Spondin-1

Overview
NameSpondin-1
Smed IDSMED30032088
Uniprot Best hitSpondin-1 OS=Rattus norvegicus OX=10116 GN=Spon1 PE=1 SV=1 (E=3.13201e-16)
Length (bp)1776
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

Don't be a BOT, type this for download: zb9Rds20

 

back to top

Expression Details

Spondin-1 ( spondin1-like ) is expressed during Stage 2, Stage 3 and Stage 4 in the blastomere, primitive ectoderm cell and primitive ectoderm

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm
Anatomical Expression

PAGE et. al., 2020




SMED30032088

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
PLANA TermReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
primitive ectodermSMED30032088 SMED30032088smed_20140614PMID:28072387whole organismStage 2colorimetric in situ hybridization evidence
primitive ectodermSMED30032088 SMED30032088smed_20140614PMID:28072387whole organismStage 4colorimetric in situ hybridization evidence
primitive ectodermSMED30032088 SMED30032088smed_20140614PMID:28072387whole organismStage 3colorimetric in situ hybridization evidence
Homology
BLAST of Spondin-1 vs. Ensembl Human
Match: SPON1 (spondin 1 [Source:HGNC Symbol;Acc:HGNC:11252])

HSP 1 Score: 85.1149 bits (209), Expect = 1.571e-16
Identity = 66/249 (26.51%), Postives = 104/249 (41.77%), Query Frame = 1
Query:   82 SGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKSNPF-TPD----TPVAEITLTRVEPQKDTQCVKTP------VKGVNEFQNAQKESRSNTLGRNGA---------------------------------VEKYNVLDDPQLAQMAKAFCGFSEWTSWSPCSVKCGEGETSRTRNLIKNLKNELCIQLPRKEQKNC 696
            S   SV+RT +L S ++MMGPSPDW  G+S  DLC   C W   +   L P DAG  +G TY+  N   + + + IR +  +    +PF  P+    T VA + + R+  +K  QC   P      V  +   +  + ++    +  N +                                  + +     P  +    + C  SEW +WSPCS+ CG G  SR R + +  ++     LP +E + C
Sbjct:  302 SAEFSVDRTRHLMSFLTMMGPSPDWNVGLSAEDLCTKECGWVQKVVQDLIPWDAGTDSGVTYESPNKPTIPQ-EKIRPLTSLDHPQSPFYDPEGGSITQVARVVIERIA-RKGEQCNIVPDNVDDIVADLAPEEKDEDDTPETCIYSNWSPWSACSSSTCDKGKRMRQRMLKAQLDLSVPCPDTQDFQPCMGPGCSDEDGSTCTMSEWITWSPCSISCGMGMRSRERYVKQFPEDGSVCTLPTEETEKC 548          

HSP 2 Score: 53.9138 bits (128), Expect = 7.039e-7
Identity = 23/54 (42.59%), Postives = 34/54 (62.96%), Query Frame = 1
Query: 1414 VDCQVSEWSLWRPCSKSCGWGTQYKKRVIQKDSLNGGLPCPVLYESRKCFSKPC 1575
            +DC+++EWS W  C+KSCG G   + R+IQ +   GG PCP   + +KC  + C
Sbjct:  667 IDCELTEWSQWSECNKSCGKGHVIRTRMIQMEPQFGGAPCPETVQRKKCRIRKC 720          
BLAST of Spondin-1 vs. Ensembl Human
Match: SPON2 (spondin 2 [Source:HGNC Symbol;Acc:HGNC:11253])

HSP 1 Score: 77.411 bits (189), Expect = 7.885e-15
Identity = 61/199 (30.65%), Postives = 85/199 (42.71%), Query Frame = 1
Query:   76 ERSGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKSNPFTPDT-----------PVAEITLTRVEPQKDTQCVKTPVKGVNEFQNAQKESRSNTLGRNGAVEKYNVLDDPQLAQMAKAFCGFSEWTSWSPCSVKCGE-GETSRTRNL 636
            + S  + V R H+L S +  + PSPDW  GV  +DLC DG +W+    + LYP DAG  +G T+   N   + + DT+ EI      S+P  P             P+A +TL R+           PV            SR N +  + +V +   LD           C  S W+SW  C   CG  G  SRTR +
Sbjct:  135 QTSAELEVQRRHSLVSFVVRIVPSPDWFVGVDSLDLC-DGDRWREQAALDLYPYDAGTDSGFTFSSPNFATIPQ-DTVTEIT----SSSPSHPANSFYYPRLKALPPIARVTLVRLRQSPRAFIPPAPV----------LPSRDNEIVDSASVPE-TPLD-----------CEVSLWSSWGLCGGHCGRLGTKSRTRYV 305          
BLAST of Spondin-1 vs. Ensembl Human
Match: SPON2 (spondin 2 [Source:HGNC Symbol;Acc:HGNC:11253])

HSP 1 Score: 77.411 bits (189), Expect = 7.885e-15
Identity = 61/199 (30.65%), Postives = 85/199 (42.71%), Query Frame = 1
Query:   76 ERSGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKSNPFTPDT-----------PVAEITLTRVEPQKDTQCVKTPVKGVNEFQNAQKESRSNTLGRNGAVEKYNVLDDPQLAQMAKAFCGFSEWTSWSPCSVKCGE-GETSRTRNL 636
            + S  + V R H+L S +  + PSPDW  GV  +DLC DG +W+    + LYP DAG  +G T+   N   + + DT+ EI      S+P  P             P+A +TL R+           PV            SR N +  + +V +   LD           C  S W+SW  C   CG  G  SRTR +
Sbjct:  135 QTSAELEVQRRHSLVSFVVRIVPSPDWFVGVDSLDLC-DGDRWREQAALDLYPYDAGTDSGFTFSSPNFATIPQ-DTVTEIT----SSSPSHPANSFYYPRLKALPPIARVTLVRLRQSPRAFIPPAPV----------LPSRDNEIVDSASVPE-TPLD-----------CEVSLWSSWGLCGGHCGRLGTKSRTRYV 305          
BLAST of Spondin-1 vs. Ensembl Human
Match: SPON2 (spondin 2 [Source:HGNC Symbol;Acc:HGNC:11253])

HSP 1 Score: 77.411 bits (189), Expect = 7.885e-15
Identity = 61/199 (30.65%), Postives = 85/199 (42.71%), Query Frame = 1
Query:   76 ERSGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKSNPFTPDT-----------PVAEITLTRVEPQKDTQCVKTPVKGVNEFQNAQKESRSNTLGRNGAVEKYNVLDDPQLAQMAKAFCGFSEWTSWSPCSVKCGE-GETSRTRNL 636
            + S  + V R H+L S +  + PSPDW  GV  +DLC DG +W+    + LYP DAG  +G T+   N   + + DT+ EI      S+P  P             P+A +TL R+           PV            SR N +  + +V +   LD           C  S W+SW  C   CG  G  SRTR +
Sbjct:  135 QTSAELEVQRRHSLVSFVVRIVPSPDWFVGVDSLDLC-DGDRWREQAALDLYPYDAGTDSGFTFSSPNFATIPQ-DTVTEIT----SSSPSHPANSFYYPRLKALPPIARVTLVRLRQSPRAFIPPAPV----------LPSRDNEIVDSASVPE-TPLD-----------CEVSLWSSWGLCGGHCGRLGTKSRTRYV 305          
BLAST of Spondin-1 vs. Ensembl Human
Match: TFPI (tissue factor pathway inhibitor [Source:HGNC Symbol;Acc:HGNC:11760])

HSP 1 Score: 53.5286 bits (127), Expect = 4.619e-7
Identity = 37/140 (26.43%), Postives = 67/140 (47.86%), Query Frame = 1
Query:  979 TRFFYHIKTGKCEPFKYYDCKKGNLNNFPTIDSCENVCSKVIQELPKIRRSNLALLQARTSYSAEESLSQKAKNIPEFCFHEVDSSKTCMKSKPKTI-------WYYSHRNRKCQSLVDYDCKGTLNKFSTFDDCMKTCR 1377
            TR+FY+ +T +CE FKY  C  GN+NNF T++ C+N+C    ++ P   + +    Q     +   SL+ ++  +P     E      C+    + +       +YY+    KC+      C G  N F++  +C++ C+
Sbjct:  139 TRYFYNNQTKQCERFKYGGC-LGNMNNFETLEECKNIC----EDGPNGFQVDNYGTQLN---AVNNSLTPQSTKVPS--LFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACK 268          

HSP 2 Score: 51.2174 bits (121), Expect = 2.749e-6
Identity = 36/131 (27.48%), Postives = 64/131 (48.85%), Query Frame = 1
Query:  982 RFFYHIKTGKCEPFKYYDCKKGNLNNFPTIDSCENVCSKVIQELPKIRRSNLALLQARTSYSAEESLSQKAKNIPEFCFHEVDSSKTCMKSKPKTIWYYSHRNRKCQSLVDYDCKGTLNKFSTFDDCMKTC 1374
            RFF++I T +CE F Y  C+ GN N F +++ C+ +C++      +I ++ L                Q+ K  P+FCF E D     +     T ++Y+++ ++C+      C G +N F T ++C   C
Sbjct:   69 RFFFNIFTRQCEEFIYGGCE-GNQNRFESLEECKKMCTR--DNANRIIKTTL----------------QQEK--PDFCFLEEDPG---ICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNIC 175          
BLAST of Spondin-1 vs. Ensembl Celegans
Match: spon-1 (SPONdin (Extracellular matrix glycoprotein) family [Source:UniProtKB/TrEMBL;Acc:Q19305])

HSP 1 Score: 108.227 bits (269), Expect = 2.486e-24
Identity = 115/399 (28.82%), Postives = 169/399 (42.36%), Query Frame = 1
Query:   79 RSGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETY-KPNNVTRLDEPDTIREINKIWMKSNPFTP------DT-PVAEITLTRVEPQKDTQC-----VKTPVKGV-NEFQNAQKESR--------------SNTLGRNGAVEKYNVLDDPQLAQM----------------------AKAF---CGFSEWTSWSPCSVKCGEGETSRTRNLI--KNLKNELCIQLPRKEQKNCAGARL-ECDLXXXXXXXXXXXXXXX--XASCTTEGKMIRIRKFARSKEKDECMKNVKPEIILQQVKTCKLD--KTDFRCDPISICSAGKLA-PCINGKPKTRFFYHIKTGKCEPFKYYDCKKGNLNNFPTIDSCENVC 1092
            +S FV VN+ H+  S+ +M GPSPDWC G+S ++LC+  C W    T  L P DAG  +G TY  PN  T   EP     I+ I  K NP +P      DT P     + R +    ++C     +K     + N  ++ + + R              S T G+ G   +  V   P  AQ+                      ++AF   C  S W SW  CSV+CG G  SR R  +       +  + L RK+   C G    +C+++        +       SASC  EG  +R R F  S+ +  CM      + LQ+  TC +   +     +   IC   K A  C    P  R++Y+ +  +CE F +  C KGN N F T + C+ +C
Sbjct:  292 KSQFV-VNKYHHFVSLATMFGPSPDWCVGLSSVNLCLPDCTWAEERTFELQPFDAGTDSGPTYMSPNEPTEPREP-----IHWITTKLNPLSPFYNSKSDTIPTLAKVILRRKNVTSSECKSDDILKAEAHNITNTSEDEEYKDRRECMMTQWEPWSLCSATCGK-GIRIRSRVYVFPIKAQVFHCHRQTTEKQFCNAKINECENSEAFSSKCQVSSWGSWGECSVQCGHGMRSRNRTFLNPATKSGDCSVDLERKDI--CVGENGDDCNVTPDPLCKTTAWSDWSPCSASC-DEGVRVRTRLFFYSEHEKRCM-----HVNLQEKDTCVMQSCRRFIEINSEEICQEDKQAGQCAGNFP--RYWYNHEKTQCERFIFTGC-KGNRNQFETEEECKQIC 672          

HSP 2 Score: 65.855 bits (159), Expect = 6.222e-11
Identity = 50/190 (26.32%), Postives = 84/190 (44.21%), Query Frame = 1
Query: 1090 CSKVIQELPKIRRSNLALLQARTSYSAEESLSQKAKNIPEFC--FHEVDSSKTCMKSKPKTI-------WYYSHRNRKCQSLVDYDCKGTLNKFSTFDDCMKTCRPDSQ-----------LESLK-------LDKVDCQVSEWSLWRPCSKSCGWGTQYKKRVIQKDSLNGGLPCP-VLYESRKCFSKPC 1575
            CS    E  ++R + L             +L +K   + + C  F E++S + C + K           ++Y+H   +C+  +   CKG  N+F T ++C + C P  +           LE           ++VDC+VS+W+ W  CS SCG G + + R + K + NGG  C   L +  +C  +PC
Sbjct:  570 CSASCDEGVRVR-TRLFFYSEHEKRCMHVNLQEKDTCVMQSCRRFIEINSEEICQEDKQAGQCAGNFPRYWYNHEKTQCERFIFTGCKGNRNQFETEEECKQICLPGYEKSKSLIPNNQLLEDFGNTEVDDGGERVDCEVSKWTAWGSCSVSCGRGKKSRSRHVVKLARNGGHQCSEHLMQELQCRLRPC 758          
BLAST of Spondin-1 vs. Ensembl Celegans
Match: E01G6.1 (pep chromosome:WBcel235:X:12260881:12266537:1 gene:WBGene00008449.1 transcript:E01G6.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:E01G6.1)

HSP 1 Score: 66.6254 bits (161), Expect = 4.243e-11
Identity = 48/157 (30.57%), Postives = 69/157 (43.95%), Query Frame = 1
Query:  937 SAGKLAPCIN-GKPKTRFFYHIKTGKCEPFKYYDCKKGNLNNFPTIDSCENVC----SKVIQELPKIRRSNLALLQAR------TSYSAEESLSQKAKNIPEFCFHEVDSSKTCMKSKPKTIWYYSHRNRKCQSLVDYDCKGTLNKFSTFDDCMKTC 1374
            SAG   PC   G    RF+++  T KC+PF YY C  GN NNF T+D C+N C          L  ++  N  L +          Y   +S S    +    C   +     C  S  +++W+Y    +KC   V   C GT N+F+T   C ++C
Sbjct:  443 SAG--TPCFGRGLTIQRFYFNPSTQKCQPFHYYGCS-GNGNNFETVDQCQNFCLHSADSACDGLVPLKNPNSELQRCSEEDPCPAGYECNDS-SYCCPSSENACNANMSRGNGCKGSTQRSMWFYDKSKKKCSQFVYNGCGGTPNRFTTKVACTESC 595          
BLAST of Spondin-1 vs. Ensembl Celegans
Match: K10D3.4 (pep chromosome:WBcel235:I:7134738:7139973:-1 gene:WBGene00010738.1 transcript:K10D3.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:K10D3.4)

HSP 1 Score: 58.9214 bits (141), Expect = 8.067e-9
Identity = 43/155 (27.74%), Postives = 61/155 (39.35%), Query Frame = 1
Query:  967 GKPKTRFFYHIKTGKCEPFKYYDCKKGNLNNFPTIDSCENVCSKVIQELPKIRRSNLALLQARTSYSAEESLSQKAKNIPEFCFHEVDSSKTC----------MKSKPK-----TIWYYSHRNRKCQSLVDYDCKGTLNKFSTFDDCMKTCRPDS 1386
            G    R++++ KTG CE F Y  C+ GN NNF T   C++ C     E   I+ + L             S +        +C+++  +   C           KS        T WYY    R CQ+     C G  N F+T  DC   CR +S
Sbjct:  421 GTYSNRWWFNAKTGNCEEFIYSGCQ-GNANNFETYKECQDYCRDARSEPQCIQGTALTDSNGNFIICGGSSAASTTCPANHYCYYDGTTYGCCPTQAYTCSLSYKSGASCGPAVTRWYYDSTTRTCQTYSFNGCDGNSNNFATQQDCKDYCRVES 574          
BLAST of Spondin-1 vs. Ensembl Celegans
Match: mlt-11 (pep chromosome:WBcel235:V:20667209:20678513:1 gene:WBGene00012186.1 transcript:W01F3.3c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mlt-11)

