G+ YS  +D+WS G+ ++E+  GK P       A I    L    LT   + K +P + I  S      I+ CL  +  ERP+  +++   + K  + K
Sbjct:  199 NSVRDVDQLDENGWKYANLKDRIETLGI---LGEGAGGSVSKCKLK-NGSKIFALKVINTLNTDPEYQKQIFRELQFNRSFQSEYIVRYYGMFTDDENSSIYIAMEYMGGRSLDAIYKNLLERGGRISEKVLGKIAEAVLRGLSYLHEKKVIHRDIKPQNILLNENGQVKLCDFGVSG--EAVNSLATTFT------GTSFYMAPERIQGQPYSVTSDVWSLGLTILEVANGKFPCSSEKMAANIAPFELLMWILTFTPELKDEPESNIIWSPSFKSFIDYCLKKDSRERPSPRQMINHPWIKGQMKK 494          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: KIC1 (Protein kinase of the PAK/Ste20 family, required for cell integrity; physically interacts with Cdc31p (centrin), which is a component of the spindle pole body; part of the RAM network that regulates cellular polarity and morphogenesis [Source:SGD;Acc:S000001144])

HSP 1 Score: 109.383 bits (272), Expect = 1.291e-24
Identity = 85/263 (32.32%), Postives = 134/263 (50.95%), Query Frame = 1
Query: 1462 IARGGFGIVFHCQEKISGKNVILKKL-IDK---KLTSFYRDIFISYHLNQAEHLVNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVI-KGELYSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPINPISKELNELINLCLTVNPDERPTGEELMKSEFFK 2235
            I RG FG+V+      +G+   +K L +D    ++    R+I     L Q  ++   +       D S+ + M + +GGSL S     L+  K + EK+I  I  ++L  +  +H+  VIH DIK  N++   EGN K  D+G+A  V       Q+  R+++  GT Y++APEVI +G  Y  K DIWS G+   E+ TG PP+      R    + K K  + +  +  S  L E I LCL  +P ER + ++L+KS+F +
Sbjct:   29 IGRGKFGVVYKGYNVKTGRVYAIKVLNLDSDSDEVEDVQREIQFLASLKQISNITRYYGSY--LKDTSLWIIMEHCAGGSLRS----LLRPGK-IDEKYIGVIMRELLVALKCIHKDNVIHRDIKAANVLITNEGNVKLCDFGVAAQVN------QTSLRRQTMAGTPYWMAPEVIMEGVYYDTKVDIWSLGITTYEIATGNPPYCDVEALRAMQLIIKSKPPRLEDRS-YSTSLKEFIALCLDEDPKERLSADDLLKSKFIR 277          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: STE20 (Cdc42p-activated signal transducing kinase; involved in pheromone response, pseudohyphal/invasive growth, vacuole inheritance, down-regulation of sterol uptake; GBB motif binds Ste4p; member of the PAK (p21-activated kinase) family [Source:SGD;Acc:S000000999])

HSP 1 Score: 108.227 bits (269), Expect = 2.326e-24
Identity = 63/197 (31.98%), Postives = 100/197 (50.76%), Query Frame = 1
Query: 1648 GSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPINPISKELNELINLCLTVNPDERPTGEELMKSEFFKD 2238
            G + + M YM GGSLT  +  C+     L E  I  +  + L+ +  LH   V+H DIK DNI+   EG+ K  D+G    +  L  K      + +  GT Y++APEV+  + Y  K DIWS G++++EM+ G+PP+      R    +      K K    +S  L + ++ CL V P++R +  EL+  E+  +
Sbjct:  688 GDLWVIMEYMEGGSLTDVVTHCI-----LTEGQIGAVCRETLSGLEFLHSKGVLHRDIKSDNILLSMEGDIKLTDFGFCAQINELNLK------RTTMVGTPYWMAPEVVSRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKEPENLSSSLKKFLDWCLCVEPEDRASATELLHDEYITE 873          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: SPS1 (Putative protein serine/threonine kinase; localizes to the nucleus and cytoplasm; required for efficient spore packaging, prospore membrane development and closure and localization of enzymes involved in spore wall synthesis; interacts with and required for Ssp1p phosphorylation and turnover; member of the GCKIII subfamily of STE20 kinases; multiply phosphorylated on S/T residues; interacts with 14-3-3 proteins, Bmh1p and Bmh2p; expressed at the end of meiosis [Source:SGD;Acc:S000002931])

HSP 1 Score: 104.76 bits (260), Expect = 6.772e-24
Identity = 76/265 (28.68%), Postives = 130/265 (49.06%), Query Frame = 1
Query: 1462 IARGGFGIVFHCQEKISGKNVILKKL----IDKKLTSFYRDIFISYHLNQAEHLVNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGEL--YSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPINPISKELNELINLCLTVNPDERPTGEELMKSEFFKD 2238
            I RG FG V+   ++++ + V +K +     D+ +    ++IF    L     L+  + I     D S+ + M Y  GGS +  +++       L E+ +  I +++   +  LHE + IH DIK  NI+ + EG  K  D+G++ H+       +S  ++++  GT Y++APEV+  E+  Y+ K DIWS G+   E++ G PP       +V   L K K  K +   P S    + +  CL   P +RP+   L+  EF K+
Sbjct:   24 IGRGNFGDVYKAVDRVTQEIVAIKVVNLEHSDEDIELLAQEIFFLAELKSP--LITNY-IATMLEDVSMWIVMEYCGGGSCSDLLKRSY--VNGLPEEKVSFIIHEVTLGLKYLHEQRKIHRDIKAANILLNEEGMVKLGDFGVSGHI-------RSTLKRDTFVGTPYWMAPEVVCCEVDGYNEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQ--GPFSDAAKDFVAGCLVKTPADRPSAYNLLSFEFVKN 274          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO41410 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4G7])

HSP 1 Score: 126.716 bits (317), Expect = 2.012e-32
Identity = 92/278 (33.09%), Postives = 140/278 (50.36%), Query Frame = 1
Query: 1435 LENFDLGKEIARGGFGIVFHCQEKISGKNVILKKLIDKKLTSFYRDIFISYHLNQAEHLVNGFE---IVQDY----NDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPINP--ISKELNELINLCLTVNPDERPTGEELMKSEFFKDC 2241
            + N+  GK +  G FG V+ C +  +G+ + +K++   +L S  ++   +  L      +  F    IVQ Y    +D  I + M Y+ GGS    I + +KQ   L E    K S QIL  I  LH  +++H DIK  NI+ D  GN K  D+G +K ++ +  K   R    S  GT Y++APEVI GE Y  K D+WS G  +VEM+T KPP  WA    ++  L K+     +P  P  +S +  E +   L +N   RP+ +EL++  F  + 
Sbjct:    1 MNNWRKGKLLGAGAFGQVYMCHDLDTGRELAVKQIETGQLNSSTKNEVKA--LEGEIEFMKAFRNERIVQYYGIETDDLHIYIFMEYLPGGS----IHEHIKQHGALNESLTRKYSRQILEGILYLHTNRIVHRDIKGANILRDLYGNVKLADFGASKRLQTIRSKTGFR----SVHGTPYWMAPEVINGEGYGRKADVWSVGCTVVEMLTTKPP--WADFEPMA-ALFKIATQPTEPELPSDLSVDAVEFVRSTLRMNSKSRPSADELLRFSFVTNS 265          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO35437 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLH0])

HSP 1 Score: 117.087 bits (292), Expect = 1.118e-28
Identity = 95/315 (30.16%), Postives = 141/315 (44.76%), Query Frame = 1
Query: 1309 EIARNCGASVEDFYCINISNHDQMNDGDPFQGGGILFEKMKR----LENFDLGKEIARGGFGIVFHCQEKISGKNVILKKLIDKKLT------SFYRDIFISYHL--NQAEHLVNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPFHWAG-------IGRVSLELTKMKKYKFKPINPISKELNELINLCLTVNPDER 2196
            +I  N   +    +  +I+ H + + G PF+    L E MK+    L +FD+GK + +G FG V+  +EK S   V LK L   +L          R+I I  HL  N    L   F     Y+D  + L + Y   G L   +  C K      EK   K   Q+   +   H  KVIH DIKP+N++ + +G+ K  D+G + H            R+ +  GT+ YL PE+I+G+ +  K D+WS G++  E + GKPPF   G       I RV L               +S    +LI+  L  NP+ R
Sbjct:    3 KIPSNTHQTTVSSFNPSITKHMKGSKGGPFK----LLENMKQGKWNLSDFDIGKPLGKGKFGNVYLAREKKSKYIVALKVLFKSQLQKSNVEHQLRREIEIQSHLRHNNILRLFGYF-----YDDTRVYLILEYAPRGELYKELTACEK----FDEKRAAKYIRQLADALAYCHSKKVIHRDIKPENLLLNYKGDIKIADFGWSVHA--------PSSRRTTLCGTLDYLPPEMIEGKEHDEKVDLWSIGVLCYEFLVGKPPFEAEGHNETYRRISRVDLRFPSH----------VSPGARDLISKLLQHNPNNR 286          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO37413 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFU9])

HSP 1 Score: 113.235 bits (282), Expect = 1.317e-27
Identity = 77/277 (27.80%), Postives = 144/277 (51.99%), Query Frame = 1
Query: 1432 RLENFDLGKEIARGGFGIVFHCQEKISGKNVILKKLIDKKLTSFYRDIFISYHLN-----QAEHLVNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECK----VIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPI-NPISKELNELINLCLTVNPDERPTGEELMKSEFF 2232
            RL +++  + I  G +GI    + K   K ++ K+L   +++   + + +S  +N     +  H+V  ++ + D  + +I + M +   G L + I++  ++ +   E  + K+ YQ++  + E H  K    V+H D+KP N+  D   N K  D+GLA+ +      A++        GT YY++PE +    Y+ K+DIWS G ++ E+    PPF    + ++ LE  K+K  +F PI +  S  L++LIN  L VN + RP+ +EL+++ + 
Sbjct:    5 RLHDYEELERIGSGSYGICKKIRRKKDNKVLVWKELDYGQMSETEKQMLVS-EVNLLRELKHPHIVRYYDRIIDRTNTTIYIVMEFCENGDLGALIKKHKREKRYTAEDLVWKLLYQLVLAVQECHRRKDGGHVLHRDLKPANVFLDANMNVKLGDFGLARVLSHDTSFAKT------FVGTPYYMSPEQVNKRSYNEKSDIWSLGCLMYELCALSPPF--TAMDQIRLE-AKIKVGRFHPIPSHYSSSLSQLINSMLQVNDEMRPSIDELLRNPYL 271          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO48741 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIM4])

HSP 1 Score: 115.546 bits (288), Expect = 3.276e-26
Identity = 87/277 (31.41%), Postives = 139/277 (50.18%), Query Frame = 1
Query: 1441 NFDLGKEIARGGFGIVFHCQEKISGKNVILKKLI---DKKLTSFYRDIFISYHLNQAEH--LVNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGL-AKHVERLEGKAQSRKRKESSPGTIYYLAPEVI-----KGELYSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPINPISKELNELINLCLTVNPDERPTGEELMKSEFFKD 2238
            N++L  E+  G FG V+  Q K        K +I   + +L  F  +I I   L++ +H  LV  FE     +DG + + + + SGG+L   +   L+  + L E  I  ++ Q+   +  LH  KVIH D+K  N++   +GN K  D+G+ AK+ + L+ ++       +  GT Y++APEV+     K + Y YK DIWS G+ L+E+    PP H     RV  ++ K     F   N  S +LN+ +  C+  NPD R +  E++K  F  D
Sbjct:   21 NWELVGELGDGSFGKVYKAQHKTESSLSAAKIIIVNDENELEDFMVEIDI---LSECKHKNLVGLFETF--LHDGKLWMMLEFCSGGALDDLM---LELERGLNEPEIRAVTRQLFEGLQFLHNHKVIHRDLKAGNLLLASDGNVKMADFGVSAKNKKTLQKRS-------TFIGTPYWMAPEVVVTETYKDDPYDYKADIWSAGITLIELAQMVPPNHNMHPMRVLFKIPKSDPPTFDNPNKWSNDLNDFLASCVVKNPDMRASATEMIKHPFIAD 282          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO34646 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNS0])

HSP 1 Score: 108.227 bits (269), Expect = 9.124e-26
Identity = 75/263 (28.52%), Postives = 128/263 (48.67%), Query Frame = 1
Query: 1435 LENFDLGKEIARGGFGIVFHCQEKISGKNVILKK-----LIDKKLTS-FYRDIFISYHLNQAEHLVNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPINP--ISKELNELINLCLTVNPDERP 2199
            L NF++ K+I RG F +V+  +   + + V LKK     ++D K      ++I +   LN    +      +++     +N+ +     G L+  I+   KQ + + E+ + K   Q+   +  +H  +V+H DIKP N+     G  K  D GL +        A S        GT YY++PE IK   Y++K+DIWS G +L EM   + PF+   +   SL   K+++  + P+     S++L  L++LC+   PD+RP
Sbjct:   18 LGNFEIEKKIGRGQFSVVYKARCTANNQIVALKKIQIFDMMDAKARQDCIKEIDLLKQLNHPNVIKYYASFIEN---NELNIVLELADAGDLSRMIKHFKKQKRLIPERTVWKYFVQLTAALEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLV------GTPYYMSPERIKENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSL-CKKIEQCDYPPLPAEHYSQQLRHLVSLCINPIPDQRP 270          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:101169290])