HSP 1 Score: 52.7582 bits (125), Expect = 7.845e-7
Identity = 42/143 (29.37%), Postives = 62/143 (43.36%), Query Frame = 1
Query:  958 CINGKPKTRFFYHIKTGKCEPFKYYDCKKGNLNNFPTIDSCENVC--SKVIQELPKIRRSNLALLQARTSYSAEESLSQKAKNIPEFCFHEVDSSKTCMKSKPKTIWYYSHRNRKCQSLVDYDCKGTLNKFSTFDDCMKTCRP 1380
            C N  P  R+F++ +TG+CE F Y  C  GN NNF   ++CE  C    VI          LA +  R S+  ++S S K  N+                      WY++ +N +C+  V     G  N+F T  +C + C P
Sbjct: 2057 CTNYTP--RWFFNSQTGQCEQFAYGSCG-GNENNFFDRNTCERKCMPHHVI----------LAQVPDRCSFD-KDSGSGKGYNV---------------------KWYFNMKNLRCEQFVFEGLGGNTNQFETLSECERICTP 2164          
BLAST of Spondin-1 vs. Ensembl Celegans
Match: mlt-11 (pep chromosome:WBcel235:V:20667211:20678513:1 gene:WBGene00012186.1 transcript:W01F3.3b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mlt-11)

HSP 1 Score: 52.7582 bits (125), Expect = 8.210e-7
Identity = 42/143 (29.37%), Postives = 62/143 (43.36%), Query Frame = 1
Query:  958 CINGKPKTRFFYHIKTGKCEPFKYYDCKKGNLNNFPTIDSCENVC--SKVIQELPKIRRSNLALLQARTSYSAEESLSQKAKNIPEFCFHEVDSSKTCMKSKPKTIWYYSHRNRKCQSLVDYDCKGTLNKFSTFDDCMKTCRP 1380
            C N  P  R+F++ +TG+CE F Y  C  GN NNF   ++CE  C    VI          LA +  R S+  ++S S K  N+                      WY++ +N +C+  V     G  N+F T  +C + C P
Sbjct: 2186 CTNYTP--RWFFNSQTGQCEQFAYGSCG-GNENNFFDRNTCERKCMPHHVI----------LAQVPDRCSFD-KDSGSGKGYNV---------------------KWYFNMKNLRCEQFVFEGLGGNTNQFETLSECERICTP 2293          
BLAST of Spondin-1 vs. Ensembl Fly
Match: fat-spondin (gene:FBgn0026721 transcript:FBtr0086975)

HSP 1 Score: 93.9745 bits (232), Expect = 1.004e-19
Identity = 73/228 (32.02%), Postives = 111/228 (48.68%), Query Frame = 1
Query:   67 LNEERSGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETY-KPNNVTRLDEPDTIREINKIWMKS------NPFTPD-TPVAEITLTRVEPQKDTQCVKTPVKGVNEFQNAQKESRSNTLGRNGAVEKYNVLDDPQLAQMAKAFCGFSEWTSWSPCSVKCGEGETSRTRNLIKNL---KNELCIQLPRKEQKNCAGARLEC 717
            +N+  S    V+R H   S++SM GPSPDW  G+SG+DLC + C WK ++   L+P DAG  +G +Y  PN+ T+   P+ +  I  ++ +       NP + + TP+A++ L R E      C        +EF  A +                 V DD +  Q  +A C   ++++WSPCSV CG+G   R+R  +      +N+   QL  KE   C  A  EC
Sbjct:  281 VNQNTSSKFRVDRKHPKVSLVSMFGPSPDWVVGISGLDLCTEDCSWKESMDFDLFPWDAGTDSGISYMSPNSETQ--PPERMYRITTMYPEDPRAPFYNPKSREMTPLAKLYLRR-EKIVSRNCD-------DEFLQALQ---------------LEVSDDAE-EQDTRAECRVGDYSAWSPCSVSCGKGIRMRSRQYLYPAAADQNKCARQLVAKEM--CVAAIPEC 480          

HSP 2 Score: 69.3218 bits (168), Expect = 5.243e-12
Identity = 38/104 (36.54%), Postives = 54/104 (51.92%), Query Frame = 1
Query: 1270 WYYSHRNRKCQSLVDYDCKGTLNKFSTFDDCMKTCRPDSQLESLKLDKV-DCQVSEWSLWRPCSKSCGWGTQYKKRVIQKDSLNGGLPCP-VLYESRKCFSKPC 1575
            + Y  +N+ C S     C+G  N F T +DC+ TC       S ++D+   C +S+WS+W PCS SCG G    +R +  +  NGG PC   L +SR C    C
Sbjct:  660 YAYDPQNQHCYSFTYGGCRGNRNNFLTENDCLNTCNVLRSPYSSRVDQPRACVLSDWSVWSPCSVSCGVGVSESRRYVVTEPQNGGQPCSKRLVKSRSCAMPAC 763          

HSP 3 Score: 51.9878 bits (123), Expect = 1.297e-6
Identity = 62/225 (27.56%), Postives = 89/225 (39.56%), Query Frame = 1
Query:  454 AQKESRSNTLGRNGAVEKYNVLDDPQLAQMAKAFCGFSEWTSWSPCSVKCGEGETSRTRNLIKNLKNELCIQLPRKEQKNCAGARLEC-----DLXXXXXXXXXXXXXXXXASCTTEGKMIRIR--KFARSKEKDECMKNVKPEIILQQVKTCKLDKTDFRCD---PISIC-SAGKLAPCINGKPKTRFFYHIKTGKCEPFKYYDCKKGNLNNFPTIDSCENVCS 1095
            AQ + R +  G N A  +  V  + + A      C  S W+ WS CS  CG G T RTR  + +L  + C  +   E+  C   R +C     +L          S     +S    G  IR R        +K+ C + ++    L Q K C ++  D   +      IC  A    PC       R+ Y  +   C  F Y  C +GN NNF T + C N C+
Sbjct:  485 AQSKDRDDDEGENLANSQSLVGSNGEGA----GLCKTSPWSVWSECSASCGIGITMRTRTFVNHLGRKRCPHITIVEKNKC--MRPDCTYEQVELPDPQCPTSQWSDWSPCSSTCGRGVTIRTRLLLLENGPDKESCTQRME----LHQQKEC-VNPIDCHINAEQAKDICVQAPDPGPCRGT--YMRYAYDPQNQHCYSFTYGGC-RGNRNNFLTENDCLNTCN 695          
BLAST of Spondin-1 vs. Ensembl Fly
Match: CG30046 (gene:FBgn0050046 transcript:FBtr0087895)

HSP 1 Score: 93.5893 bits (231), Expect = 1.543e-19
Identity = 75/266 (28.20%), Postives = 112/266 (42.11%), Query Frame = 1
Query:   91 VSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKS--NPF-----TPDTPVAEITLTRV--------------EPQKDTQCVKTP-----------------------------VKGVNEFQNAQKESRSNTLGRNGAV---EKYNVLD-DP-----QLAQMAKAFCGFSEWTSWSPCSVKCGEGETSRTRNLIKNLKNELCIQLPR---KEQKNCAG 702
            V V+  H++ S  S + PSPDW  GV+G++LC+  C W     I LYP D G  +G TY  ++  ++  PD IR +   +     +PF     TP  P+A +T+ R               +P    +C   P                             V   NE Q  ++E +    G+N  +   E++  L+ DP     Q +Q  +A C  S W SWSPCSV CG+G   R R  +       C  + R   +E + C+G
Sbjct:  294 VRVDPIHHMVSFASKIEPSPDWIVGVTGLELCLRNCTWMEEKVINLYPWDVGTDSGPTYTSSDQPQV-PPDVIRRMRSDFPNDPRSPFYDISGTPMKPMAILTVKRQRIYERRCADEDSNNDPDVPRECFTHPWSSWSDCSSKCGVGMQYRRRVYKQPELARVYNCNEAQYEERECQGEMCGQNNLMREPEEFEDLEPDPRRIGYQPSQQRRAECELSSWGSWSPCSVTCGDGYEMRQRQYLNPQAEFDCQGVHRMELQETRKCSG 558          
BLAST of Spondin-1 vs. Ensembl Fly
Match: CG30046 (gene:FBgn0050046 transcript:FBtr0339627)

HSP 1 Score: 93.5893 bits (231), Expect = 1.543e-19
Identity = 75/266 (28.20%), Postives = 112/266 (42.11%), Query Frame = 1
Query:   91 VSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKS--NPF-----TPDTPVAEITLTRV--------------EPQKDTQCVKTP-----------------------------VKGVNEFQNAQKESRSNTLGRNGAV---EKYNVLD-DP-----QLAQMAKAFCGFSEWTSWSPCSVKCGEGETSRTRNLIKNLKNELCIQLPR---KEQKNCAG 702
            V V+  H++ S  S + PSPDW  GV+G++LC+  C W     I LYP D G  +G TY  ++  ++  PD IR +   +     +PF     TP  P+A +T+ R               +P    +C   P                             V   NE Q  ++E +    G+N  +   E++  L+ DP     Q +Q  +A C  S W SWSPCSV CG+G   R R  +       C  + R   +E + C+G
Sbjct:  294 VRVDPIHHMVSFASKIEPSPDWIVGVTGLELCLRNCTWMEEKVINLYPWDVGTDSGPTYTSSDQPQV-PPDVIRRMRSDFPNDPRSPFYDISGTPMKPMAILTVKRQRIYERRCADEDSNNDPDVPRECFTHPWSSWSDCSSKCGVGMQYRRRVYKQPELARVYNCNEAQYEERECQGEMCGQNNLMREPEEFEDLEPDPRRIGYQPSQQRRAECELSSWGSWSPCSVTCGDGYEMRQRQYLNPQAEFDCQGVHRMELQETRKCSG 558          
BLAST of Spondin-1 vs. Ensembl Fly
Match: CG17739 (gene:FBgn0033710 transcript:FBtr0087893)

HSP 1 Score: 91.2781 bits (225), Expect = 9.681e-19
Identity = 67/235 (28.51%), Postives = 103/235 (43.83%), Query Frame = 1
Query:   97 VNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKSN-PFTPDTPVAEITLTRVEP-------------------------------------QKDTQCVKTPVKGVNEFQNAQKESRS----------NTLGRN--GAVEKYNVLDDPQLAQMAKAF----CGFSEWTSWSPCSVKCGEGETSRTRNLI 639
            V+  H+L S++SM+ PSPDW  GVSG++LC+  C W  N    LYP DAG  +G +Y   +  ++  PD +R I     KSN P  P +P  + T  +++P                                     +  T+C       + EF+N    SR           N +G    G  E+     +P++A    +     CG S+W+ WS C+V CG GE +R+R+ +
Sbjct:  286 VDSNHHLISLVSMVDPSPDWIVGVSGLELCLPNCSWVENKVHNLYPWDAGTDSGPSYMSADQPQV-PPDVVRRI-----KSNFPNDPRSPFYDPTGAQMKPLATLHINRRRLYEKNCESSDSEQVPPECATNSWSRWDECTTKCGPGKQYRIREFKNPALASRHRCNNALREEKNCVGHKCAGFNEETAEGGEPEVAPSPGSSDDPQCGLSDWSEWSSCTVTCGTGEMTRSRHYL 514          

HSP 2 Score: 67.0106 bits (162), Expect = 3.229e-11
Identity = 40/127 (31.50%), Postives = 62/127 (48.82%), Query Frame = 1
Query: 1201 IPEFCFHEVDSSKTCMKSKPKTIWYYSHRNRKCQSLVDYDCKGTLNKFSTFDDCMKTCRPDSQLESLKLD---KVDCQVSEWSLWRPCSKSCGWGTQYKKRVIQKDSLNGGLPCP-VLYESRKCFSK 1569
            +P FC+ E+  S  C  +     WYY H + +C       C    NKF + ++C +TCR     + L+ D    +DC VS+W +   C+ SCG G Q + R + +    GG PCP  L    +C+ +
Sbjct:  658 VPGFCYDELTDSP-CRDNDVANFWYYDHVSDQCAIYWSDRCDTNRNKFKSKEECEETCRLPRHKQELQHDGIPAIDCLVSDW-VSHSCNASCGDGFQLRTRRVLRTPKYGGKPCPKHLVRLDRCYQR 782          
BLAST of Spondin-1 vs. Ensembl Fly
Match: CG30203 (gene:FBgn0050203 transcript:FBtr0273303)

HSP 1 Score: 81.6481 bits (200), Expect = 9.548e-16
Identity = 61/254 (24.02%), Postives = 107/254 (42.13%), Query Frame = 1
Query:  109 HNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKSN--PFTPDT-----PVAEITLTRVEPQKDTQCVKTPVKGVNE-------------------FQNAQKESRSNTLGRNGAVEK--------------------------YNVLDDPQLAQMAKAFCGFSEWTSWSPCSVKCGEGETSRTRNLIKNLKNELCI---QLPRKEQKNCAGA 705
            H+  S+ + + PSPDW  GV+G++LC+  C W     + LYP D G  +G +Y  ++  ++  PD +R I   +   +  PF  DT     P+A + LTR +     +C + P +G  E                   + + Q+  ++  L  N   ++                            + + P    MA+  C  + W  WSPC+  CG G ++RTR+       + C+   ++P +E + C G+
Sbjct:  290 HHQISLAAKIDPSPDWILGVAGLELCLSNCTWLERKVLNLYPWDIGTDSGPSYMSSDEPQV-PPDVVRRITSSYPSDHRSPFYDDTGAPMKPLATLYLTRKK-LYIRECEEVPQEGPLECAVHPWNEWTNCSTRCGQGYSHRQRSFKNPNLAANFNCDRRLEEFRQCQGTQCGAAEEELEGEEPGLGMENPPSSGSMAE--CQLTNWGEWSPCTKTCGRGSSTRTRDYYNPQARQRCLSVMRIPLEETRECIGS 539          
BLAST of Spondin-1 vs. Ensembl Zebrafish
Match: spon1b (spondin 1b [Source:ZFIN;Acc:ZDB-GENE-000427-10])

HSP 1 Score: 94.3597 bits (233), Expect = 1.177e-19
Identity = 72/251 (28.69%), Postives = 103/251 (41.04%), Query Frame = 1
Query:   82 SGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKSNPF-----TPDTPVAEITLTRVEPQKDTQCVKTP---VKGVNEFQNAQKESRSNTL---------------------GRNGAVEKYNVLDDPQL----------------AQMAKAFCGFSEWTSWSPCSVKCGEGETSRTRNLIKNLKNELCIQLPRKEQKNCA 699
            S   SV+R  +L S ++M+GPSPDW  G+SG DLC   C W   L   L P DAG  +G +Y+  N   + + + IR +  +    +PF      P TP+  + + R+  +K  QC   P      V +    +KE   NT                      GR           DP L                ++   + C  SEW SWSPCS  CG G  SR R + +  ++     LP +E + C 
Sbjct:  297 SAEFSVDRVRHLMSFLTMLGPSPDWNVGLSGEDLCTRDCGWVQKLVKDLVPWDAGTDSGVSYESPNKPSIPQ-ERIRPLTSLDHPQSPFYDPSGGPMTPLGRVVVERIA-RKGEQCNTVPDTIDDIVADIAQEEKEEGDNTPETCIYSNWSPWSACSSSTCDKGRRMRQRMLKAQLDPNLPCLHTQDFEPCMGPGCSEEEASTCMMSEWISWSPCSASCGMGMRSRERYVKQFPEDGSSCTLPTEETEKCV 545          

HSP 2 Score: 53.5286 bits (127), Expect = 5.999e-7
Identity = 23/54 (42.59%), Postives = 33/54 (61.11%), Query Frame = 1
Query: 1414 VDCQVSEWSLWRPCSKSCGWGTQYKKRVIQKDSLNGGLPCPVLYESRKCFSKPC 1575
             DC +SEWS W  C+KSCG G   + R+++ +   GGLPCP   + +KC  + C
Sbjct:  663 TDCMLSEWSAWSECNKSCGKGHMIRSRMVKLEPQFGGLPCPETVQRKKCKIRKC 716          
BLAST of Spondin-1 vs. Ensembl Zebrafish
Match: spon1b (spondin 1b [Source:ZFIN;Acc:ZDB-GENE-000427-10])

HSP 1 Score: 93.9745 bits (232), Expect = 1.358e-19
Identity = 72/251 (28.69%), Postives = 103/251 (41.04%), Query Frame = 1
Query:   82 SGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKSNPF-----TPDTPVAEITLTRVEPQKDTQCVKTP---VKGVNEFQNAQKESRSNTL---------------------GRNGAVEKYNVLDDPQL----------------AQMAKAFCGFSEWTSWSPCSVKCGEGETSRTRNLIKNLKNELCIQLPRKEQKNCA 699
            S   SV+R  +L S ++M+GPSPDW  G+SG DLC   C W   L   L P DAG  +G +Y+  N   + + + IR +  +    +PF      P TP+  + + R+  +K  QC   P      V +    +KE   NT                      GR           DP L                ++   + C  SEW SWSPCS  CG G  SR R + +  ++     LP +E + C 
Sbjct:  297 SAEFSVDRVRHLMSFLTMLGPSPDWNVGLSGEDLCTRDCGWVQKLVKDLVPWDAGTDSGVSYESPNKPSIPQ-ERIRPLTSLDHPQSPFYDPSGGPMTPLGRVVVERIA-RKGEQCNTVPDTIDDIVADIAQEEKEEGDNTPETCIYSNWSPWSACSSSTCDKGRRMRQRMLKAQLDPNLPCLHTQDFEPCMGPGCSEEEASTCMMSEWISWSPCSASCGMGMRSRERYVKQFPEDGSSCTLPTEETEKCV 545          