HSP 1 Score: 127.872 bits (320), Expect = 4.903e-30
Identity = 86/272 (31.62%), Postives = 143/272 (52.57%), Query Frame = 1
Query: 1453 GKEIARGGFGIVFHCQEKISGKNVILKKL--------IDKKLTSFYRDIFISYHLNQAEHLVNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPINPI-----SKELNELINLCLTVNPDERPTGEELMKSEF 2229
            GK + +G FG+V+ C +  +G+ +  K++          K++++   +I +  +L+  E +V  +  ++D+++ ++ + M YM GGS    ++  LK +  L E    K + QIL  ++ LH   ++H DIK  NI+ D  GN K  D+G +K   RL+    S     S  GT Y+++PEVI GE Y  K D+WS G  +VEM+T KPP  WA        +  + K   +P NP+     S +  + I+ C+ V    RP+ EEL++  F
Sbjct:  356 GKLLGQGAFGLVYLCYDVDTGRELAAKQVQFDPDSPETSKEVSALECEIQLLKNLHH-ERIVQYYGCLRDHSEKTLTIFMEYMPGGS----VKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASK---RLQTICMSGTGIRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPP--WAEYE----AMAAIFKIATQPTNPLLPSHTSDQARDFIH-CIFVEAKHRPSAEELLRHPF 612          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:NCBI gene;Acc:101160297])

HSP 1 Score: 116.316 bits (290), Expect = 3.214e-26
Identity = 84/276 (30.43%), Postives = 142/276 (51.45%), Query Frame = 1
Query: 1441 NFDLGKEIARGGFGIVFHCQEKISGKNVILKKL--------IDKKLTSFYRDIFISYHLNQAEHLVNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPINP-----ISKELNELINLCLTVNPDERPTGEELMKSEF 2229
            N+ LGK + +G FG V+ C +  +G+ + +K++          K++++   +I +  +L   E +V  +  ++D  + ++++ M +M GGS    I+  LK +  L E    + + QIL  ++ LH   ++H DIK  NI+ D  GN K  D+G ++   RL+    S    +S  GT Y+++PEVI GE Y  K DIWS G  +VEM+T +PP  WA        +  + K   +P NP     +S    E +     V   +RP+ +EL++  F
Sbjct:  388 NWRLGKLLGQGAFGRVYLCYDADTGRELAVKQVQFDPESPETSKEVSALECEIQLLKNLCH-ERIVQYYGCLRDTMERTLSIFMEHMPGGS----IKDQLKSYGALTENVTRRYTRQILEGVSYLHSNMIVHRDIKGANILRDSVGNVKLGDFGASR---RLQTICLSGTGIKSVTGTPYWMSPEVISGEGYGRKADIWSVGCTVVEMLTQRPP--WAEFE----AMAAIFKIATQPTNPELPVHVSDHCREFLRRIF-VETKQRPSADELLRHIF 648          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: nek7 (NIMA related kinase 7 [Source:NCBI gene;Acc:101170580])

HSP 1 Score: 110.923 bits (276), Expect = 3.582e-26
Identity = 80/292 (27.40%), Postives = 137/292 (46.92%), Query Frame = 1
Query: 1354 INISNHDQMNDGDPFQGGGILFEKM--KRLENFDLGKEIARGGFGIVFHCQEKISGKNVILKK-----LIDKKLTS-FYRDIFISYHLNQAEHLVNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPI--NPISKELNELINLCLTVNPDERP 2199
            +++    Q  +  PFQ    L   M    L NF + K+I +G F  V+  +  +    V LKK     L+D K      ++I +   LN    +      ++D     +N+ +     G L+  I     Q + + EK + K   Q+   +  +H  +V+H DIKP N+     G  K  D GL +        A S        GT YY++PE ++   Y++K+DIWS G +L EM   + PF+   +   SL  TK+++  + P+  +  S+EL +L+++C+  +P++RP
Sbjct:    3 MDMQPQGQQAETPPFQPQKPLQLDMDYSSLANFQIEKKIGKGQFSEVYRARYILDNTPVALKKIQIFNLMDAKARQDCIKEIDLLKQLNHPNVIKYHASFIED---NELNIVLELADAGDLSRMINHFKNQRRLIPEKAVWKYFVQVCRALEHMHSRRVMHRDIKPANVFVTATGVVKLGDLGLGRFFSSKTTAAHSLV------GTPYYMSPERLRENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSL-CTKIQQCDYPPLPSDHYSQELRDLVDMCINPDPEKRP 284          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: nek6 (NIMA related kinase 6 [Source:NCBI gene;Acc:101173323])

HSP 1 Score: 109.768 bits (273), Expect = 8.771e-26
Identity = 86/316 (27.22%), Postives = 144/316 (45.57%), Query Frame = 1
Query: 1279 DPQNIREAKLEIARNCGASVEDFYCINISNHDQMNDGDPFQGGGILFEKMKRLENFDLGKEIARGGFGIVFHCQEKISGKNVILKK-----LIDKKLTS-FYRDIFISYHLNQAEHLVNGFEIVQDY-NDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPINP--ISKELNELINLCLTVNPDERP 2199
            +PQN  +  +E          D  C  +   DQ N      G G        + NF + ++I RG F  V+     +  ++V LKK     ++D K      ++I +   LN      N  + +  +  D  +N+ +     G L+  I+   K+ + + E+ I K   Q+ + +  +H  +V+H DIKP N+     G  K  D GL +        A S        GT YY++PE I    Y++K+DIWS G +L EM   + PF+   +  +SL   K+++  + P+ P   S +L EL+++C+   PD+RP
Sbjct:    2 EPQNSHQTTVE--------NHDHLCEPVPPEDQKNPT----GCGFRCS----MANFRVERKIGRGQFSEVYRAVRLLDRQSVALKKVQIFEMMDAKARQDCIKEIDLLKQLNHP----NIIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKKRRLIPERTIWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGEVKLGDLGLGRFFSSKTTAAHSLV------GTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLLSL-CRKIEQCDYPPLPPDQYSDKLRELVSMCINSEPDQRP 290          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000044704.1 (serine/threonine-protein kinase 4 [Source:NCBI gene;Acc:101175466])