HSP 2 Score: 53.1434 bits (126), Expect = 8.156e-7
Identity = 23/54 (42.59%), Postives = 33/54 (61.11%), Query Frame = 1
Query: 1414 VDCQVSEWSLWRPCSKSCGWGTQYKKRVIQKDSLNGGLPCPVLYESRKCFSKPC 1575
             DC +SEWS W  C+KSCG G   + R+++ +   GGLPCP   + +KC  + C
Sbjct:  663 TDCMLSEWSAWSECNKSCGKGHMIRSRMVKLEPQFGGLPCPETVQRKKCKIRKC 716          
BLAST of Spondin-1 vs. Ensembl Zebrafish
Match: spon1b (spondin 1b [Source:ZFIN;Acc:ZDB-GENE-000427-10])

HSP 1 Score: 93.9745 bits (232), Expect = 1.398e-19
Identity = 72/251 (28.69%), Postives = 103/251 (41.04%), Query Frame = 1
Query:   82 SGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKSNPF-----TPDTPVAEITLTRVEPQKDTQCVKTP---VKGVNEFQNAQKESRSNTL---------------------GRNGAVEKYNVLDDPQL----------------AQMAKAFCGFSEWTSWSPCSVKCGEGETSRTRNLIKNLKNELCIQLPRKEQKNCA 699
            S   SV+R  +L S ++M+GPSPDW  G+SG DLC   C W   L   L P DAG  +G +Y+  N   + + + IR +  +    +PF      P TP+  + + R+  +K  QC   P      V +    +KE   NT                      GR           DP L                ++   + C  SEW SWSPCS  CG G  SR R + +  ++     LP +E + C 
Sbjct:  260 SAEFSVDRVRHLMSFLTMLGPSPDWNVGLSGEDLCTRDCGWVQKLVKDLVPWDAGTDSGVSYESPNKPSIPQ-ERIRPLTSLDHPQSPFYDPSGGPMTPLGRVVVERIA-RKGEQCNTVPDTIDDIVADIAQEEKEEGDNTPETCIYSNWSPWSACSSSTCDKGRRMRQRMLKAQLDPNLPCLHTQDFEPCMGPGCSEEEASTCMMSEWISWSPCSASCGMGMRSRERYVKQFPEDGSSCTLPTEETEKCV 508          

HSP 2 Score: 53.1434 bits (126), Expect = 8.450e-7
Identity = 23/54 (42.59%), Postives = 33/54 (61.11%), Query Frame = 1
Query: 1414 VDCQVSEWSLWRPCSKSCGWGTQYKKRVIQKDSLNGGLPCPVLYESRKCFSKPC 1575
             DC +SEWS W  C+KSCG G   + R+++ +   GGLPCP   + +KC  + C
Sbjct:  626 TDCMLSEWSAWSECNKSCGKGHMIRSRMVKLEPQFGGLPCPETVQRKKCKIRKC 679          
BLAST of Spondin-1 vs. Ensembl Zebrafish
Match: spon1b (spondin 1b [Source:ZFIN;Acc:ZDB-GENE-000427-10])

HSP 1 Score: 93.9745 bits (232), Expect = 1.433e-19
Identity = 72/251 (28.69%), Postives = 103/251 (41.04%), Query Frame = 1
Query:   82 SGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKSNPF-----TPDTPVAEITLTRVEPQKDTQCVKTP---VKGVNEFQNAQKESRSNTL---------------------GRNGAVEKYNVLDDPQL----------------AQMAKAFCGFSEWTSWSPCSVKCGEGETSRTRNLIKNLKNELCIQLPRKEQKNCA 699
            S   SV+R  +L S ++M+GPSPDW  G+SG DLC   C W   L   L P DAG  +G +Y+  N   + + + IR +  +    +PF      P TP+  + + R+  +K  QC   P      V +    +KE   NT                      GR           DP L                ++   + C  SEW SWSPCS  CG G  SR R + +  ++     LP +E + C 
Sbjct:  297 SAEFSVDRVRHLMSFLTMLGPSPDWNVGLSGEDLCTRDCGWVQKLVKDLVPWDAGTDSGVSYESPNKPSIPQ-ERIRPLTSLDHPQSPFYDPSGGPMTPLGRVVVERIA-RKGEQCNTVPDTIDDIVADIAQEEKEEGDNTPETCIYSNWSPWSACSSSTCDKGRRMRQRMLKAQLDPNLPCLHTQDFEPCMGPGCSEEEASTCMMSEWISWSPCSASCGMGMRSRERYVKQFPEDGSSCTLPTEETEKCV 545          

HSP 2 Score: 53.1434 bits (126), Expect = 8.021e-7
Identity = 23/54 (42.59%), Postives = 33/54 (61.11%), Query Frame = 1
Query: 1414 VDCQVSEWSLWRPCSKSCGWGTQYKKRVIQKDSLNGGLPCPVLYESRKCFSKPC 1575
             DC +SEWS W  C+KSCG G   + R+++ +   GGLPCP   + +KC  + C
Sbjct:  663 TDCMLSEWSAWSECNKSCGKGHMIRSRMVKLEPQFGGLPCPETVQRKKCKIRKC 716          
BLAST of Spondin-1 vs. Ensembl Zebrafish
Match: spon1a (spondin 1a [Source:ZFIN;Acc:ZDB-GENE-000427-9])

HSP 1 Score: 85.1149 bits (209), Expect = 8.189e-17
Identity = 68/250 (27.20%), Postives = 104/250 (41.60%), Query Frame = 1
Query:   82 SGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYK-PNNVTRLDEPDTIREINKIWMKSNPF-TPD----TPVAEITLTRVEPQKDTQCVKTP------VKGVNEFQNAQKESRSNTLGRNGA---------------------------------VEKYNVLDDPQLAQMAKAFCGFSEWTSWSPCSVKCGEGETSRTRNLIKNLKNELCIQLPRKEQKNC 696
            S   SV+RT +L S ++M+GPSPDW  G+S  DLC   C W   +   L P DAG  +G +Y+ PN  T   E   IR +  +    +PF  P+    TPVA + + R+  +K  QC   P      V  + + +  + ++    +  N +                                  + +     P  +    + C  SEW +WSPCSV CG G  SR R + +   +      P +E + C
Sbjct:  302 SAEFSVDRTRHLMSFLTMLGPSPDWNVGLSSEDLCTRECGWVQKVVQDLIPWDAGTDSGVSYESPNKSTAPQE--KIRPLTSLDHPQSPFYDPEGGAITPVARLVVERIA-RKGEQCNIVPDNVDDIVADIAQEEKEEDDTPETCIYSNWSPWSACSSSTCEKGKRMRQRMLKAQLDLSVPCPHTQDFEPCMGPGCSDEDSSTCMMSEWITWSPCSVSCGSGLRSRERYVKQFPDDGFACTHPTEETEPC 548          
BLAST of Spondin-1 vs. Ensembl Xenopus
Match: spon1 (spondin 1, extracellular matrix protein [Source:NCBI gene;Acc:100036727])

HSP 1 Score: 86.6557 bits (213), Expect = 4.268e-17
Identity = 69/249 (27.71%), Postives = 103/249 (41.37%), Query Frame = 1
Query:   82 SGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKSNPF-----TPDTPVAEITLTRVEPQKDTQCVKTPVKG---VNEFQNAQKESR-----------------SNTLGRNGAVEKYNVLD-------------------DPQLAQMAKAFCGFSEWTSWSPCSVKCGEGETSRTRNLIKNLKNELCIQLPRKEQKNC 696
            S   SV+R+ +L S ++MMGPSPDW  G+S  DLC   C W   +   L P DAG  +G TY+  N   + + D IR +  +    +PF      P  PVA + + R+  +K  QC   P      V +    +KE                   S+     G   +  +L                     P  +    + C  SEW +WSPCS  CG G  SR R + +  ++    ++P +E + C
Sbjct:  298 SAEFSVDRSRHLMSFLAMMGPSPDWNVGLSSEDLCTKECGWVQKVIQDLIPWDAGTDSGVTYESPNKPSIPQ-DKIRPLTSLDHPQSPFYDPEGGPIIPVARVVIERIA-RKGDQCNIVPDNVDDIVPDLVTEEKEEDDTPETCIYSNWSPWSACSSATCDKGKRMRQRMLKAQLDLSVPCPDTQDFEPCMGPGCSDDEASTCMMSEWITWSPCSASCGMGMRSRERYVKQFPEDGSMCKVPTEETEKC 544          
BLAST of Spondin-1 vs. Ensembl Xenopus
Match: spon1 (spondin 1, extracellular matrix protein [Source:NCBI gene;Acc:100036727])

HSP 1 Score: 86.6557 bits (213), Expect = 4.293e-17
Identity = 69/249 (27.71%), Postives = 103/249 (41.37%), Query Frame = 1
Query:   82 SGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKSNPF-----TPDTPVAEITLTRVEPQKDTQCVKTPVKG---VNEFQNAQKESR-----------------SNTLGRNGAVEKYNVLD-------------------DPQLAQMAKAFCGFSEWTSWSPCSVKCGEGETSRTRNLIKNLKNELCIQLPRKEQKNC 696
            S   SV+R+ +L S ++MMGPSPDW  G+S  DLC   C W   +   L P DAG  +G TY+  N   + + D IR +  +    +PF      P  PVA + + R+  +K  QC   P      V +    +KE                   S+     G   +  +L                     P  +    + C  SEW +WSPCS  CG G  SR R + +  ++    ++P +E + C
Sbjct:  295 SAEFSVDRSRHLMSFLAMMGPSPDWNVGLSSEDLCTKECGWVQKVIQDLIPWDAGTDSGVTYESPNKPSIPQ-DKIRPLTSLDHPQSPFYDPEGGPIIPVARVVIERIA-RKGDQCNIVPDNVDDIVPDLVTEEKEEDDTPETCIYSNWSPWSACSSATCDKGKRMRQRMLKAQLDLSVPCPDTQDFEPCMGPGCSDDEASTCMMSEWITWSPCSASCGMGMRSRERYVKQFPEDGSMCKVPTEETEKC 541          
BLAST of Spondin-1 vs. Ensembl Xenopus
Match: spon1 (spondin 1, extracellular matrix protein [Source:NCBI gene;Acc:100036727])

HSP 1 Score: 83.1889 bits (204), Expect = 5.650e-16
Identity = 60/195 (30.77%), Postives = 87/195 (44.62%), Query Frame = 1
Query:   82 SGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKSNPF-----TPDTPVAEITLTRVEPQKDTQCVKTPVKGVNEFQNAQKESRSNTLGRNGAVEKYNVLDDPQLAQMAKAFCGFSEWTSWSPC-SVKCGEGETSRTRNLIKNL 648
            S   SV+R+ +L S ++MMGPSPDW  G+S  DLC   C W   +   L P DAG  +G TY+  N   + + D IR +  +    +PF      P  PVA + + R+  +K  QC   P                + +  +   E+    D P+        C +S W+ WS C S  C +G+  R R L   L
Sbjct:  298 SAEFSVDRSRHLMSFLAMMGPSPDWNVGLSSEDLCTKECGWVQKVIQDLIPWDAGTDSGVTYESPNKPSIPQ-DKIRPLTSLDHPQSPFYDPEGGPIIPVARVVIERIA-RKGDQCNIVP-------------DNVDDIVPDLVTEEKEEDDTPET-------CIYSNWSPWSACSSATCDKGKRMRQRMLKAQL 470          
BLAST of Spondin-1 vs. Ensembl Xenopus
Match: spon1 (spondin 1, extracellular matrix protein [Source:NCBI gene;Acc:100036727])

HSP 1 Score: 82.8037 bits (203), Expect = 6.330e-16
Identity = 60/195 (30.77%), Postives = 87/195 (44.62%), Query Frame = 1
Query:   82 SGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKSNPF-----TPDTPVAEITLTRVEPQKDTQCVKTPVKGVNEFQNAQKESRSNTLGRNGAVEKYNVLDDPQLAQMAKAFCGFSEWTSWSPC-SVKCGEGETSRTRNLIKNL 648
            S   SV+R+ +L S ++MMGPSPDW  G+S  DLC   C W   +   L P DAG  +G TY+  N   + + D IR +  +    +PF      P  PVA + + R+  +K  QC   P                + +  +   E+    D P+        C +S W+ WS C S  C +G+  R R L   L
Sbjct:  298 SAEFSVDRSRHLMSFLAMMGPSPDWNVGLSSEDLCTKECGWVQKVIQDLIPWDAGTDSGVTYESPNKPSIPQ-DKIRPLTSLDHPQSPFYDPEGGPIIPVARVVIERIA-RKGDQCNIVP-------------DNVDDIVPDLVTEEKEEDDTPET-------CIYSNWSPWSACSSATCDKGKRMRQRMLKAQL 470          
BLAST of Spondin-1 vs. Ensembl Xenopus
Match: spon1 (spondin 1, extracellular matrix protein [Source:NCBI gene;Acc:100036727])

HSP 1 Score: 82.8037 bits (203), Expect = 6.535e-16
Identity = 60/195 (30.77%), Postives = 87/195 (44.62%), Query Frame = 1
Query:   82 SGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKSNPF-----TPDTPVAEITLTRVEPQKDTQCVKTPVKGVNEFQNAQKESRSNTLGRNGAVEKYNVLDDPQLAQMAKAFCGFSEWTSWSPC-SVKCGEGETSRTRNLIKNL 648
            S   SV+R+ +L S ++MMGPSPDW  G+S  DLC   C W   +   L P DAG  +G TY+  N   + + D IR +  +    +PF      P  PVA + + R+  +K  QC   P                + +  +   E+    D P+        C +S W+ WS C S  C +G+  R R L   L
Sbjct:  305 SAEFSVDRSRHLMSFLAMMGPSPDWNVGLSSEDLCTKECGWVQKVIQDLIPWDAGTDSGVTYESPNKPSIPQ-DKIRPLTSLDHPQSPFYDPEGGPIIPVARVVIERIA-RKGDQCNIVP-------------DNVDDIVPDLVTEEKEEDDTPET-------CIYSNWSPWSACSSATCDKGKRMRQRMLKAQL 477          
BLAST of Spondin-1 vs. Ensembl Mouse
Match: Spon1 (spondin 1, (f-spondin) extracellular matrix protein [Source:MGI Symbol;Acc:MGI:2385287])

HSP 1 Score: 85.8853 bits (211), Expect = 5.470e-17
Identity = 69/249 (27.71%), Postives = 104/249 (41.77%), Query Frame = 1
Query:   82 SGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKSNPF-TPD----TPVAEITLTRVEPQKDTQCVKTPVKGVNEFQNAQKESR--------------------SNTLGRNGAVEKYNVLD-------------------DPQLAQMAKAFCGFSEWTSWSPCSVKCGEGETSRTRNLIKNLKNELCIQLPRKEQKNC 696
            S   SV+RT +L S ++MMGPSPDW  G+S  DLC   C W   +   L P DAG  +G TY+  N   + + + IR +  +    +PF  P+    T VA + + R+  +K  QC   P    +   +   E +                    S++    G   +  +L                     P  +    + C  SEW +WSPCSV CG G  SR R + +  ++     LP +E + C
Sbjct:  302 SAEFSVDRTRHLMSFLTMMGPSPDWNVGLSAEDLCTKECGWVQKVVQDLIPWDAGTDSGVTYESPNKPTIPQ-EKIRPLTSLDHPQSPFYDPEGGSITQVARVVIERIA-RKGEQCNIVPDNVDDIVADLAPEEKDEDDTPETCIYSNWSPWSACSSSTCEKGKRMRQRMLKAQLDLSVPCPDTQDFQPCMGPGCSDEDGSTCTMSEWITWSPCSVSCGMGMRSRERYVKQFPEDGSVCMLPTEETEKC 548          

HSP 2 Score: 57.3806 bits (137), Expect = 4.624e-8
Identity = 24/54 (44.44%), Postives = 35/54 (64.81%), Query Frame = 1
Query: 1414 VDCQVSEWSLWRPCSKSCGWGTQYKKRVIQKDSLNGGLPCPVLYESRKCFSKPC 1575
            +DC++SEWS W  C+KSCG G   + R IQ +   GG+PCP   + +KC ++ C
Sbjct:  667 IDCELSEWSQWSECNKSCGKGHMIRTRTIQMEPQFGGVPCPETVQRKKCRTRKC 720          
BLAST of Spondin-1 vs. Ensembl Mouse
Match: Spon2 (spondin 2, extracellular matrix protein [Source:MGI Symbol;Acc:MGI:1923724])