HSP 1 Score: 111.309 bits (277), Expect = 2.899e-25
Identity = 74/269 (27.51%), Postives = 131/269 (48.70%), Query Frame = 1
Query: 1438 ENFDLGKEIARGGFGIVFHCQEKISGKNVILKKL-IDKKLTSFYRDIFISYHLNQAEHLVNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPINPISKELNELINLCLTVNPDERPTGEELMKSEFFKDC 2241
            E FD+ +++  G +G VF    K +G+ V +K++ ++  L    ++I I    N + H+V  +     + +  + + M Y   GS++  I     + K L E+ I  + +  L  +  LH  + IH DIK  NI+ + EG AK  D+G+A  +        +  ++ +  GT +++APEVI+   Y+   DIWS G+  +EM  GKPP+      R    +       F+  +  S+   + ++ CL  NP+ R T  +L++  F K  
Sbjct:   31 EVFDVLEKLGEGSYGCVFKANYKETGEIVAIKQVPVESDLQEIIKEISIMQQCN-SPHVVRYYGSY--FKNSDLWIVMEYCGAGSVSDIIR---IRNKTLSEEEIATVVHSTLKGLEYLHFMRKIHRDIKAGNILLNAEGQAKLADFGVAGQL------TDTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRNPDLWSENFRDFVSQCLVKNPENRATATQLLQHPFIKSA 287          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000024489.1 (SMESG000024489.1)

HSP 1 Score: 878.626 bits (2269), Expect = 0.000e+0
Identity = 425/433 (98.15%), Postives = 428/433 (98.85%), Query Frame = 1
Query:  952 INEWRKIKSYFCLSLLNSSCKYFLVRSDHIENARISYNYIVINALDHFLTLLTEPDDSLKCSIKLLMNSFFLIFRSDSQLDDWMGSFNSFRSAVILTINGETHELKVQTDPQNIREAKLEIARNCGASVEDFYCINISNHDQMNDGDPFQGGGILFEKMKRLENFDLGKEIARGGFGIVFHCQEKISGKNVILKKLIDKKLTSFYRDIFISYHLNQAEHLVNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPINPISKELNELINLCLTVNPDERPTGEELMKSEFFKDCLHK 2250
            INEWRKIKSYFCLSLLNSSCKYFLVRSDHIENARISYN IVINALDHFLTLLTEPD+SLKCSIKLLMNSFFLIFRSDSQLDDWMGSFN FRSAVILTINGETHELKVQTDPQNIREAKLEIA NCG SVEDFYCINISNHDQMNDGDPFQGGGILFEKMKRLENFDLGKEIARGGFGIVFHCQEKISGKN+ILKKLIDKKLTSFYRDIFISYHLNQ+EHLVNGFEIVQDY DGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPINPISKELNELINLCLTVNPDERPTGEELMKSEFFKDCLHK
Sbjct:    8 INEWRKIKSYFCLSLLNSSCKYFLVRSDHIENARISYNDIVINALDHFLTLLTEPDNSLKCSIKLLMNSFFLIFRSDSQLDDWMGSFNCFRSAVILTINGETHELKVQTDPQNIREAKLEIALNCGESVEDFYCINISNHDQMNDGDPFQGGGILFEKMKRLENFDLGKEIARGGFGIVFHCQEKISGKNLILKKLIDKKLTSFYRDIFISYHLNQSEHLVNGFEIVQDYKDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPINPISKELNELINLCLTVNPDERPTGEELMKSEFFKDCLHK 440          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000071997.1 (SMESG000071997.1)

HSP 1 Score: 506.138 bits (1302), Expect = 1.745e-166
Identity = 301/718 (41.92%), Postives = 429/718 (59.75%), Query Frame = 1
Query:  115 MKIYVSSGSDYDGVLEIEVDEYSQGENIKYYLN*IRQEDKTWTKDYYRLIYKNIIINDHDFINKYKISDGDEIWHGKIENYLNSDDIIVEVFLAGWVPDWVWLIVKEHDSIKTIRSTLEIFQPKIIHIWNSKGDQMMDNQSVTEINREGYYQLIVRCADEREQNLTFANCCDQHD----RFR-SKFYFLRFGLYDDTQISSNVITSMQIKTKKIRQIMSTNNKIHAILDTNLSDFPYYYVNSKFLFCNHIYERIWEICEEYWELIEDPDNLSDINVCNALYVDEINEWRKIKSYFCLSLLN--SSCKYFLVRSDHIENARISYNYIVINALDHFLTLLTEPDDSLKCSIKLLMNSFFLIFRSDSQLDDWMGSFNSFRSAVILTINGETHELKVQTDPQNIREAKLEIARNCGASVEDFYCINISNHDQMNDGDPFQGGGILFEKMKRLENFDLGKEIARGGFGIVFHCQEKISGKNVILKKLIDKKLTSFYRDIFISYHLNQAEHLVNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPINPISKELNELINLCLTVNPDERPTGEELMKSEFFKDCLH 2247
            MKI+V +G +      IE++  +    IK     +R  ++     ++ +   N ++ND+D +++Y +SD DEIWHG +EN++  DD+IVE+FL+GW P   WL+VK + S+  IR+ L   +P II+I+N  G  M DNQ VT+I+R+GYY+LI+ C      NL F  C   +     RF+ SK + L +  +    I       +  +  +IR+IMS+N+ I   L+ NLSDF  +++ SK LF   I  R+ EIC  YW LI+              Y  E+  W  +  YF LSLLN  S C   +V      +A  S+  I+I+ALD+F+  L+E  + LK S KL  + F LI  + S+ DD      S  S+  +   G  H+L + ++P+ I EAK  IA     S +D Y I+  NHD+ ++ D F  G I+ E M+ +E+F+  +E  RG FG V   QE+ISG   I+KKL D K  S YRD FI   L+Q+ +L+   E+++  +  S +LAMPYM GG+L+ +I +     +C  E+ I KISYQIL QIN+LH+ ++IH DIKPDNIV D  GN K ID+GL+++  RL  +  S K     PGTI Y+APE+I+   YS K DIWSFGMVLVEMVT KPPFHWA  GR+++EL KM+K+KFKPI PIS+ L++ IN CLTV+P ERP+GE L+ S++  D LH
Sbjct:    1 MKIFVVNGENGGEKTAIEIEGLTFVSEIK-----LRLPEECRVNYFWLINSNNFLLNDNDHLSRYNLSDNDEIWHGSLENFIKKDDVIVEIFLSGWTPFISWLVVKVNQSMSEIRAALVRIEPDIINIFNGDGQLMEDNQLVTDIDRDGYYRLIISCGRGANMNLAFDECYKFYKLHILRFKYSKSHLLYYAQFYSEGIQEQTRYQLIYQMIRIREIMSSNDVIDTRLNKNLSDF-LFFIKSKLLFQQDISARLLEICYSYWFLIK------------YFYTSEV--WAVVGLYFRLSLLNVLSECSNSVVNLG--VSADKSFGGIIIDALDNFVLFLSEFGEILKSSAKLWTDLFSLITLAGSEFDDQFDDSYSKESSCTVKSGGRNHQLVIFSNPRTIAEAKEAIAVANKTSEQDLYVIDGQNHDEPSERDRFSQG-IIIEMMRGMEHFEFLQEKGRGAFGTVDLYQERISGNKFIIKKLNDVK-CSLYRDAFIGAKLSQS-NLLRYSEVIKGQH--SAHLAMPYMPGGTLSKHIYKG----ECQNEEDIFKISYQILAQINKLHKLEIIHRDIKPDNIVLDEGGNPKLIDFGLSRYTARLTNEDLSDKLAAYFPGTINYMAPELIRVRPYSNKIDIWSFGMVLVEMVTRKPPFHWAADGRITIELKKMQKFKFKPIMPISEGLHQFINSCLTVDPSERPSGEHLIGSQWIIDNLH 687          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000024532.1 (SMESG000024532.1)