HSP 1 Score: 73.9442 bits (180), Expect = 8.444e-14
Identity = 63/217 (29.03%), Postives = 97/217 (44.70%), Query Frame = 1
Query:   91 VSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKSNPFTPDT-----------PVAEITLTRVEPQKDTQCVKTPVKGVNEFQNAQKESRSNTLGRNGAVEKYNVLDDPQLAQMAKAFCGFSEWTSWSPCSVKCGE-GETSRTRNLIKNLKNE--LCIQLPRKEQKNCA 699
            + V+  H+L S +  + PSPDW  G+  +DLC +G +WK  + + LYP DAG  +G T+   N   + + DT+ EI      S+P  P             P+A++T  R+  Q+  +    P        +    SR N +     V+  +V + P         C  S W+SW  C   CG+ G  SRTR +     N    C +L  +E+  CA
Sbjct:  139 LEVHPRHSLVSFVVRIVPSPDWFVGIDSLDLC-EGGRWKEQVVLDLYPHDAGTDSGFTFSSPNFATIPQ-DTVTEIT----ASSPSHPANSFYYPRLKSLPPIAKVTFVRL--QQSPRAFAPP--------SLDLASRGNEI-----VDSLSVPETP-------LDCEVSLWSSWGLCGGPCGKLGAKSRTRYVRVQPANNGTPCPEL--EEEAECA 325          
BLAST of Spondin-1 vs. Ensembl Mouse
Match: Spint2 (serine protease inhibitor, Kunitz type 2 [Source:MGI Symbol;Acc:MGI:1338031])

HSP 1 Score: 59.6918 bits (143), Expect = 1.790e-9
Identity = 36/135 (26.67%), Postives = 63/135 (46.67%), Query Frame = 1
Query:  982 RFFYHIKTGKCEPFKYYDCKKGNLNNFPT----IDSCENVCSKVIQELPKIRRSNLALLQARTSYSAEESLSQKAKNIPEFCFHEVDSSKTCMKSKPKTIWYYSHRNRKCQSLVDYDCKGTLNKFSTFDDCMKTC 1374
            R++Y+I  G C+PF Y  C+ GN NN+ +    +D C  V      ++ + R    + + +     + E LS +  N  E+C  +  +   C  + P+  WYY      C S +   C+G  N + + + CM+ C
Sbjct:   53 RWWYNITDGSCQPFVYGGCE-GNGNNYQSKEECLDKCAGVTENTTDDMARNRNGADSSVLSVPRKQSAEDLSAEIFNYEEYCVPKAVTGP-CRAAFPR--WYYDTEKNSCISFIYGGCRGNKNSYLSQEACMQHC 183          
BLAST of Spondin-1 vs. Ensembl Mouse
Match: Tfpi (tissue factor pathway inhibitor [Source:MGI Symbol;Acc:MGI:1095418])

HSP 1 Score: 50.8322 bits (120), Expect = 1.356e-6
Identity = 37/132 (28.03%), Postives = 61/132 (46.21%), Query Frame = 1
Query:  985 FFYHIKTGKCEPFKYYDCKKGNLNNFPTIDSCENVCSKVIQELPKIRRSNLALLQARTSYSAEESLSQKAKNIPEFCFHEVDSS--KTCMKSKPKTIWYYSHRNRKCQSLVDYDCKGTLNKFSTFDDCMKTC 1374
            +F+++ T +CE F Y  C+ GN N F T++ C+  C      +P   ++       + +  AE          P+FCF E D    +  MK      + Y+++ ++C+  V   C G  N F T D+C K C
Sbjct:   66 YFFNMYTHQCEEFIYGGCE-GNENRFDTLEECKKTC------IPGYEKT-----AVKAASGAER---------PDFCFLEEDPGLCRGYMKR-----YLYNNQTKQCERFVYGGCLGNRNNFETLDECKKIC 171          
BLAST of Spondin-1 vs. Ensembl Mouse
Match: Tfpi (tissue factor pathway inhibitor [Source:MGI Symbol;Acc:MGI:1095418])

HSP 1 Score: 50.8322 bits (120), Expect = 1.356e-6
Identity = 37/132 (28.03%), Postives = 61/132 (46.21%), Query Frame = 1
Query:  985 FFYHIKTGKCEPFKYYDCKKGNLNNFPTIDSCENVCSKVIQELPKIRRSNLALLQARTSYSAEESLSQKAKNIPEFCFHEVDSS--KTCMKSKPKTIWYYSHRNRKCQSLVDYDCKGTLNKFSTFDDCMKTC 1374
            +F+++ T +CE F Y  C+ GN N F T++ C+  C      +P   ++       + +  AE          P+FCF E D    +  MK      + Y+++ ++C+  V   C G  N F T D+C K C
Sbjct:   66 YFFNMYTHQCEEFIYGGCE-GNENRFDTLEECKKTC------IPGYEKT-----AVKAASGAER---------PDFCFLEEDPGLCRGYMKR-----YLYNNQTKQCERFVYGGCLGNRNNFETLDECKKIC 171          
BLAST of Spondin-1 vs. UniProt
Match: sp|P35446|SPON1_RAT (Spondin-1 OS=Rattus norvegicus OX=10116 GN=Spon1 PE=1 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 3.132e-16
Identity = 69/249 (27.71%), Postives = 104/249 (41.77%), Query Frame = 1
Query:   82 SGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKSNPF-TPD----TPVAEITLTRVEPQKDTQCVKTPVKGVNEFQNAQKESR--------------------SNTLGRNGAVEKYNVLD-------------------DPQLAQMAKAFCGFSEWTSWSPCSVKCGEGETSRTRNLIKNLKNELCIQLPRKEQKNC 696
            S   SV+RT +L S ++MMGPSPDW  G+S  DLC   C W   +   L P DAG  +G TY+  N   + + + IR +  +    +PF  P+    T VA + + R+  +K  QC   P    +   +   E +                    S++    G   +  +L                     P  +    + C  SEW +WSPCSV CG G  SR R + +  ++     LP +E + C
Sbjct:  302 SAEFSVDRTRHLMSFLTMMGPSPDWNVGLSAEDLCTKECGWVQKVVQDLIPWDAGTDSGVTYESPNKPTIPQ-EKIRPLTSLDHPQSPFYDPEGGSITQVARVVIERIA-RKGEQCNIVPDNVDDIVADLAPEEKDEDDTPETCIYSNWSPWSACSSSTCEKGKRMRQRMLKAQLDLSVPCPDTQDFQPCMGPGCSDEDGSTCTMSEWITWSPCSVSCGMGMRSRERYVKQFPEDGSVCMLPTEETEKC 548          

HSP 2 Score: 56.6102 bits (135), Expect = 5.560e-7
Identity = 24/54 (44.44%), Postives = 34/54 (62.96%), Query Frame = 1
Query: 1414 VDCQVSEWSLWRPCSKSCGWGTQYKKRVIQKDSLNGGLPCPVLYESRKCFSKPC 1575
            +DC++SEWS W  C+KSCG G   + R IQ +   GG PCP   + +KC ++ C
Sbjct:  667 IDCELSEWSQWSECNKSCGKGHMIRTRTIQMEPQFGGAPCPETVQRKKCRARKC 720          
BLAST of Spondin-1 vs. UniProt
Match: sp|Q8VCC9|SPON1_MOUSE (Spondin-1 OS=Mus musculus OX=10090 GN=Spon1 PE=1 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 3.826e-16
Identity = 69/249 (27.71%), Postives = 104/249 (41.77%), Query Frame = 1
Query:   82 SGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKSNPF-TPD----TPVAEITLTRVEPQKDTQCVKTPVKGVNEFQNAQKESR--------------------SNTLGRNGAVEKYNVLD-------------------DPQLAQMAKAFCGFSEWTSWSPCSVKCGEGETSRTRNLIKNLKNELCIQLPRKEQKNC 696
            S   SV+RT +L S ++MMGPSPDW  G+S  DLC   C W   +   L P DAG  +G TY+  N   + + + IR +  +    +PF  P+    T VA + + R+  +K  QC   P    +   +   E +                    S++    G   +  +L                     P  +    + C  SEW +WSPCSV CG G  SR R + +  ++     LP +E + C
Sbjct:  302 SAEFSVDRTRHLMSFLTMMGPSPDWNVGLSAEDLCTKECGWVQKVVQDLIPWDAGTDSGVTYESPNKPTIPQ-EKIRPLTSLDHPQSPFYDPEGGSITQVARVVIERIA-RKGEQCNIVPDNVDDIVADLAPEEKDEDDTPETCIYSNWSPWSACSSSTCEKGKRMRQRMLKAQLDLSVPCPDTQDFQPCMGPGCSDEDGSTCTMSEWITWSPCSVSCGMGMRSRERYVKQFPEDGSVCMLPTEETEKC 548          

HSP 2 Score: 57.3806 bits (137), Expect = 3.235e-7
Identity = 24/54 (44.44%), Postives = 35/54 (64.81%), Query Frame = 1
Query: 1414 VDCQVSEWSLWRPCSKSCGWGTQYKKRVIQKDSLNGGLPCPVLYESRKCFSKPC 1575
            +DC++SEWS W  C+KSCG G   + R IQ +   GG+PCP   + +KC ++ C
Sbjct:  667 IDCELSEWSQWSECNKSCGKGHMIRTRTIQMEPQFGGVPCPETVQRKKCRTRKC 720          
BLAST of Spondin-1 vs. UniProt
Match: sp|Q9GLX9|SPON1_BOVIN (Spondin-1 OS=Bos taurus OX=9913 GN=SPON1 PE=1 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 5.811e-16
Identity = 66/249 (26.51%), Postives = 104/249 (41.77%), Query Frame = 1
Query:   82 SGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKSNPF-TPD----TPVAEITLTRVEPQKDTQCVKTP------VKGVNEFQNAQKESRSNTLGRNGA---------------------------------VEKYNVLDDPQLAQMAKAFCGFSEWTSWSPCSVKCGEGETSRTRNLIKNLKNELCIQLPRKEQKNC 696
            S   SV+RT +L S ++MMGPSPDW  G+S  DLC   C W   +   L P DAG  +G TY+  N   + + + IR +  +    +PF  P+    T VA + + R+  +K  QC   P      V  +   +  + ++    +  N +                                  + +     P  +    + C  SEW +WSPCS+ CG G  SR R + +  ++     LP +E + C
Sbjct:  302 SAEFSVDRTRHLMSFLTMMGPSPDWNVGLSAEDLCTKECGWVQKVVQDLIPWDAGTDSGVTYESPNKPTIPQ-EKIRPLTSLDHPQSPFYDPEGGSITQVARVVIERIA-RKGEQCNIVPDNVDDIVADLAPEEKDEDDTPETCIYSNWSPWSACSSSTCDKGKRMRQRMLKAQLDLSVPCPDTQDFQPCMGPGCSDEDGSTCTMSEWITWSPCSISCGTGTRSRERYVKQFPEDGSVCTLPTEETEKC 548          

HSP 2 Score: 54.6842 bits (130), Expect = 2.238e-6
Identity = 23/54 (42.59%), Postives = 34/54 (62.96%), Query Frame = 1
Query: 1414 VDCQVSEWSLWRPCSKSCGWGTQYKKRVIQKDSLNGGLPCPVLYESRKCFSKPC 1575
            +DC+++EWS W  C+KSCG G   + R+IQ +   GG PCP   + +KC  + C
Sbjct:  667 IDCELTEWSQWSECNKSCGKGHMIRTRMIQMEPQFGGTPCPETVQRKKCRIRKC 720          
BLAST of Spondin-1 vs. UniProt
Match: sp|Q9HCB6|SPON1_HUMAN (Spondin-1 OS=Homo sapiens OX=9606 GN=SPON1 PE=1 SV=2)

HSP 1 Score: 85.1149 bits (209), Expect = 7.545e-16
Identity = 66/249 (26.51%), Postives = 104/249 (41.77%), Query Frame = 1
Query:   82 SGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKSNPF-TPD----TPVAEITLTRVEPQKDTQCVKTP------VKGVNEFQNAQKESRSNTLGRNGA---------------------------------VEKYNVLDDPQLAQMAKAFCGFSEWTSWSPCSVKCGEGETSRTRNLIKNLKNELCIQLPRKEQKNC 696
            S   SV+RT +L S ++MMGPSPDW  G+S  DLC   C W   +   L P DAG  +G TY+  N   + + + IR +  +    +PF  P+    T VA + + R+  +K  QC   P      V  +   +  + ++    +  N +                                  + +     P  +    + C  SEW +WSPCS+ CG G  SR R + +  ++     LP +E + C
Sbjct:  302 SAEFSVDRTRHLMSFLTMMGPSPDWNVGLSAEDLCTKECGWVQKVVQDLIPWDAGTDSGVTYESPNKPTIPQ-EKIRPLTSLDHPQSPFYDPEGGSITQVARVVIERIA-RKGEQCNIVPDNVDDIVADLAPEEKDEDDTPETCIYSNWSPWSACSSSTCDKGKRMRQRMLKAQLDLSVPCPDTQDFQPCMGPGCSDEDGSTCTMSEWITWSPCSISCGMGMRSRERYVKQFPEDGSVCTLPTEETEKC 548          

HSP 2 Score: 53.9138 bits (128), Expect = 3.380e-6
Identity = 23/54 (42.59%), Postives = 34/54 (62.96%), Query Frame = 1
Query: 1414 VDCQVSEWSLWRPCSKSCGWGTQYKKRVIQKDSLNGGLPCPVLYESRKCFSKPC 1575
            +DC+++EWS W  C+KSCG G   + R+IQ +   GG PCP   + +KC  + C
Sbjct:  667 IDCELTEWSQWSECNKSCGKGHVIRTRMIQMEPQFGGAPCPETVQRKKCRIRKC 720          
BLAST of Spondin-1 vs. UniProt
Match: sp|Q9BUD6|SPON2_HUMAN (Spondin-2 OS=Homo sapiens OX=9606 GN=SPON2 PE=1 SV=3)

HSP 1 Score: 77.7962 bits (190), Expect = 2.875e-14
Identity = 61/199 (30.65%), Postives = 85/199 (42.71%), Query Frame = 1
Query:   76 ERSGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKSNPFTPDT-----------PVAEITLTRVEPQKDTQCVKTPVKGVNEFQNAQKESRSNTLGRNGAVEKYNVLDDPQLAQMAKAFCGFSEWTSWSPCSVKCGE-GETSRTRNL 636
            + S  + V R H+L S +  + PSPDW  GV  +DLC DG +W+    + LYP DAG  +G T+   N   + + DT+ EI      S+P  P             P+A +TL R+           PV            SR N +  + +V +   LD           C  S W+SW  C   CG  G  SRTR +
Sbjct:  135 QTSAELEVQRRHSLVSFVVRIVPSPDWFVGVDSLDLC-DGDRWREQAALDLYPYDAGTDSGFTFSSPNFATIPQ-DTVTEIT----SSSPSHPANSFYYPRLKALPPIARVTLVRLRQSPRAFIPPAPV----------LPSRDNEIVDSASVPE-TPLD-----------CEVSLWSSWGLCGGHCGRLGTKSRTRYV 305          
BLAST of Spondin-1 vs. TrEMBL
Match: gnl|BL_ORD_ID|15795392 (tr|A0A0R3SRQ7|A0A0R3SRQ7_HYMDI Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS7882 PE=4 SV=1)

HSP 1 Score: 318.161 bits (814), Expect = 1.163e-93
Identity = 220/597 (36.85%), Postives = 291/597 (48.74%), Query Frame = 1
Query:   22 VKSLFTSGWLNGEEQLNEERSGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKSNPFTPDTPVAEITLTRVEPQKDTQCVKTPVKGVNEF------------------------------------QNAQKESRSNTLG---RNGAVEKYNVLDDPQLAQMAKAFCGFSEWTSWSPCSVKCGEGETSRTRNLIKNLKNELCIQLPRKEQKNCAGARLECDLXXXXXXXXXXXXXXXXASCTTE-GKMIRIRKFARSKEKDEC---MKNVKPEII--LQQVKTCKLDKTDFRCDPISICSAG--KLAPCINGKPKTRFFYHIKTGKCEPFKYYDCKKGNLNNFPTIDSCENVCSKVIQELPKIRRSNLALLQARTSY---SAEESLSQKAKNIPEFCFHEVDSSKTCMKSKPKTI---WYYSHRNRKCQSLVDYDCKGTLNKFSTFDDCMKTCRPDSQLESLKLDKV-----------------------------DCQVSEWSLWRPCSKSCG--WGTQYKKRVIQKDSLNGGLPCPVLYESRKC 1560
            ++SL ++  + GEE L E+R+   SVNRTH LFSM++M+GPSPDWCTG+SG  LC   C W  N+T+ L P DAGI+ G TY P    R D PD IR I++ WM  NPF  + PVA + + R+ P+ D +C      GV  F                                    +   K S+S   G    +G +   N L DP LAQMA   C  SEW++WS CSV CG G  +RTR LI N K ELC  +P   +++C G +  CD S  CS LPWS WSPC+A+C +  G   R R  AR KE  +C    K++   +   L +V+ C++      CDP +IC  G  +  PC  GK   R++Y      C  F+Y  CK G  N F T + CEN+C   ++ LP  RR  + LLQ +TS    SA ++ + + K  P  CF+EV++   C    PK I   WYY  R   C       C GT N+F     CM  C P+   +S  L KV                             DC+V+ W  W PCS  C    G QY+ R I + +  GG  C  LYE R C
Sbjct:  376 LRSLISTPGMWGEETLMEQRTTLFSVNRTHPLFSMLTMLGPSPDWCTGISGQSLCKADCTWVRNMTLYLRPWDAGIREGNTYMPKESDRKDIPDPIRYIDESWMPGNPFRENKPVARVEIERILPKNDWECTNVDADGVQLFVMGGGIRVSGKKVEEVKNKAADNMHTPSATQQIVTGKGRGKSSKSVGFGGPGSSGTLGTNNPLSDPSLAQMATFLCITSEWSAWSQCSVTCGVGTKTRTRELIANKKPELCQHVPLVMEESCEGRKRTCDYSAPCSFLPWSLWSPCNATCESPIGVRSRTRALARPKEAPQCEHLWKDLPGGMTSALNEVEECRIASEA--CDPATICGEGPKQGYPC--GKSMKRYYYSAIDHHCLEFEYLGCKGGR-NMFETREQCENICIPAVEALPAWRRERMGLLQFKTSQLSNSAADTCNMELKQDPA-CFYEVNTGYEC--DSPKEIGSYWYYYPRKNICSDFFYLGCGGTPNRFPNHTACMAACMPNDLRQSQILAKVRSNAGSNNPGELGDSEVPDGLEVAVSPKQDCRVTPWGGWGPCSTRCASQIGYQYRLRAIIRPARYGGEGCGPLYEKRNC 964          
BLAST of Spondin-1 vs. TrEMBL
Match: gnl|BL_ORD_ID|24659989 (tr|A0A5K3F8X7|A0A5K3F8X7_9CEST Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 317.775 bits (813), Expect = 2.118e-93
Identity = 217/602 (36.05%), Postives = 292/602 (48.50%), Query Frame = 1
Query:   22 VKSLFTSGWLNGEEQLNEERSGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKSNPFTPDTPVAEITLTRVEPQKDTQCVKTPVKGVNEFQNA----------QKESRSNTL---------------------------GRNGAVEKYNVLDDPQLAQMAKAFCGFSEWTSWSPCSVKCGEGETSRTRNLIKNLKNELCIQLPRKEQKNCAGARLECDLXXXXXXXXXXXXXXXXASC-TTEGKMIRIRKFARSKEKDECM-------KNVKPEIILQQVKTCKLDKTDFRCDPISICSAG--KLAPCINGKPKTRFFYHIKTGKCEPFKYYDCKKGNLNNFPTIDSCENVCSKVIQELPKIRRSNLALLQARTSY---SAEESLSQKAKNIPEFCFHEVDSSKTCMKSKPKTI---WYYSHRNRKCQSLVDYDCKGTLNKFSTFDDCMKTCRPDSQLESLKLDKV--------------------------------DCQVSEWSLWRPCSKSCG--WGTQYKKRVIQKDSLNGGLPCPVLYESRKCFS 1566
            ++SL T+  + GEE L EERS   SVNRTH L SM++M+GPSPDWCTG+SG  LC   C W +NLT+ LYP DAGI+ G TY P    R + PD IR I++ WM  NPF    PVA + + RV P+ D  C  T   GV  F+             KES  ++L                           G +G +   N L DP LAQMA   C   EW++WS CSV CG G  +RTR LI N K ELC  +P   +++C G +  CD S  CSLLPW+ WSPC+ +C +  G   R R  AR +E  +C        +  + + I+ +V+ C++      C+P +IC  G  +  PC  G    RF+Y     +C  F+Y  CK G  N F T   CE +C   ++ LP  RR  + LLQ +TS    S+ + L    K  P  C++EV++   C    PK +   WY+  R  +C+      C GT N+F+    CM  C P+    S  L KV                                DC+V++W  W PCS  C    G Q + R I++ S  GG  C  LYE R C+ 
Sbjct:  381 LRSLITTPGMWGEETLMEERSTLFSVNRTHPLVSMLTMLGPSPDWCTGISGQSLCKADCTWVNNLTLHLYPWDAGIREGNTYMPKESDRREIPDPIRYIDESWMPGNPFRERKPVAVVKIQRVRPKYDWACTNTDEDGVQLFKMGGGIYVTGKKNDKESDESSLKGGSATQQITAGKQKGKRTKSVGFGGPGASGTIGSNNPLSDPSLAQMATFLCITDEWSAWSACSVTCGVGTKTRTRRLIANKKPELCQHVPLVMEESCEGRKRTCDYSAPCSLLPWTLWSPCTGTCDSPRGHRSRKRALARPEEAAQCGHLWEGRNQEGREQGIMSEVEECQVPSET--CEPATICGEGPKQGYPC--GPKLRRFYYSAIDHECLEFEYLGCKGGR-NMFETKQDCEKLCIPAVEALPAWRRERMGLLQFKTSQLTSSSPDDLEDSLKRDP-VCYYEVNTGYEC--DPPKELGNYWYFCSRTNRCRDFFYLGCGGTPNRFANHTACMAACMPNELRHSQLLAKVRSATASRKAAANATDADEEAPDGLEVGVSPRQDCRVTQWGAWGPCSVRCSSQRGQQIRLRAIERPSRYGGEACGPLYERRSCYG 974          
BLAST of Spondin-1 vs. TrEMBL
Match: gnl|BL_ORD_ID|18802170 (tr|A0A0X3Q224|A0A0X3Q224_SCHSO Spondin-1 OS=Schistocephalus solidus OX=70667 GN=SPON1 PE=4 SV=1)

HSP 1 Score: 313.538 bits (802), Expect = 8.211e-93
Identity = 204/598 (34.11%), Postives = 288/598 (48.16%), Query Frame = 1
Query:   22 VKSLFTSGWLNGEEQLNEERSGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKSNPFTPDTPVAEITLTRVEPQKDTQCVKTPVKGVNEFQN-----------------------AQKESRSNT-------LGRNGAVEKYNVLDDPQLAQMAKAFCGFSEWTSWSPCSVKCGEGETSRTRNLIKNLKNELCIQLPRKEQKNCAGARLECDLXXXXXXXXXXXXXXXXASCTTEGKM-IRIRKFARSKEKDECMKNVKPEI------ILQQVKTCKLDKTDFRCDPISICSAGKLAPCINGKPKTRFFYHIKTGKCEPFKYYDCKKGNLNNFPTIDSCENVCSKVIQELPKIRRSNLALLQARTSY-----SAEESLSQKAKNIPEFCFHEVDSSKTC-MKSKPKTIWYYSHRNRKCQSLVDYDCKGTLNKFSTFDDCMKTCRPDSQLESLKLDKV----------------------------------------DCQVSEWSLWRPCSKSCG--WGTQYKKRVIQKDSLNGGLPCPVLYESRKC 1560
            + SL ++  + GEE LNE R+  ++VNRTH L S+++M+GPSPDWCTG+SG  +C   C W   L I LYP DAG++ G TY P N  RLD PD IR I++ WM  NPF    PVA +T+ R+ P+   QC      GV+ FQ                        +QK+ R           G +G++   + L DP LAQMA   C  S+W++W PCSV CG G   R R +I N K ELC  +    +++C G +  CD S  CSLLPW++WSPC+A+C +   +  R+RK   ++  +E   ++ P         L Q + C+L      CDP +IC  G       G+P   F+Y      C PF Y  CK G  N F + ++C+  C  V++ LP  RR  + LLQ +TS      + +ES     +N    C  EV++ + C    + ++ WYY  R  +C+  V   CKGT N+F+    CM  C P+    S +L ++                                        DCQV+ W  W PCS  C    G +++ R I + S  GG  C  LYE   C
Sbjct:  254 LHSLLSTPGMWGEETLNEPRTALIAVNRTHPLISLVTMLGPSPDWCTGISGQSVCKSDCTWVDKLEINLYPWDAGVRQGNTYMPKNADRLDIPDPIRYIDEKWMPGNPFYEHKPVARVTVQRILPEHAWQCTNRVADGVHLFQMGGTVMVSGKPANGSESVGAVQQVSQKKGRKGGKAVGFGGPGASGSLGTNDPLSDPSLAQMATFLCITSDWSAWGPCSVTCGVGSRKRQRTMISNKKPELCQHVQLTMEESCEGRQRTCDFSAPCSLLPWTAWSPCNATCQSPNHLGTRVRKRTLARRNEEGCDHLFPSARELATRTLVQTEECQLPPET--CDPATICGEGPKEGFPCGEPTPAFYYSAIEHDCLPFTYLGCKGGR-NRFSSAEACKTFCLPVVEALPAWRRERMGLLQFKTSQLSSTGATDESEGPVGQN--PACHEEVNTGEECDPPVEWESYWYYCPRTHRCRDFVYLGCKGTANRFTNHTACMAACMPNELRRSQQLARLRHSATKTSNMTGSEQKLQPEDNADFPVGLESMVDIANPKQDCQVTAWGAWGPCSAKCASEQGRRFRLRAILRPSRYGGKTCGPLYERTVC 846          
BLAST of Spondin-1 vs. TrEMBL
Match: gnl|BL_ORD_ID|24668607 (tr|A0A0R3U498|A0A0R3U498_9CEST Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS1462 PE=4 SV=2)

HSP 1 Score: 316.235 bits (809), Expect = 8.610e-93
Identity = 217/605 (35.87%), Postives = 292/605 (48.26%), Query Frame = 1
Query:   22 VKSLFTSGWLNGEEQLNEERSGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKSNPFTPDTPVAEITLTRVEPQKDTQCVKTPVKGVNEFQNA----------QKESRSNTL------------------------------GRNGAVEKYNVLDDPQLAQMAKAFCGFSEWTSWSPCSVKCGEGETSRTRNLIKNLKNELCIQLPRKEQKNCAGARLECDLXXXXXXXXXXXXXXXXASC-TTEGKMIRIRKFARSKEKDECM-------KNVKPEIILQQVKTCKLDKTDFRCDPISICSAG--KLAPCINGKPKTRFFYHIKTGKCEPFKYYDCKKGNLNNFPTIDSCENVCSKVIQELPKIRRSNLALLQARTSY---SAEESLSQKAKNIPEFCFHEVDSSKTCMKSKPKTI---WYYSHRNRKCQSLVDYDCKGTLNKFSTFDDCMKTCRPDSQLESLKLDKV--------------------------------DCQVSEWSLWRPCSKSCG--WGTQYKKRVIQKDSLNGGLPCPVLYESRKCFS 1566
            ++SL T+  + GEE L EERS   SVNRTH L SM++M+GPSPDWCTG+SG  LC   C W +NLT+ LYP DAGI+ G TY P    R + PD IR I++ WM  NPF    PVA + + RV P+ D  C  T   GV  F+             KES  ++L                              G +G +   N L DP LAQMA   C   EW++WS CSV CG G  +RTR LI N K ELC  +P   +++C G +  CD S  CSLLPW+ WSPC+ +C +  G   R R  AR +E  +C        +  + + I+ +V+ C++      C+P +IC  G  +  PC  G    RF+Y     +C  F+Y  CK G  N F T   CE +C   ++ LP  RR  + LLQ +TS    S+ + L    K  P  C++EV++   C    PK +   WY+  R  +C+      C GT N+F+    CM  C P+    S  L KV                                DC+V++W  W PCS  C    G Q + R I++ S  GG  C  LYE R C+ 
Sbjct:  381 LRSLITTPGMWGEETLMEERSTLFSVNRTHPLVSMLTMLGPSPDWCTGISGQSLCKADCTWVNNLTLHLYPWDAGIREGNTYMPKESDRREIPDPIRYIDESWMPGNPFRERKPVAVVKIQRVRPKYDWACTNTDEDGVQLFKMGGGIYVTGKKNDKESDESSLKEKAREQRCTTITAGKQKGKRTKSVGFGGPGASGTIGSNNPLSDPSLAQMATFLCITDEWSAWSACSVTCGVGTKTRTRRLIANKKPELCQHVPLVMEESCEGRKRTCDYSAPCSLLPWTLWSPCTGTCDSPRGHRSRKRALARPEEAAQCGHLWEGRNQEGREQGIMSEVEECQVPSET--CEPATICGEGPKQGYPC--GPKLRRFYYSAIDHECLEFEYLGCKGGR-NMFETKQDCEKLCIPAVEALPAWRRERMGLLQFKTSQLTSSSPDDLEDSLKRDP-VCYYEVNTGYEC--DPPKELGNYWYFCSRTNRCRDFFYLGCGGTPNRFANHTACMAACMPNELRHSQLLAKVRSATASRKAAANATDADEEAPDGLEVGVSPRQDCRVTQWGAWGPCSVRCSSQRGQQIRLRAIERPSRYGGEACGPLYERRSCYG 977          
BLAST of Spondin-1 vs. TrEMBL
Match: gnl|BL_ORD_ID|18715820 (tr|A0A0X3PKV3|A0A0X3PKV3_SCHSO Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=TR92381 PE=4 SV=1)

HSP 1 Score: 313.923 bits (803), Expect = 4.459e-92
Identity = 204/598 (34.11%), Postives = 288/598 (48.16%), Query Frame = 1
Query:   22 VKSLFTSGWLNGEEQLNEERSGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKSNPFTPDTPVAEITLTRVEPQKDTQCVKTPVKGVNEFQN-----------------------AQKESRSNT-------LGRNGAVEKYNVLDDPQLAQMAKAFCGFSEWTSWSPCSVKCGEGETSRTRNLIKNLKNELCIQLPRKEQKNCAGARLECDLXXXXXXXXXXXXXXXXASCTTEGKM-IRIRKFARSKEKDECMKNVKPEI------ILQQVKTCKLDKTDFRCDPISICSAGKLAPCINGKPKTRFFYHIKTGKCEPFKYYDCKKGNLNNFPTIDSCENVCSKVIQELPKIRRSNLALLQARTSY-----SAEESLSQKAKNIPEFCFHEVDSSKTC-MKSKPKTIWYYSHRNRKCQSLVDYDCKGTLNKFSTFDDCMKTCRPDSQLESLKLDKV----------------------------------------DCQVSEWSLWRPCSKSCG--WGTQYKKRVIQKDSLNGGLPCPVLYESRKC 1560
            + SL ++  + GEE LNE R+  ++VNRTH L S+++M+GPSPDWCTG+SG  +C   C W   L I LYP DAG++ G TY P N  RLD PD IR I++ WM  NPF    PVA +T+ R+ P+   QC      GV+ FQ                        +QK+ R           G +G++   + L DP LAQMA   C  S+W++W PCSV CG G   R R +I N K ELC  +    +++C G +  CD S  CSLLPW++WSPC+A+C +   +  R+RK   ++  +E   ++ P         L Q + C+L      CDP +IC  G       G+P   F+Y      C PF Y  CK G  N F + ++C+  C  V++ LP  RR  + LLQ +TS      + +ES     +N    C  EV++ + C    + ++ WYY  R  +C+  V   CKGT N+F+    CM  C P+    S +L ++                                        DCQV+ W  W PCS  C    G +++ R I + S  GG  C  LYE   C
Sbjct:  357 LHSLLSTPGMWGEETLNEPRTALIAVNRTHPLISLVTMLGPSPDWCTGISGQSVCKSDCTWVDKLEINLYPWDAGVRQGNTYMPKNADRLDIPDPIRYIDEKWMPGNPFYEHKPVARVTVQRILPEHAWQCTNRVADGVHLFQMGGTVMVSGKPANGSESVGAVQQVSQKKGRKGGKAVGFGGPGASGSLGTNDPLSDPSLAQMATFLCITSDWSAWGPCSVTCGVGSRKRQRTMISNKKPELCQHVQLTMEESCEGRQRTCDFSAPCSLLPWTAWSPCNATCQSPNHLGTRVRKRTLARRNEEGCDHLFPSARELATRTLVQTEECQLPPET--CDPATICGEGPKEGFPCGEPTPAFYYSAIEHDCLPFTYLGCKGGR-NRFSSAEACKTFCLPVVEALPAWRRERMGLLQFKTSQLSSTGATDESEGPVGQN--PACHEEVNTGEECDPPVEWESYWYYCPRTHRCRDFVYLGCKGTANRFTNHTACMAACMPNELRRSQQLARLRHSATKTSNMTGSEQKLQPEDNADFPVGLESMVDIANPKQDCQVTAWGAWGPCSAKCASEQGRRFRLRAILRPSRYGGKTCGPLYERTVC 949          
BLAST of Spondin-1 vs. Ensembl Cavefish
Match: spon1b (spondin 1b [Source:ZFIN;Acc:ZDB-GENE-000427-10])