HSP 1 Score: 498.434 bits (1282), Expect = 1.248e-163
Identity = 308/709 (43.44%), Postives = 424/709 (59.80%), Query Frame = 1
Query:  115 MKIYVSSGSDYDGVLEIEVDEYSQGENIKYYLN*IRQEDKTWTKDYYRLIYKNIIINDHDFINKYKISDGDEIWHGKIENYLNSDDIIVEVFLAGWVPDWVWLIVKEHDSIKTIRSTLEIFQPKIIHIWNSKGDQMMDNQSVTEINREGYYQLIVRCADEREQNLTFANCCDQHDRFRSKFYF-LRFGLYDDTQISS-NVITSMQIKTKKIRQIMSTNNKIHAILDTNLSDFPYYYVNSKFLFCNHIYERIWEICEEYWELIEDPDNLSDINVCNALYVDEINEWRKIKSYFCLSLLNSSCKYFLVRSDHIENARISYNYIVINALDHFLTLLTEPDDSLKCSIKLLMNSFFLIFRSDSQLDDWMGSFNS--FRSAVILTINGETHELKVQTDPQNIREAKLEIARNCGASVEDFYCINISNHDQMNDGDPFQGGGILFEKMKRLENFDLGKEIARGGFGIVFHCQEKISGKNVILKKLIDKKLTSFYRDIFISYHLNQAEHLVNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPINPISKELNELINLCLTVNPDERPTGEELMKSEF 2229
            MKI V +G +      IE+D++S   +IK+ ++ I      W K++ R IYKNII++D ++I +YK+ + DEIW GKIENYL SDD+I+EVFLAG  P  +WLIVK + SI  IRS +EI Q K+I+I++  G +M + Q V++I+  GYY+LIV   DER + L+F +C  QHD F  +F     F   D T+I++ N+I        KIR IMS N+ I A L  NLS+ P   VNSK LF  +I  RI +IC+E+W+  +D     + N+              IKS F LS+L +  +Y   R    EN   S+N IVI+ALD+ +  L +    LK   KL  + F L+ R  S+  +    ++S      +I   +     L +      + +AK EIA+  G S++D YCIN  NHD+  +   ++ G  +FE +K +EN +LGKE   GGFG VF  Q+ ISGK + +K     K +S YRDIFIS  +     L     + +      + +AMPYM+GGSLTSYI+      K L EK  ++ISYQIL QI +LHE K+IH DIKPDNIVFDG GNAK ID+GL+K ++    +    K K  +PGTI Y+APE+++   YSYK DIWSFGMVLVEMVTG PPFH     R  +EL KM +YKFKP   IS EL++ I  CL VNP+ERP+ ++L+ S+F
Sbjct:    1 MKISVVNGENLSVKFVIEIDKHSYVGDIKHKIDKILNGQGKWEKEHLRFIYKNIILHD-EYIKRYKVCESDEIWFGKIENYLRSDDVIIEVFLAGCSPVLIWLIVKINHSITVIRSMIEIVQSKLINIYDWNGREMQNVQIVSDIDPIGYYRLIVSYEDERGKWLSFEDCVRQHDEFTFRFCLNSEFEFEDMTEINTVNLIN-------KIRTIMSLNDVIDARLKENLSNIPSGVVNSKLLFYYNIQLRILDICQEFWKSTKDSPYYINYNI--------------IKS-FELSILVALHQYSHSRQKDPENKDKSFNGIVIDALDYLVKHLHDHCKDLKYHQKLFFDHFLLVPRPVSEYIELRNEYSSQLITKIIINKKDNIAPFLTLLLTQGTVLDAKCEIAQKLGVSIKDLYCINHWNHDKAEEDKIYKEGFYMFEIIKSMENMNLGKEFGAGGFGRVFFYQDIISGKQLAMKTANSDK-SSLYRDIFISALIMNNSELFKYSGLFK--YKSELYIAMPYMTGGSLTSYIQGK----KGLFEKEALRISYQILIQIEKLHELKIIHRDIKPDNIVFDGAGNAKLIDFGLSKWMKNSTDENILEKLKAYAPGTINYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPARAIIELKKMVEYKFKPSVLISIELHQFIKSCLIVNPNERPSAQQLIGSQF 679          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000024565.1 (SMESG000024565.1)