HSP 1 Score: 92.8189 bits (229), Expect = 3.292e-19
Identity = 74/250 (29.60%), Postives = 106/250 (42.40%), Query Frame = 1
Query:   82 SGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYK-PNNVTRLDEPDTIREINKIWMKSNPF-----TPDTPVAEITLTRVE--------------------PQKDTQCVKTPVKGVNEFQNAQKESRSNTL--GR-----------NGAVEKYNVLD-----DPQLAQMAKAFCGFSEWTSWSPCSVKCGEGETSRTRNLIKNLKNELCIQLPRKEQKNCA 699
            S   SV+R H+L S ++M+GPSPDW  G+SG +LC   C W   L   L P DAG  +G TY+ PN  T   E   IR +  +    +PF      P TP+A + + R+                     P +DT+   TP   +    +      S+T   GR           +  V   +  D      P   +   + C  SEW SWSPCS  CG G  SR R + +  ++    + P +E + C 
Sbjct:  293 SAEFSVDRAHHLMSFLTMLGPSPDWNVGISGENLCTQECGWVQRLVKDLLPWDAGTDSGVTYESPNKPTNPQE--RIRPLTSLDHPQSPFYSPHGGPITPLARVVVERIARKGEQCNTVPDTVDDIVADIPPEDTEEDNTPETCIYSNWSPWSACSSSTCDKGRRMRQRMLKAQLDATVPCLHTQDFEPCMGPGCREEEPSTCMLSEWISWSPCSASCGMGMRSRERYIKQFPEDGSSCREPTEETEKCV 540          

HSP 2 Score: 51.9878 bits (123), Expect = 1.686e-6
Identity = 22/54 (40.74%), Postives = 35/54 (64.81%), Query Frame = 1
Query: 1414 VDCQVSEWSLWRPCSKSCGWGTQYKKRVIQKDSLNGGLPCPVLYESRKCFSKPC 1575
            VDC +S+WS W  C+KSCG G   + R+++ ++  GG+PCP   + +KC  + C
Sbjct:  658 VDCMLSDWSDWSECNKSCGKGHMIRSRMVKLEAQFGGVPCPETVQRKKCKIRKC 711          
BLAST of Spondin-1 vs. Ensembl Cavefish
Match: spon2b (spondin 2b, extracellular matrix protein [Source:ZFIN;Acc:ZDB-GENE-990415-161])

HSP 1 Score: 76.6406 bits (187), Expect = 9.596e-15
Identity = 65/237 (27.43%), Postives = 108/237 (45.57%), Query Frame = 1
Query:   19 NVKSLF-TSGWLNGEEQLNEERSGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKSNP----FTPDT----PVAEITLTRVEPQKDTQCVKTPVKGVNEFQNAQKESRSNTLGRNGAVEKYNVLDDPQLAQMAKAFCGFSEWTSWSPCSVKCGE-GETSRTRNLIKNLKNELCIQLPRKEQKNCA 699
            +V  LF T   L+G  Q   E      V   H+  S I  + PSPDW  GV  ++LC +G  WK N+++ L+P DAG  +G T+   N   + + D + +I      S+P    + P      P+A++TLT++   K  Q    P+          + ++SN +     + + ++++ P         C  S W+ W  C  +CGE G   RTR +  +  N   +  P +++K C 
Sbjct:  135 SVYGLFSTPAVLDGTSQTTTE----FEVYARHSFLSFIMRLVPSPDWFVGVDSLNLC-EGDHWKENISLDLFPYDAGTDSGFTFSSPNFETIPQ-DKVMQITSS-FPSHPANSFYYPRLKHLPPIAKVTLTKI---KSNQIFSLPI----------EPTQSNQIPTGNEINE-SLINTP-------LDCEVSAWSPWGLCKGQCGEKGVRHRTRYIHIHPANNGAVCPPLEDEKPCV 343          
BLAST of Spondin-1 vs. Ensembl Cavefish
Match: spon2a (spondin-2-like [Source:NCBI gene;Acc:103039648])

HSP 1 Score: 61.6178 bits (148), Expect = 7.531e-10
Identity = 58/207 (28.02%), Postives = 86/207 (41.55%), Query Frame = 1
Query:  115 LFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYK--------PNNVTRLDEPDTIREINKIWMKSNPFTPDTPVAEITLTRVEPQKDTQCVKTPVKGVNEFQNAQKESRSNTLGRNGAVEKYN--VLDDPQLAQMAKAFCGFSEWTSWSPCSVKCGEGET-SRTRNLIKNLKN--ELCIQLPRKEQKNC 696
            L S++  + PSPDW  GV  ++LC +G +WK  +T  L+P DAG  +G T+         P N+T +         N  +    P  P  P+A I L R          ++PV+  N   N       + L  +   +K++   LD           C  S W+SW  C   C  G    RTR ++    N    C +L  +EQ  C
Sbjct:  150 LLSLLVKVIPSPDWFVGVDSLNLC-EGGQWKQEVTFDLHPFDAGTDSGFTFSSPNFPTMPPENITMITSQKPNHPANSFYYPRLPQLP--PLATIWLRRQ--------ARSPVRQHNHVSN-------HILPHHTKPQKFSETPLD-----------CEVSMWSSWGLCLGPCSRGGLRHRTRYIMLKPANSGSPCPEL--EEQAEC 325          
BLAST of Spondin-1 vs. Ensembl Cavefish
Match: si:dkey-178e17.3 (somatomedin-B and thrombospondin type-1 domain-containing protein-like [Source:NCBI gene;Acc:103038119])

HSP 1 Score: 56.225 bits (134), Expect = 2.113e-8
Identity = 23/51 (45.10%), Postives = 30/51 (58.82%), Query Frame = 1
Query: 1414 VDCQVSEWSLWRPCSKSCGWGTQYKKRVIQKDSLNGGLPCPVLYESRKCFS 1566
            +DC+V EW +W PCS  CG GT  + R +     NGG PCP L + R C +
Sbjct:   83 IDCEVGEWGVWSPCSSVCGAGTTERSRQVTTPPRNGGSPCPDLKQRRGCLA 133          
BLAST of Spondin-1 vs. Ensembl Cavefish
Match: thsd7ab (thrombospondin, type I, domain containing 7Ab [Source:ZFIN;Acc:ZDB-GENE-130530-999])

HSP 1 Score: 55.4546 bits (132), Expect = 1.591e-7
Identity = 28/53 (52.83%), Postives = 32/53 (60.38%), Query Frame = 1
Query: 1417 DCQVSEWSLWRPCSKSCGWGTQYKKRVIQKDSLNGGLPCPVLYESRKCFSKPC 1575
            DC VS +S W  CSK+CG G Q + R I    L GGLPCP L E R C  +PC
Sbjct:  177 DCVVSRFSPWTACSKTCGLGLQNRVRSILAPPLFGGLPCPNLTEFRTCAPRPC 229          
BLAST of Spondin-1 vs. Ensembl Sea Lamprey
Match: spon2b (spondin 2b, extracellular matrix protein [Source:ZFIN;Acc:ZDB-GENE-990415-161])

HSP 1 Score: 61.2326 bits (147), Expect = 1.627e-10
Identity = 64/221 (28.96%), Postives = 93/221 (42.08%), Query Frame = 1
Query:   22 VKSLFTSGWL-NGEEQLNEERSGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETY-KPNNVTRLDEPDTIREINKIWMKSNPFTPD-----TPVAEITLTRVEPQKDTQCVKTPVKGVNEFQNAQKESRSNTLGRNGAVEKYNVLDDPQLAQMAKAFCGFSEWTSWSPCSV-KCGE-GETSRTRNLIKNLKNE 657
            V  +F++  L NG  Q + E    +       L S++  + PSPDW  GV  ++LC +G +WK  L++ L P DAG  +G T+  PN  T   EP T    +     +N F         P+A + LTR+   K     K P   +   QN            +G   K   LD           C  ++W+ W  CSV  CG+ G   RTR +     N+
Sbjct:  101 VAGVFSAPALPNGTGQSSTE----LEFTAKQPLLSLMVRLVPSPDWFVGVDSLNLC-EGERWKERLSLDLQPYDAGTDSGFTFSSPNYATIPQEPITQMTSSSPSHPANSFYYPKLKQLPPLARLVLTRM--GKRPHSSKHPDANLVTRQNEPA---------SGVYIKQTPLD-----------CEVAKWSPWGLCSVDTCGQPGVKRRTRYIRVKPANQ 294          
BLAST of Spondin-1 vs. Ensembl Sea Lamprey
Match: spon2a (spondin 2a, extracellular matrix protein [Source:ZFIN;Acc:ZDB-GENE-990415-160])

HSP 1 Score: 57.3806 bits (137), Expect = 6.837e-10
Identity = 26/68 (38.24%), Postives = 37/68 (54.41%), Query Frame = 1
Query: 1375 RPDS-QLESLKLDKVDCQVSEWSLWRPCSKSCGWGTQYKKRVIQKDSLNGGLPCPVLYESRKCFSKPC 1575
            R DS Q E      +DC+VS+W+ W  CS++CG G +   R + +   NGG PCP L+    C  + C
Sbjct:  118 RSDSGQREEAAGTPLDCEVSDWAAWGFCSRTCGIGVKRSTRFVIQTPANGGRPCPELHMEESCVDRAC 185          

HSP 2 Score: 48.9062 bits (115), Expect = 6.457e-7
Identity = 46/185 (24.86%), Postives = 72/185 (38.92%), Query Frame = 1
Query:  121 SMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETY-KPNNVTRLDEPDTIREINKIWMKSNPFTPDTPVAEITLTRVEPQKDTQCVKTPVKGVNEFQNAQKESRSNTLGR-NGAVEKYNVLDDPQLAQMAKAF-----CGFSEWTSWSPCSVKCGEGETSRTRNLIKNLKN 654
            S++  + PSPDW  GVS +DLC +   W   ++  L P D G  +G  +  PN  +   EP ++    +         P  P       R++          P  G  EF     +   +   R +  + K+  +      Q  +A      C  S+W +W  CS  CG G    TR +I+   N
Sbjct:    2 SIVVRLIPSPDWFVGVSSLDLCSNAGGWAPLVSHDLQPWDGGTDSGFAFSSPNYASEPQEPISLITAQR---------PSHPANSFYYPRLQ--------ALPRIGFLEF---HLQPADHAFQRPDDLICKHCQIVRSDSGQREEAAGTPLDCEVSDWAAWGFCSRTCGIGVKRSTRFVIQTPAN 166          
BLAST of Spondin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005043.1 (pep scaffold:Pmarinus_7.0:GL481015:31246:35903:1 gene:ENSPMAG00000004579.1 transcript:ENSPMAT00000005043.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.1434 bits (126), Expect = 3.222e-8
Identity = 39/133 (29.32%), Postives = 60/133 (45.11%), Query Frame = 1
Query:  982 RFFYHIKTGKCEPFKYYDCKKGNLNNFPTIDSCENVCSKVIQELPKIRRS--NLALLQARTSYSAEESLSQKAKNIPEFCFHEVDSSKTCMKSKPKTIWYYSHRNRKCQSLVDYDCKGTLNKFSTFDDCMKTC 1374
            R+F+++ +G CE F Y  C+ GNLNNF    SC   C      L   +RS         + +    ES S++   +P  C  + D  + C    P+  ++Y+ +   C+S     C G  N FS+   CM  C
Sbjct:   89 RYFFNMTSGSCEEFGYGGCQ-GNLNNFKDAASCYQHCVHRAVPLKIKKRSKQTNNNNNNKAARCNGESNSEQFV-LPRICLMKADPGE-CTAVIPR--FHYNPKTSNCESFTYGGCGGNDNNFSSERSCMSVC 216          
BLAST of Spondin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005038.1 (pep scaffold:Pmarinus_7.0:GL481015:31246:35903:1 gene:ENSPMAG00000004579.1 transcript:ENSPMAT00000005038.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.1434 bits (126), Expect = 3.781e-8
Identity = 39/133 (29.32%), Postives = 60/133 (45.11%), Query Frame = 1
Query:  982 RFFYHIKTGKCEPFKYYDCKKGNLNNFPTIDSCENVCSKVIQELPKIRRS--NLALLQARTSYSAEESLSQKAKNIPEFCFHEVDSSKTCMKSKPKTIWYYSHRNRKCQSLVDYDCKGTLNKFSTFDDCMKTC 1374
            R+F+++ +G CE F Y  C+ GNLNNF    SC   C      L   +RS         + +    ES S++   +P  C  + D  + C    P+  ++Y+ +   C+S     C G  N FS+   CM  C
Sbjct:   90 RYFFNMTSGSCEEFGYGGCQ-GNLNNFKDAASCYQHCVHRAVPLKIKKRSKQTNNNNNNKAARCNGESNSEQFV-LPRICLMKADPGE-CTAVIPR--FHYNPKTSNCESFTYGGCGGNDNNFSSERSCMSVC 217          
BLAST of Spondin-1 vs. Ensembl Sea Lamprey
Match: si:dkey-178e17.3 (si:dkey-178e17.3 [Source:ZFIN;Acc:ZDB-GENE-081104-335])

HSP 1 Score: 46.9802 bits (110), Expect = 2.343e-6
Identity = 20/53 (37.74%), Postives = 28/53 (52.83%), Query Frame = 1
Query: 1411 KVDCQVSEWSLWRPCSKSCGWGTQYKKRVIQKDSLNGGLPCPVLYESRKCFSK 1569
              DC V  W  W PCS +CG G++ + R +     NGG  CP L + + C+S 
Sbjct:    1 ATDCAVLGWGAWSPCSSACGVGSRERIRQVTVPPHNGGAKCPHLRQRQGCYSH 53          
BLAST of Spondin-1 vs. Ensembl Nematostella
Match: EDO49895 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RF43])

HSP 1 Score: 87.4261 bits (215), Expect = 9.741e-19
Identity = 78/249 (31.33%), Postives = 113/249 (45.38%), Query Frame = 1
Query:   76 ERSGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKSNPFTPDTPVAEITLTRVEPQKDTQCVKTPVKGVNEFQNAQKESRSNTLGRNGAVEKYNVLDDPQLAQMAKAFCGFSEWTSWSPCSVKCGEGETSRTRNLIKNLKNELCIQLPRKEQKNCAGARLECDLXXXXXXXXXXXXXXXXASCTTEGKMIRIRKFAR 822
            E S    V+ T +L SMIS M PSPDW  GV  ++LC   C WK   TI L P DAG   G T+K  N                       TP  P++ IT TR+               +  F + + E  + + G +   + +    +P   + A+  C  + W+ W+ CSV CG GE  R R++I+  +++        E + C  AR  C  +KKC + PWS+WS C  SC   G+ +R R+  R
Sbjct:   97 ESSAVFRVDSTRHLLSMISRMIPSPDWNVGVDRVNLCTTNCTWKHEETIDLIPWDAGTDDGITFKSPNARS--------------------TPKQPISRIT-TRLHDHPRASFYLNTNDQIRPFASLKLERLAVSGGCSN--DAHIAPKNPYPPKSARIDCQLTHWSKWTSCSVTCGVGEQIRGRDIIRVPEHDGIPCPNLYEHRPC--ARQRCSSTKKCEVTPWSAWSSCRGSCGV-GRKVRTRRIIR 319          

HSP 2 Score: 55.4546 bits (132), Expect = 2.527e-8
Identity = 25/58 (43.10%), Postives = 35/58 (60.34%), Query Frame = 1
Query: 1402 KLDKVDCQVSEWSLWRPCSKSCGWGTQYKKRVIQKDSLNGGLPCPVLYESRKCFSKPC 1575
            K  ++DCQ++ WS W  CS +CG G Q + R I +   + G+PCP LYE R C  + C
Sbjct:  228 KSARIDCQLTHWSKWTSCSVTCGVGEQIRGRDIIRVPEHDGIPCPNLYEHRPCARQRC 285          
BLAST of Spondin-1 vs. Ensembl Nematostella
Match: EDO47504 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLY4])

HSP 1 Score: 52.373 bits (124), Expect = 1.884e-7
Identity = 30/63 (47.62%), Postives = 36/63 (57.14%), Query Frame = 1
Query: 1393 ESLKLDKV-DCQVSEWSLWRPCSKSCGWGTQYK-KRVIQKDSLNGGLPCPVLYESRKCFSKPC 1575
            E  KL  V DC VS WS W PCS  CG G + + +RVI + S  GG  CP L + R CF + C
Sbjct:   83 EECKLQGVQDCVVSTWSRWSPCSHRCGVGMRKRSRRVIVRPSQRGGKECPPLRQKRGCFLEHC 145          
BLAST of Spondin-1 vs. Ensembl Medaka
Match: spon1b (spondin-1 [Source:NCBI gene;Acc:101161803])

HSP 1 Score: 89.7373 bits (221), Expect = 2.678e-18
Identity = 69/255 (27.06%), Postives = 104/255 (40.78%), Query Frame = 1
Query:   67 LNEERSGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKSNPF-----TPDTPVAEITLTRVEPQKDTQCVKTP------VKGVNEFQNAQKESRSNTL-----------------GRN----------------GAVEKYNVLDDPQLAQMAKAFCGFSEWTSWSPCSVKCGEGETSRTRNLIKNLKNELCIQLPRKEQKNCA 699
            L    S   SV+R  +L S ++M+GPSPDW  G+SG DLC   C W   L   L P DAG  +G TY+  N   + + D IR +       +PF      P +P+A + + R+  +K  QC   P      V  + + +  + ++    +                 GR                    + +     P  +    + C  SEW SWS CSV CG G  SR R + +  ++    QL  +E + C 
Sbjct:  289 LRAAPSAEFSVDRARHLMSFLTMLGPSPDWNVGLSGEDLCTKDCGWIQRLVADLIPWDAGTDSGVTYESPNKPTIPQ-DKIRPLTSFDHPQSPFYDPQGGPISPLARVVVERIA-RKGEQCNVVPDNIDDIVADIGQEEKEEDDTPETCIYSAWSPWSACSSATCDKGRRMRQRMLKAQLDLSVPCPHTQDFQPCMAPGCSMEEPSTCMMSEWISWSACSVSCGMGMRSRERYVKQYPEDGSLCQLHTEETEKCV 541          

HSP 2 Score: 50.447 bits (119), Expect = 5.317e-6
Identity = 25/70 (35.71%), Postives = 41/70 (58.57%), Query Frame = 1
Query: 1372 CRPDSQLESLKLDK--VDCQVSEWSLWRPCSKSCGWGTQYKKRVIQKDSLNGGLPCPVLYESRKCFSKPC 1575
            CR +++ +  +L +  +DC VSEWS W  C+KSCG G   + R+++ +   GG  CP   + +KC  + C
Sbjct:  640 CREETEQKECRLPECSIDCMVSEWSEWSECNKSCGKGHTIRTRMVKLEPQFGGRACPETIQRKKCKLRKC 709          
BLAST of Spondin-1 vs. Ensembl Medaka
Match: spon1a (spondin 1 [Source:NCBI gene;Acc:101161963])

HSP 1 Score: 85.8853 bits (211), Expect = 4.013e-17
Identity = 65/250 (26.00%), Postives = 106/250 (42.40%), Query Frame = 1
Query:   82 SGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKSNPF-TPD----TPVAEITLTRVEPQKDTQCVKTP------VKGVNEFQNAQKESRSNTLGRNGA---------------------------------VEKYNVLDDPQLAQMAKAFCGFSEWTSWSPCSVKCGEGETSRTRNLIKNLKNELCIQLPRKEQKNCA 699
            S   SV+R  +L S ++MMGPSPDW  G+S  +LC   C W   +   L P DAG  +G +Y+ +N   + + + IR +  +    +PF  P+    TPVA + + R+  +K  QC   P      V  + + +  + ++    +  N +                                  + +     P  +    + C  SEW +WSPCS+ CG G  SR R + +   +     LP +E +NC 
Sbjct:  300 SAEFSVDRIRHLMSFLTMMGPSPDWNVGLSAENLCTKECGWVQKVVQDLIPWDAGTDSGVSYESSNKPTVPQ-EKIRPLTSLDHPQSPFYDPEGGAITPVARVVVERIA-RKGEQCNIVPDNVDDIVADIAQEEKEEDDTPETCIYSNWSPWSACSSATCEKGKRMRQRMLKAQLDLSVPCPHTQDFEPCMGPGCSDEDGSTCMMSEWITWSPCSMSCGAGIRSRERYVKQFPDDGSICTLPTEETENCV 547          
BLAST of Spondin-1 vs. Ensembl Medaka
Match: spon2b (spondin 2 [Source:NCBI gene;Acc:101164320])

HSP 1 Score: 78.9518 bits (193), Expect = 1.538e-15
Identity = 64/211 (30.33%), Postives = 102/211 (48.34%), Query Frame = 1
Query:   49 LNGEEQLNEERSGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKSNP----FTPDT----PVAEITLTRVEPQKDTQCVKTPVKGVNEFQNAQKESRSNTLGRNGAVEKYNVLDDPQLAQMAKAFCGFSEWTSWSPCSVKCGE-GETSRTRNLIKNLKN 654
            + G  Q++ E   F      H+L S +  + PSPDW  GV  I+LC +G KWK ++T+ L+P DAG  +G T+   N   + + D I +I   +  S+P    F P      P+A++ LT++  +K  Q +  P+          + ++SN L     +E+  +++ P         C  S W+ W  C  KCGE G   RTR +I +  N
Sbjct:  135 VGGTGQMDTEFEVFAR----HSLMSFMVRIIPSPDWFVGVDSINLC-NGDKWKESVTLELFPYDAGTDSGFTFSSPNFETIPQ-DRITQITSSY-PSHPANSFFYPRLKHLPPIAKVKLTKI--KKTNQIISLPM----------EPTQSNLLPTGNEIEE-TLINTP-------LDCEVSVWSPWGLCKGKCGESGVQHRTRYVIMHPAN 318          

HSP 2 Score: 50.0618 bits (118), Expect = 3.768e-6
Identity = 25/62 (40.32%), Postives = 33/62 (53.23%), Query Frame = 1
Query: 1393 ESLKLDKVDCQVSEWSLWRPCSKSCG-WGTQYKKRVIQKDSLNGGLPCPVLYESRKCFSKPC 1575
            E+L    +DC+VS WS W  C   CG  G Q++ R +     N G+ CP+L E RKC    C
Sbjct:  276 ETLINTPLDCEVSVWSPWGLCKGKCGESGVQHRTRYVIMHPANNGVACPLLEEERKCIPDNC 337          
BLAST of Spondin-1 vs. Ensembl Medaka
Match: spon2a (spondin-2 [Source:NCBI gene;Acc:101163419])

HSP 1 Score: 55.0694 bits (131), Expect = 1.025e-7
Identity = 61/226 (26.99%), Postives = 96/226 (42.48%), Query Frame = 1
Query:   37 TSGWLNGEEQLNEERSGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETY-KPNNVTRLDEPDTIREINKIWMKSNPFTPDTPVAEITLTRVEPQKDTQCVKTPVKGVNEFQNAQKES-RSNTLGRNGAVEKYNVLDDPQLAQMAKAFCGFSEWTSWSPCSVKCGEGET-SRTRNLIKNLKN--ELCIQLPRKEQKNCA 699
            T+G  NG    + E    V +    +L S++  M PSPDW  GV+ ++LC +G  WK  +T+ L P DAG  +G T+  P   T    P+ I +I           P+ P       R+   K+   + + +K   + ++A +++  SN +  N           P+        C  S W+SW  C   C  G    RTR ++    N    C +L  +EQ  C 
Sbjct:  128 TAGIPNGIGHSSTE----VHMQPRSSLLSLMVKMIPSPDWFVGVNSLNLC-EGNHWKQEVTVNLQPYDAGTNSGFTFSSPKFPT--SPPENISKITSQ-------VPNHPANSFYYPRL---KELPAIAS-IKITRQHRSANRQTVLSNHILPNSI--------SPRRFSETPLDCEVSLWSSWGLCLGPCSRGGIRHRTRYILLRPANAGSPCPEL--EEQAECV 325          
BLAST of Spondin-1 vs. Ensembl Medaka
Match: si:dkey-178e17.3 (somatomedin-B and thrombospondin type-1 domain-containing protein [Source:NCBI gene;Acc:101155034])

HSP 1 Score: 48.521 bits (114), Expect = 6.958e-6
Identity = 19/55 (34.55%), Postives = 28/55 (50.91%), Query Frame = 1
Query: 1402 KLDKVDCQVSEWSLWRPCSKSCGWGTQYKKRVIQKDSLNGGLPCPVLYESRKCFS 1566
            ++  +DC V  W  W  C+  CG G+  + R +     NGG PCP L + R C+ 
Sbjct:   51 QISAIDCVVGSWGAWSLCTSKCGVGSTERSRQVSVPPRNGGAPCPDLRQRRGCYG 105          
BLAST of Spondin-1 vs. Planmine SMEST
Match: SMESG000009946.1 (SMESG000009946.1)

HSP 1 Score: 385.185 bits (988), Expect = 2.211e-124
Identity = 220/532 (41.35%), Postives = 305/532 (57.33%), Query Frame = 1
Query:   19 NVKSLFTSGWLNGEEQLNEERSGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKSNPFTPDTPVAEITLTRVEPQKDTQCVKTPVKGVNEF--QNAQKESRSNTLG-----RNGAVEKYNVLDDPQLAQMAKAFCGFSEWTSWSPCSVKCGEGETSRTRNLIKNLKNELCIQLPRKEQKNCAGARLECDLXXXXXXXXXXXXXXXXASCTTEGKMIRIRKFARSKEKDECMKNVKPEIILQQVKTCKLDKTDFRCDPISICSAGKLAPCINGKPKTRFFYHIKTGKCEPFKYYDCKKGNLNNFPTIDSCENVCSKVIQELPKIRRSNLALLQARTSYSAEESLSQKAKNIPEF---CFHEVD-SSKTCMKSK-PKTIWYYSHRNRKCQSLVDYDCKGTLNKFSTFDDCMKTCRPDSQLESLKLDKVD-CQVSEWSLWRPCSKSCGWGTQYKKRVIQKDSLNGGLPCPVLYESRKCFSKPC 1575
            ++KS F +  +  E+++ + RSGF+SVNRTH+ FS ++MMGPSPDWCTGV+ +D+CM+ C WK + T+ L+P DAGI+ G TY P N  R D PD IR IN  +M   PFT + PVA +   +++P+ + +C K   K V EF   N+ K   S   G     +   + K + LDDP LA MA   C  S W+ W+ CSV CG G   R+R+++KN K ELC  LP  E + C G +  CD S  CSLL WS W PC+A+C   G   R R FAR +EK++C+KN +    + + K CK D     CDP+ ICS G +     GKP  ++FY      C PF+Y  C KG+LNNFP+  SCE  C   +  LP+ R+  +A LQ ++     +S S K K +P     C  EV      C  +  P   +YY +RN +C+      C G  N F ++  C+K C PD Q++ +K   +  CQVSEWS W PCS +CG G ++K R + + +LNGG  CP L+ S  CF+  C
Sbjct:  262 HLKSYFNTSGMWNEDEIEQSRSGFISVNRTHHFFSFLTMMGPSPDWCTGVAAVDMCMNDCTWKDDFTMDLFPFDAGIKNGFTYFPENSDRQDIPDPIRTINTTYMTQFPFTANVPVARVIYQKIKPKHNWECTKMNAKQVKEFDEMNSNKNGNSQFDGSSLTKKRRHINKKSPLDDPTLANMATFLCITSPWSEWTKCSVTCGIGTEMRSRDMLKNAKTELCRHLPLLESRTCEGRKRSCDFSAPCSLLSWSRWGPCNATCEMHGYQQRSRMFARFEEKEKCLKNKERRFKIFEEKRCKKDTA--LCDPVIICSEGLIMGSSCGKPVMKYFYDAAKHSCVPFEYLGC-KGSLNNFPSKMSCEKTCLAAVNALPQWRKDKMAHLQFQS-----QSNSDKRKKMPTMANKCRLEVKYGGMNCDGTMGPDIRYYYDNRNGRCRQFKYTGCDGNSNNFRSYHSCIKACMPD-QIDFMKTAPIKACQVSEWSHWGPCSTTCGVGERFKWRSVLRPALNGGPACPELFLSEPCFATTC 784          
BLAST of Spondin-1 vs. Planmine SMEST
Match: SMESG000009946.1 (SMESG000009946.1)

HSP 1 Score: 385.571 bits (989), Expect = 2.515e-124
Identity = 221/533 (41.46%), Postives = 306/533 (57.41%), Query Frame = 1
Query:   19 NVKSLFTSGWLNGEEQLNEERSGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKSNPFTPDTPVAEITLTRVEPQKDTQCVKTPVKGVNEFQ--------NAQKESRSNTLGRNGAVEKYNVLDDPQLAQMAKAFCGFSEWTSWSPCSVKCGEGETSRTRNLIKNLKNELCIQLPRKEQKNCAGARLECDLXXXXXXXXXXXXXXXXASCTTEGKMIRIRKFARSKEKDECMKNVKPEIILQQVKTCKLDKTDFRCDPISICSAGKLAPCINGKPKTRFFYHIKTGKCEPFKYYDCKKGNLNNFPTIDSCENVCSKVIQELPKIRRSNLALLQARTSYSAEESLSQKAKNIPEF---CFHEVD-SSKTCMKSK-PKTIWYYSHRNRKCQSLVDYDCKGTLNKFSTFDDCMKTCRPDSQLESLKLDKVD-CQVSEWSLWRPCSKSCGWGTQYKKRVIQKDSLNGGLPCPVLYESRKCFSKPC 1575
            ++KS F +  +  E+++ + RSGF+SVNRTH+ FS ++MMGPSPDWCTGV+ +D+CM+ C WK + T+ L+P DAGI+ G TY P N  R D PD IR IN  +M   PFT + PVA +   +++P+ + +C K   K V EF         N+Q +  S T  R   + K + LDDP LA MA   C  S W+ W+ CSV CG G   R+R+++KN K ELC  LP  E + C G +  CD S  CSLL WS W PC+A+C   G   R R FAR +EK++C+KN +    + + K CK D     CDP+ ICS G +     GKP  ++FY      C PF+Y  C KG+LNNFP+  SCE  C   +  LP+ R+  +A LQ ++     +S S K K +P     C  EV      C  +  P   +YY +RN +C+      C G  N F ++  C+K C PD Q++ +K   +  CQVSEWS W PCS +CG G ++K R + + +LNGG  CP L+ S  CF+  C
Sbjct:  278 HLKSYFNTSGMWNEDEIEQSRSGFISVNRTHHFFSFLTMMGPSPDWCTGVAAVDMCMNDCTWKDDFTMDLFPFDAGIKNGFTYFPENSDRQDIPDPIRTINTTYMTQFPFTANVPVARVIYQKIKPKHNWECTKMNAKQVKEFDEMNSNKNGNSQFDGSSLTKKRR-HINKKSPLDDPTLANMATFLCITSPWSEWTKCSVTCGIGTEMRSRDMLKNAKTELCRHLPLLESRTCEGRKRSCDFSAPCSLLSWSRWGPCNATCEMHGYQQRSRMFARFEEKEKCLKNKERRFKIFEEKRCKKDTA--LCDPVIICSEGLIMGSSCGKPVMKYFYDAAKHSCVPFEYLGC-KGSLNNFPSKMSCEKTCLAAVNALPQWRKDKMAHLQFQS-----QSNSDKRKKMPTMANKCRLEVKYGGMNCDGTMGPDIRYYYDNRNGRCRQFKYTGCDGNSNNFRSYHSCIKACMPD-QIDFMKTAPIKACQVSEWSHWGPCSTTCGVGERFKWRSVLRPALNGGPACPELFLSEPCFATTC 800          
BLAST of Spondin-1 vs. Planmine SMEST
Match: SMESG000009946.1 (SMESG000009946.1)