HSP 1 Score: 490.73 bits (1262), Expect = 2.305e-160
Identity = 300/735 (40.82%), Postives = 435/735 (59.18%), Query Frame = 1
Query:  115 MKIYVSSGSDYDGVLEIEVDEYSQGENIKYYLN*IRQEDKTWTKDYYRLIYKNIIINDHDFINKYKISDGDEIWHGKIENYLNSDDIIVEVFLAGWVPDWVWLIVKEHDSIKTIRSTLEIFQPKIIHIWNSKGDQMMDNQSVTEINREGYYQLIVRCADEREQNLTFANCCDQHDRFRSKFYF---LRFG-LYD---DTQISSNVITSMQIKTKKIRQIMSTNNKIHAILDTNLSDFPYYYVNSKFLFCNHIYERIWEICEEYWELIEDPDNLSDINVCNALYVDEINEWRKIKSYFCLSLLNSSCKYFLVRSDHIENARISYNYIVINALDHFLTLLTEPD------DSLKCSIKLL-----------MNSFFLIFRSDSQLDDWMGSFNSFRSAVILTINGETHELKVQTDPQNIREAKLEIARNCGASVEDFYCINISNHDQMNDGDPFQGGGILFEKMKRLENFDLGKEIARGGFGIVFHCQEKISGKNVILKKLIDKKLTSFYRDIFISYHLNQAEHLVNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPINPISKELNELINLCLTVNPDERPTGEELMKSEFFKDCLH 2247
            MKI+V    + +  +EI+++EYS   NI+  L+ I      W K + +L++KNII++D   I  YK+ +GDEI   +IENYL SDD+I+EVFL+G+VP+ ++LIV+ + SI  I+S +E  Q +II+I +  G++M  +Q+VTE +   YY+LIV+   +     TF +C  Q+ +FR   Y+   LR   LY+   +T+I+  VI  M     +I+ IM +N+     L  NLS+FP  ++    +FC+ I  RIW+IC++YW+L  +              V E +EW  I  +F ++LL    +Y     +H E A  ++N IV++AL + +TLL +        ++   S  L+           M+ F    R  S+ D+    + +   A +   NG   E    +DPQ I EAK  +A+ CG  V D Y I   N D+  DG+P+    + F  M  +ENFD  KE A G FG VF CQ+KIS + ++LKK  + +  S +RDIFI Y L  +  L     IV+D +  SI LAMPY+SGGSLTS I+Q     KC+ E   +KISYQILTQI+ELH  +++H DIKPDNI+ DG GNAK ID+GL+K +E +  +    K K  +PGT+ Y+APE+++   YSYK DIWSFGMVLVEMVTG PPFH     RV +EL KM +Y+FKP   IS E N+ I  CLTV+P+ERP+ ++L++S+F  D L+
Sbjct:    1 MKIFVIRVENPEIKIEIKLEEYSLVRNIRNKLDKIFPGRVKWNKHFIKLVHKNIIMDDEKSIGWYKLCEGDEILCVRIENYLCSDDVILEVFLSGFVPEVIYLIVQRNYSISKIKSMIERIQCEIINICDFTGNKMTGSQTVTETSSCAYYRLIVKYGRKETCISTFEDCLKQYHKFRIIHYYDFILRLRHLYECLFETRINE-VIKQMN----EIKAIMLSNDPFEIRLKENLSEFPSAFIKCHSIFCDDISSRIWDICDDYWQLSRN--------------VIENDEWIVIGLFFRMALLIVLHQYLEHERNHCEIATKTFNSIVVDALGYSVTLLIKIRQMESFCETAGYSFDLIGELMEDICVKWMDPFLSTSRYYSEFDEVFNRYYNKTFASLKFGNGSV-EFHFHSDPQTIIEAKEAMAQKCGVKVNDLYAIYQRNEDKPTDGEPYDETILDFVLMINMENFDFLKEFATGAFGKVFICQDKISSQELVLKKSTEMEF-SLHRDIFIGYRLKNSSKLFQYSRIVKDMD--SIQLAMPYLSGGSLTSKIQQ----QKCIHENEKIKISYQILTQIHELHRLQIVHRDIKPDNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPPRVVIELKKMVEYEFKPNLLISIEFNQFIKWCLTVDPNERPSAQQLIESQFIIDYLN 708          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000024843.1 (SMESG000024843.1)

HSP 1 Score: 451.44 bits (1160), Expect = 4.582e-147
Identity = 251/584 (42.98%), Postives = 366/584 (62.67%), Query Frame = 1
Query:  496 IWNSKGDQMMDNQSVTEINREGYYQLIVRCADEREQNLTFANCCDQHDRFRSKFYFLRFGLYDDTQISSNVITSMQIKTKKIRQIMSTNNKIHAILDTNLSDFPYYYVNSKFLFCNHIYERIWEICEEYWELIEDPDNLSDINVCNALYVDEINEWRKIKSYFCLSLLNSSCKYFLVRSDHIENARISYNYIVINALDHFLTLLTEPDDSLKCSIKLLMNSFFLIFRSDSQLDDWMGSFNSFRSAVILTINGETHELKVQTDPQNIREAKLEIARNCGASVEDFYCINISNHDQMNDGDPFQGGGILFEKMKRLENFDLGKEIARGGFGIVFHCQEKISGKNVILKKLIDKKLTSFYRDIFISYHLNQAEHLVNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLKQWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCIDYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSFGMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPINPISKELNELINLCLTVNPDERPTGEELMKSEFFKDCLH 2247
            +W+ KG++M +NQSVT+I+  GYY+LIV C  E + NLTF  CC+QHDR +   Y+     ++  + S      +  + KKIRQI+S+N+ I   L+ NLS FP  +V   +LF + I +RIW+IC EY +L++       +  C        +EW  +K +F  +LL +  KY     +  +N + S+N I+++ALD  +  L  P +  K + K  +NSFFLI +SD  +D+    F+   S +I+ I  E +E+ V+ +P+ I EA   +A       +D Y IN    D+ NDGDP+      FE M ++ +F+   E+A GGFG VF C++KISGK V++KKLID K  S +R+I I   L   E L+   E+++D  + +I+L MPY+ GG+LTS I+Q     KCL E  +++IS+QILTQI+ELH+ K+IHCDIKP+NIVFD E N K ID+GLAK++     K  SRKRK SSPGTI Y+APE+ K +  S K DIWSFGMV+VEMVTG+ PF+  G G++ L L K+ KY+FKP+  IS +L + I+ CLTV+P+ RPT ++L++S+   + L 
Sbjct:    1 MWDCKGNEMQNNQSVTDIDAFGYYRLIVNCGQEADDNLTFDECCNQHDRCKIILYYYSENWWEFEKFSEIARVKIINQIKKIRQIISSNDTIDPRLNENLSHFPKAFVKQNYLFGHDITKRIWDICNEYRKLMKSYP--FSVQFCLN------DEWHAMKLFFLTALLVTMRKYSDAVQNDPKNTKKSFNDILVDALDCLVRHLMNPCEDWKHAAKRWLNSFFLITQSDGDMDELFVKFDP--SMIIVRIKSEEYEMDVELNPKTILEATKAVANKFRIDRQDLYSINHWIPDKPNDGDPYFQPMTFFELMSKMADFENLNELANGGFGKVFICEDKISGKQVVMKKLIDVK-DSLHREILIGSILFDKE-LIKYSEVIRD--EKNIHLTMPYLPGGTLTSNIQQL----KCLGENEVIRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMMEISNDLKQFISWCLTVDPNVRPTAQQLIESQLINNYLQ 566          
The following BLAST results are available for this feature:
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MAP3K38.320e-2831.29mitogen-activated protein kinase kinase kinase 3 [... [more]
MAP3K39.196e-2831.29mitogen-activated protein kinase kinase kinase 3 [... [more]
MAP3K31.102e-2731.29mitogen-activated protein kinase kinase kinase 3 [... [more]
MAP3K31.401e-2731.29mitogen-activated protein kinase kinase kinase 3 [... [more]
MAP3K31.401e-2731.29mitogen-activated protein kinase kinase kinase 3 [... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pak-24.491e-2630.66Serine/threonine-protein kinase pak-2 [Source:Uni... [more]
pak-24.823e-2630.37Serine/threonine-protein kinase pak-2 [Source:Uni... [more]
max-21.265e-2527.88Serine/threonine-protein kinase max-2 [Source:Uni... [more]
max-21.760e-2527.74Serine/threonine-protein kinase max-2 [Source:Uni... [more]
max-25.225e-2427.74Serine/threonine-protein kinase max-2 [Source:Uni... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pak31.560e-2828.31gene:FBgn0044826 transcript:FBtr0330047[more]
Pak31.643e-2828.31gene:FBgn0044826 transcript:FBtr0083312[more]
Pak31.643e-2828.31gene:FBgn0044826 transcript:FBtr0305003[more]
Nek22.283e-2426.76gene:FBgn0029970 transcript:FBtr0071142[more]
mbt4.280e-2428.06gene:FBgn0025743 transcript:FBtr0074285[more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k32.645e-3031.99mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k33.567e-3031.99mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k34.591e-3031.99mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k21.110e-2731.16mitogen-activated protein kinase kinase kinase 2 [... [more]
map3k21.440e-2731.16mitogen-activated protein kinase kinase kinase 2 [... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
samd84.473e-2830.80sterile alpha motif domain containing 8 [Source:Xe... [more]
samd85.175e-2830.80sterile alpha motif domain containing 8 [Source:Xe... [more]
MAP3K21.039e-2731.88mitogen-activated protein kinase kinase kinase 2 [... [more]
MAP3K21.234e-2731.88mitogen-activated protein kinase kinase kinase 2 [... [more]
dennd1a1.681e-2630.07DENN domain containing 1A [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Map3k34.527e-2731.29mitogen-activated protein kinase kinase kinase 3 [... [more]
Nek73.618e-2629.28NIMA (never in mitosis gene a)-related expressed k... [more]
Nek73.618e-2629.28NIMA (never in mitosis gene a)-related expressed k... [more]
Map3k26.615e-2631.52mitogen-activated protein kinase kinase kinase 2 [... [more]
Myo3a3.724e-2527.89myosin IIIA [Source:MGI Symbol;Acc:MGI:2183924][more]
back to top
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q10407|MKH1_SCHPO1.978e-2831.44MAP kinase kinase kinase mkh1 OS=Schizosaccharomyc... [more]
sp|Q99759|M3K3_HUMAN3.995e-2731.29Mitogen-activated protein kinase kinase kinase 3 O... [more]
sp|Q9S7U9|M2K2_ARATH8.506e-2729.82Mitogen-activated protein kinase kinase 2 OS=Arabi... [more]
sp|P32491|MKK2_YEAST1.086e-2632.21MAP kinase kinase MKK2/SSP33 OS=Saccharomyces cere... [more]
sp|Q61084|M3K3_MOUSE3.167e-2631.29Mitogen-activated protein kinase kinase kinase 3 O... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1R2CRM44.221e-3333.09Protein kinase domain-containing protein OS=Stento... [more]
A0A085ML901.532e-3132.42Protein kinase domain-containing protein OS=Trichu... [more]
A0A085NMY21.634e-3132.66Protein kinase domain-containing protein OS=Trichu... [more]
A0A1R2CWZ92.485e-3131.37Protein kinase domain-containing protein OS=Stento... [more]
S9UAZ35.178e-3131.60Protein kinase OS=Angomonas deanei OX=59799 GN=AGD... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k33.634e-2931.62mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k33.634e-2931.62mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k33.634e-2931.62mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k21.817e-2731.52mitogen-activated protein kinase kinase kinase 2 [... [more]
map3k193.432e-2729.41mitogen-activated protein kinase kinase kinase 19 ... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k25.909e-2830.43mitogen-activated protein kinase kinase kinase 2 [... [more]
slka7.230e-2329.63STE20-like kinase a [Source:ZFIN;Acc:ZDB-GENE-0504... [more]
nek25.758e-2229.22NIMA-related kinase 2 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
map2k61.096e-2126.97mitogen-activated protein kinase kinase 6 [Source:... [more]
pak42.937e-2127.01p21 protein (Cdc42/Rac)-activated kinase 4 [Source... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
MKK21.564e-2832.21MAPKK involved in the protein kinase C signaling p... [more]
MKK11.170e-2629.55MAPKK involved in the protein kinase C signaling p... [more]
KIC11.291e-2432.32Protein kinase of the PAK/Ste20 family, required f... [more]
STE202.326e-2431.98Cdc42p-activated signal transducing kinase; involv... [more]
SPS16.772e-2428.68Putative protein serine/threonine kinase; localize... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO414102.012e-3233.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354371.118e-2830.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO374131.317e-2727.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487413.276e-2631.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO346469.124e-2628.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k34.903e-3031.62mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k23.214e-2630.43mitogen-activated protein kinase kinase kinase 2 [... [more]
nek73.582e-2627.40NIMA related kinase 7 [Source:NCBI gene;Acc:101170... [more]
nek68.771e-2627.22NIMA related kinase 6 [Source:NCBI gene;Acc:101173... [more]
ENSORLT00000044704.12.899e-2527.51serine/threonine-protein kinase 4 [Source:NCBI gen... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000024489.10.000e+098.15SMESG000024489.1[more]
SMESG000071997.11.745e-16641.92SMESG000071997.1[more]
SMESG000024532.11.248e-16343.44SMESG000024532.1[more]
SMESG000024565.12.305e-16040.82SMESG000024565.1[more]
SMESG000024843.14.582e-14742.98SMESG000024843.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032093 ID=SMED30032093|Name=Protein kinase domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3118bp
AACAAGCTTTCATTAATAATATTTATGAAATATAATTATTCATATAATAT
ATAAATAGATTTGGACATAAATATTGTTTGTATATTTATTTATTGAAGCA
TTACAAATTGAGGAATGAAAATATACGTATCAAGTGGGTCGGATTACGAC
GGGGTACTCGAGATTGAGGTTGATGAATATTCACAAGGGGAAAATATTAA
ATATTACTTGAATTAAATTCGCCAGGAAGATAAAACGTGGACAAAGGATT
ATTACCGATTAATCTATAAAAATATTATTATAAATGATCATGATTTCATC
AACAAATATAAAATATCAGACGGAGATGAAATTTGGCATGGGAAAATTGA
GAATTATTTGAACAGTGATGACATAATTGTGGAGGTGTTCCTGGCTGGGT
GGGTACCTGATTGGGTCTGGCTGATAGTCAAGGAGCATGATTCTATTAAA
ACAATCAGATCAACATTAGAAATCTTTCAACCAAAAATCATCCATATATG
GAATAGCAAAGGGGATCAAATGATGGACAACCAATCAGTTACAGAAATCA
ATAGGGAGGGCTATTATCAATTGATTGTGAGATGTGCTGATGAAAGGGAG
CAAAATTTGACATTTGCCAATTGCTGCGATCAGCATGATCGATTCAGATC
AAAATTTTACTTTTTACGATTTGGTCTATACGATGATACACAAATCTCGT
CAAACGTCATCACATCTATGCAAATTAAAACTAAGAAAATCAGACAAATA
ATGTCGACAAATAATAAAATTCATGCCATTTTGGATACAAATTTGTCAGA
TTTCCCTTATTATTATGTCAATTCCAAATTTCTATTTTGCAATCACATCT
ATGAACGCATCTGGGAGATTTGTGAAGAATATTGGGAACTGATCGAGGAT
CCTGATAATTTGAGTGATATTAATGTTTGTAATGCACTATATGTTGATGA
GATCAACGAGTGGAGGAAAATAAAATCATATTTCTGTTTATCTTTATTGA
ATTCTTCGTGCAAATATTTTCTTGTCAGATCGGATCATATAGAAAATGCA
CGCATTTCATATAATTATATTGTGATCAACGCTCTGGATCATTTTCTGAC
ACTCTTAACCGAGCCTGACGACAGTTTGAAATGTTCAATAAAACTATTGA
TGAATTCATTCTTTTTAATATTTCGTTCGGATTCTCAGCTCGATGATTGG
ATGGGTAGCTTTAACAGTTTTCGGTCGGCAGTCATATTAACGATAAATGG
AGAAACACACGAATTGAAGGTTCAAACAGATCCGCAAAATATTAGAGAAG
CAAAACTTGAGATAGCCCGCAATTGTGGAGCAAGCGTGGAGGATTTTTAT
TGTATAAATATTTCTAATCACGATCAAATGAATGACGGTGATCCATTTCA
AGGCGGGGGAATATTATTTGAAAAAATGAAAAGATTAGAAAATTTTGATC
TAGGAAAAGAAATAGCAAGAGGGGGATTTGGCATAGTTTTTCATTGTCAA
GAAAAAATATCTGGAAAAAATGTAATATTAAAAAAGTTAATTGACAAGAA
ATTGACAAGTTTTTACCGGGATATTTTCATCAGCTATCATTTGAATCAAG
CAGAGCATCTAGTGAATGGTTTTGAAATAGTGCAAGATTATAACGATGGT
AGCATCAATCTGGCCATGCCCTACATGTCAGGAGGCTCACTAACGTCATA
CATCGAGCAATGCCTCAAGCAATGGAAATGTCTACAGGAAAAGCATATTG
TTAAGATTTCCTATCAAATACTCACCCAAATAAATGAGTTACATGAATGC
AAAGTTATCCATTGCGATATCAAACCGGACAATATAGTTTTTGATGGTGA
AGGGAACGCAAAATGTATTGATTACGGACTAGCTAAACACGTGGAAAGGT
TGGAAGGGAAAGCTCAGTCTAGGAAACGTAAGGAATCTTCTCCGGGAACC
ATTTACTACTTGGCACCTGAGGTGATTAAAGGTGAACTATATTCATACAA
AACCGATATTTGGTCATTTGGAATGGTGCTGGTTGAGATGGTTACCGGGA
AACCTCCATTTCACTGGGCGGGAATCGGACGGGTGTCACTGGAACTTACA
AAGATGAAGAAATATAAATTCAAACCAATCAATCCAATTTCTAAAGAATT
GAACGAACTTATCAACTTGTGCTTGACTGTGAATCCAGACGAGAGGCCAA
CGGGTGAAGAATTGATGAAATCTGAATTTTTTAAAGATTGTTTACACAAA
TAACACTTCATCATAACTTTACTTTACAGTATCATTTTCATCCCTCTATG
AGACACTGCCAGCCTTGCACAAAGTTCAAATGGAATCATTGAGAAATTGG
AATTAATTAAATGTTGATATCTAAATATGATCTTGCATCAATATGGCAAC
AATGCTAAATTCTTGTTCTATAATTATTTTCTTTCATTTCTTTATCATTA
CTCCGATTGAAGCCATTCTGGATCTGACTCCCGGTGCATTCAAAAGAATG
CGATTACAGTATTAGACTCAGTGAAACTTAGTGTTCACATGTTTTTACTT
GATTTTCTAGTATGGTTTCACGACGCTTCAATCAGCTGCATGTTTTGACG
CGTGAAACTTATAGAGTCTCGCAAAGATGGCTTTCACGGGCTGTTTATGG
CGATCTACCAACAACTGACTAGGTCTTCTTCAGAACTAAAATGCTATTTA
CTGTTTAAATTATTATATTTCTTGCCTTCTAACTACGTTCATATGCGTGA
GTTTCATGATCAGATGAACATAATCAAAAGCGACTTGATGTGTTTATATA
AGCCAAAGGATAGTGGTGTTTTAAGTTTAGACTAGGAAAATAAGTTTAAA
GGAAATAAACTACAGGGTGAAGAGATAGGAATATCTGAAAAGAAGAAATA
TGATCAAGAAAAGCAGATATTTAGAAAAAATAGGAAAGAAACTTTATCTC
AAATTTGTGCAGAGAATCCTGATATAGAGTAAATTGAAGATCCAAAAGAA
AGCTTGCCGATCAACAATTGAAGAAGTGTCTGCGATTGAGCAGAAAATTA
TCTAAATAAGGATCAAGATTGGTGCAACAAACCATATAAGAACTAGTCAA
TACTTTTTACAAATTGTG
back to top

protein sequence of SMED30032093-orf-1

>SMED30032093-orf-1 ID=SMED30032093-orf-1|Name=SMED30032093-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=578bp
MMDNQSVTEINREGYYQLIVRCADEREQNLTFANCCDQHDRFRSKFYFLR
FGLYDDTQISSNVITSMQIKTKKIRQIMSTNNKIHAILDTNLSDFPYYYV
NSKFLFCNHIYERIWEICEEYWELIEDPDNLSDINVCNALYVDEINEWRK
IKSYFCLSLLNSSCKYFLVRSDHIENARISYNYIVINALDHFLTLLTEPD
DSLKCSIKLLMNSFFLIFRSDSQLDDWMGSFNSFRSAVILTINGETHELK
VQTDPQNIREAKLEIARNCGASVEDFYCINISNHDQMNDGDPFQGGGILF
EKMKRLENFDLGKEIARGGFGIVFHCQEKISGKNVILKKLIDKKLTSFYR
DIFISYHLNQAEHLVNGFEIVQDYNDGSINLAMPYMSGGSLTSYIEQCLK
QWKCLQEKHIVKISYQILTQINELHECKVIHCDIKPDNIVFDGEGNAKCI
DYGLAKHVERLEGKAQSRKRKESSPGTIYYLAPEVIKGELYSYKTDIWSF
GMVLVEMVTGKPPFHWAGIGRVSLELTKMKKYKFKPINPISKELNELINL
CLTVNPDERPTGEELMKSEFFKDCLHK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0002056medial muscle cell
PLANA:0003001lateral region of the whole animal
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0007049cell cycle
GO:0016310phosphorylation
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0016301kinase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 243..505
e-value: 5.3E-63
score: 225.3
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 245..505
e-value: 2.5E-51
score: 174.6
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 243..505
score: 41.658
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 233..508
e-value: 3.7E-64
score: 218.4
NoneNo IPR availablePANTHERPTHR45832FAMILY NOT NAMEDcoord: 186..506
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 363..375
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 234..507