HSP 1 Score: 385.185 bits (988), Expect = 4.790e-124
Identity = 220/532 (41.35%), Postives = 305/532 (57.33%), Query Frame = 1
Query:   19 NVKSLFTSGWLNGEEQLNEERSGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKSNPFTPDTPVAEITLTRVEPQKDTQCVKTPVKGVNEF--QNAQKESRSNTLG-----RNGAVEKYNVLDDPQLAQMAKAFCGFSEWTSWSPCSVKCGEGETSRTRNLIKNLKNELCIQLPRKEQKNCAGARLECDLXXXXXXXXXXXXXXXXASCTTEGKMIRIRKFARSKEKDECMKNVKPEIILQQVKTCKLDKTDFRCDPISICSAGKLAPCINGKPKTRFFYHIKTGKCEPFKYYDCKKGNLNNFPTIDSCENVCSKVIQELPKIRRSNLALLQARTSYSAEESLSQKAKNIPEF---CFHEVD-SSKTCMKSK-PKTIWYYSHRNRKCQSLVDYDCKGTLNKFSTFDDCMKTCRPDSQLESLKLDKVD-CQVSEWSLWRPCSKSCGWGTQYKKRVIQKDSLNGGLPCPVLYESRKCFSKPC 1575
            ++KS F +  +  E+++ + RSGF+SVNRTH+ FS ++MMGPSPDWCTGV+ +D+CM+ C WK + T+ L+P DAGI+ G TY P N  R D PD IR IN  +M   PFT + PVA +   +++P+ + +C K   K V EF   N+ K   S   G     +   + K + LDDP LA MA   C  S W+ W+ CSV CG G   R+R+++KN K ELC  LP  E + C G +  CD S  CSLL WS W PC+A+C   G   R R FAR +EK++C+KN +    + + K CK D     CDP+ ICS G +     GKP  ++FY      C PF+Y  C KG+LNNFP+  SCE  C   +  LP+ R+  +A LQ ++     +S S K K +P     C  EV      C  +  P   +YY +RN +C+      C G  N F ++  C+K C PD Q++ +K   +  CQVSEWS W PCS +CG G ++K R + + +LNGG  CP L+ S  CF+  C
Sbjct:  285 HLKSYFNTSGMWNEDEIEQSRSGFISVNRTHHFFSFLTMMGPSPDWCTGVAAVDMCMNDCTWKDDFTMDLFPFDAGIKNGFTYFPENSDRQDIPDPIRTINTTYMTQFPFTANVPVARVIYQKIKPKHNWECTKMNAKQVKEFDEMNSNKNGNSQFDGSSLTKKRRHINKKSPLDDPTLANMATFLCITSPWSEWTKCSVTCGIGTEMRSRDMLKNAKTELCRHLPLLESRTCEGRKRSCDFSAPCSLLSWSRWGPCNATCEMHGYQQRSRMFARFEEKEKCLKNKERRFKIFEEKRCKKDTA--LCDPVIICSEGLIMGSSCGKPVMKYFYDAAKHSCVPFEYLGC-KGSLNNFPSKMSCEKTCLAAVNALPQWRKDKMAHLQFQS-----QSNSDKRKKMPTMANKCRLEVKYGGMNCDGTMGPDIRYYYDNRNGRCRQFKYTGCDGNSNNFRSYHSCIKACMPD-QIDFMKTAPIKACQVSEWSHWGPCSTTCGVGERFKWRSVLRPALNGGPACPELFLSEPCFATTC 807          
BLAST of Spondin-1 vs. Planmine SMEST
Match: SMESG000039905.1 (SMESG000039905.1)

HSP 1 Score: 152.525 bits (384), Expect = 1.213e-38
Identity = 148/521 (28.41%), Postives = 219/521 (42.03%), Query Frame = 1
Query:   76 ERSGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKSNPFT------PDTPVAEITLTRVEPQKDTQCVKTPVKGVNEFQNAQKESRSNTLGRNGAVEKYNVLDDPQLAQMAKAFCGFSEWTSWSPCSVKCGEGETSRTRNLIKNLKNELCIQLPRKEQKNCAGARLECDLXXXXXXXXXXXXXXXXASCTTEGKMIRIRKFARSKEKDECMKNVKPEIILQQVKTCKLDKTDFRCDPISICSAGKLA--PCINGKPKTRFFYHIKTGKCEPFKYYDCKKGNLNNFPTIDSCENVCSKVIQELPKIRRSNLALLQARTSYSAEESLSQKAKNIPEFCFHEVDSSKTCMKSKPKTIWYYSHRNRKCQSLVDYDCKGTLNKFSTFDDCMKTCRPDSQL--------ESLKLDKVDCQVSEWSLWRPCSKSCGWGTQYKKRVIQKDSLNGGLPCP-VLYESRKCFSKPC*SVN 1587
            +RS  + VN T +L S ++ + PSPDWCTG+S  DLC   CKW+    + LYP DAG+ +GETY   N      P  I  I   W K NPFT       +  V    L +   + D Q   + +  + + +  Q E +S+ L  N    ++ +L +                         CG+GE +R R L+K  K+E CI+      ++C+         + CS   W  WSPC+A+C+ +G + R R F   +EK ECM+  + +  L+    C L     RC P  IC         C    P  RF+Y   +G C  F Y  C  G LNNF T + C  +C       PK++ ++        +Y             P  C   +     C    P   WYY + N++C       C+G  N F T  +C   C  +           + + + KV C  S WS W  C  +C       + +I+K+       C   + E+RKC S+ C S N
Sbjct:  308 KRSALIVVNATQHLVSFLARLHPSPDWCTGLSRFDLCNGSCKWQEKFIVHLYPWDAGVYSGETYLNKNEKTRQTP--ICPITSSWPKDNPFTVMNGKIKNIGVVTFQLIQEYNKNDNQYCNS-INSILQDEAYQNEPKSSALKSNPDKTRHCLLSEWSEWSSCSE---------------SCGKGEKTRYRKLLKG-KSEQCIESSLTNTESCSSKCSTAISFETCSFRLWGQWSPCNATCSQKGIIHRERVFINEQEKHECMQYSEMKASLE----CALASE--RCKPDVICKEYVYPGDSCSWSSPSQRFYYDFSSGTCNAFIYKGC-YGGLNNFHTYEECILLCR------PKLKETDQRRFNTPETY-------------PNRCGVSMTWGIFCDSQSPSNRWYYDNINKECYRFRFGGCRGNANNFRTKTECQNVCLREKSTSTTTTTISQPVTVRKV-CIYSNWSDWSSCDDNCQNQQTRIRFLIEKND-----DCTESISETRKCQSEKCNSPN 777          
BLAST of Spondin-1 vs. Planmine SMEST
Match: SMESG000076582.1 (SMESG000076582.1)

HSP 1 Score: 52.7582 bits (125), Expect = 8.155e-7
Identity = 22/54 (40.74%), Postives = 36/54 (66.67%), Query Frame = 1
Query: 1414 VDCQVSEWSLWRPCSKSCGWGTQYKKRVIQKDSLNGGLPCPVLYESRKCFSKPC 1575
            +DC+VSEW+ W  CSK+CG G   + R+I K ++  G     L+E+++C++ PC
Sbjct: 5605 IDCEVSEWTSWSSCSKTCGVGRYTRTRIIVKAAMFNGNCEDPLFETQQCYNGPC 5658          
The following BLAST results are available for this feature:
BLAST of Spondin-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SPON11.571e-1626.51spondin 1 [Source:HGNC Symbol;Acc:HGNC:11252][more]
SPON27.885e-1530.65spondin 2 [Source:HGNC Symbol;Acc:HGNC:11253][more]
SPON27.885e-1530.65spondin 2 [Source:HGNC Symbol;Acc:HGNC:11253][more]
SPON27.885e-1530.65spondin 2 [Source:HGNC Symbol;Acc:HGNC:11253][more]
TFPI4.619e-726.43tissue factor pathway inhibitor [Source:HGNC Symbo... [more]
back to top
BLAST of Spondin-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
spon-12.486e-2428.82SPONdin (Extracellular matrix glycoprotein) family... [more]
E01G6.14.243e-1130.57pep chromosome:WBcel235:X:12260881:12266537:1 gene... [more]
K10D3.48.067e-927.74pep chromosome:WBcel235:I:7134738:7139973:-1 gene:... [more]
mlt-117.845e-729.37pep chromosome:WBcel235:V:20667209:20678513:1 gene... [more]
mlt-118.210e-729.37pep chromosome:WBcel235:V:20667211:20678513:1 gene... [more]
back to top
BLAST of Spondin-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fat-spondin1.004e-1932.02gene:FBgn0026721 transcript:FBtr0086975[more]
CG300461.543e-1928.20gene:FBgn0050046 transcript:FBtr0087895[more]
CG300461.543e-1928.20gene:FBgn0050046 transcript:FBtr0339627[more]
CG177399.681e-1928.51gene:FBgn0033710 transcript:FBtr0087893[more]
CG302039.548e-1624.02gene:FBgn0050203 transcript:FBtr0273303[more]
back to top
BLAST of Spondin-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
spon1b1.177e-1928.69spondin 1b [Source:ZFIN;Acc:ZDB-GENE-000427-10][more]
spon1b1.358e-1928.69spondin 1b [Source:ZFIN;Acc:ZDB-GENE-000427-10][more]
spon1b1.398e-1928.69spondin 1b [Source:ZFIN;Acc:ZDB-GENE-000427-10][more]
spon1b1.433e-1928.69spondin 1b [Source:ZFIN;Acc:ZDB-GENE-000427-10][more]
spon1a8.189e-1727.20spondin 1a [Source:ZFIN;Acc:ZDB-GENE-000427-9][more]
back to top
BLAST of Spondin-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
spon14.268e-1727.71spondin 1, extracellular matrix protein [Source:NC... [more]
spon14.293e-1727.71spondin 1, extracellular matrix protein [Source:NC... [more]
spon15.650e-1630.77spondin 1, extracellular matrix protein [Source:NC... [more]
spon16.330e-1630.77spondin 1, extracellular matrix protein [Source:NC... [more]
spon16.535e-1630.77spondin 1, extracellular matrix protein [Source:NC... [more]
back to top
BLAST of Spondin-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Spon15.470e-1727.71spondin 1, (f-spondin) extracellular matrix protei... [more]
Spon28.444e-1429.03spondin 2, extracellular matrix protein [Source:MG... [more]
Spint21.790e-926.67serine protease inhibitor, Kunitz type 2 [Source:M... [more]
Tfpi1.356e-628.03tissue factor pathway inhibitor [Source:MGI Symbol... [more]
Tfpi1.356e-628.03tissue factor pathway inhibitor [Source:MGI Symbol... [more]
back to top
BLAST of Spondin-1 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P35446|SPON1_RAT3.132e-1627.71Spondin-1 OS=Rattus norvegicus OX=10116 GN=Spon1 P... [more]
sp|Q8VCC9|SPON1_MOUSE3.826e-1627.71Spondin-1 OS=Mus musculus OX=10090 GN=Spon1 PE=1 S... [more]
sp|Q9GLX9|SPON1_BOVIN5.811e-1626.51Spondin-1 OS=Bos taurus OX=9913 GN=SPON1 PE=1 SV=1[more]
sp|Q9HCB6|SPON1_HUMAN7.545e-1626.51Spondin-1 OS=Homo sapiens OX=9606 GN=SPON1 PE=1 SV... [more]
sp|Q9BUD6|SPON2_HUMAN2.875e-1430.65Spondin-2 OS=Homo sapiens OX=9606 GN=SPON2 PE=1 SV... [more]
back to top
BLAST of Spondin-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|157953921.163e-9336.85tr|A0A0R3SRQ7|A0A0R3SRQ7_HYMDI Uncharacterized pro... [more]
gnl|BL_ORD_ID|246599892.118e-9336.05tr|A0A5K3F8X7|A0A5K3F8X7_9CEST Uncharacterized pro... [more]
gnl|BL_ORD_ID|188021708.211e-9334.11tr|A0A0X3Q224|A0A0X3Q224_SCHSO Spondin-1 OS=Schist... [more]
gnl|BL_ORD_ID|246686078.610e-9335.87tr|A0A0R3U498|A0A0R3U498_9CEST Uncharacterized pro... [more]
gnl|BL_ORD_ID|187158204.459e-9234.11tr|A0A0X3PKV3|A0A0X3PKV3_SCHSO Uncharacterized pro... [more]
back to top
BLAST of Spondin-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
spon1b3.292e-1929.60spondin 1b [Source:ZFIN;Acc:ZDB-GENE-000427-10][more]
spon2b9.596e-1527.43spondin 2b, extracellular matrix protein [Source:Z... [more]
spon2a7.531e-1028.02spondin-2-like [Source:NCBI gene;Acc:103039648][more]
si:dkey-178e17.32.113e-845.10somatomedin-B and thrombospondin type-1 domain-con... [more]
thsd7ab1.591e-752.83thrombospondin, type I, domain containing 7Ab [Sou... [more]
back to top
BLAST of Spondin-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
spon2b1.627e-1028.96spondin 2b, extracellular matrix protein [Source:Z... [more]
spon2a6.837e-1038.24spondin 2a, extracellular matrix protein [Source:Z... [more]
ENSPMAT00000005043.13.222e-829.32pep scaffold:Pmarinus_7.0:GL481015:31246:35903:1 g... [more]
ENSPMAT00000005038.13.781e-829.32pep scaffold:Pmarinus_7.0:GL481015:31246:35903:1 g... [more]
si:dkey-178e17.32.343e-637.74si:dkey-178e17.3 [Source:ZFIN;Acc:ZDB-GENE-081104-... [more]
back to top
BLAST of Spondin-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spondin-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO498959.741e-1931.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO475041.884e-747.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Spondin-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
spon1b2.678e-1827.06spondin-1 [Source:NCBI gene;Acc:101161803][more]
spon1a4.013e-1726.00spondin 1 [Source:NCBI gene;Acc:101161963][more]
spon2b1.538e-1530.33spondin 2 [Source:NCBI gene;Acc:101164320][more]
spon2a1.025e-726.99spondin-2 [Source:NCBI gene;Acc:101163419][more]
si:dkey-178e17.36.958e-634.55somatomedin-B and thrombospondin type-1 domain-con... [more]
back to top
BLAST of Spondin-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000009946.12.211e-12441.35SMESG000009946.1[more]
SMESG000009946.12.515e-12441.46SMESG000009946.1[more]
SMESG000009946.14.790e-12441.35SMESG000009946.1[more]
SMESG000039905.11.213e-3828.41SMESG000039905.1[more]
SMESG000076582.18.155e-740.74SMESG000076582.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032088 ID=SMED30032088|Name=Spondin-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1776bp
TTACCTGAAAATAGATTAAATGTTAAGAGTCTCTTTACGTCAGGCTGGTT
AAATGGGGAAGAACAGCTAAATGAAGAGCGTTCTGGATTCGTTTCTGTTA
ATAGAACTCATAATTTATTTAGTATGATTTCAATGATGGGACCAAGTCCG
GATTGGTGTACCGGAGTGTCAGGAATCGATCTTTGTATGGACGGATGCAA
ATGGAAATCAAATCTAACAATTCCTCTTTATCCTATCGACGCTGGAATAC
AAACTGGAGAGACCTACAAACCAAATAATGTCACAAGACTTGATGAACCC
GACACTATTAGAGAAATTAATAAAATTTGGATGAAAAGTAATCCTTTTAC
TCCAGATACTCCAGTAGCAGAAATCACCCTCACCAGAGTAGAGCCACAGA
AAGACACACAATGTGTTAAAACTCCAGTTAAGGGTGTAAATGAATTTCAA
AATGCACAAAAAGAGTCTAGATCTAACACGCTCGGTAGAAATGGTGCCGT
GGAAAAATATAATGTTCTAGATGATCCTCAGTTAGCTCAAATGGCAAAAG
CCTTTTGTGGATTTTCCGAATGGACCAGCTGGTCACCATGTTCCGTAAAA
TGTGGAGAAGGTGAAACGTCTCGTACTAGAAATTTGATAAAAAACTTGAA
AAATGAATTGTGTATTCAATTGCCAAGAAAGGAGCAAAAAAATTGTGCCG
GTGCTCGATTGGAATGTGATCTCTCAAAGAAATGTAGTCTATTACCTTGG
AGCTCATGGAGTCCGTGTTCTGCATCTTGTACAACTGAAGGGAAAATGAT
CAGAATTAGAAAATTTGCGAGGTCAAAAGAAAAGGACGAATGCATGAAAA
ACGTCAAACCAGAAATTATTCTTCAACAAGTGAAAACTTGTAAATTGGAT
AAAACGGACTTCCGATGTGATCCGATATCAATTTGCAGCGCCGGTAAATT
GGCACCTTGCATCAATGGTAAACCCAAGACGAGATTTTTCTACCACATCA
AAACTGGAAAATGCGAACCGTTTAAATACTATGATTGCAAAAAAGGAAAT
CTGAACAATTTCCCAACTATAGATTCATGTGAAAATGTTTGCTCTAAAGT
TATTCAGGAATTACCAAAAATAAGACGATCTAATTTAGCCTTGCTTCAAG
CAAGAACATCTTATTCAGCTGAAGAGAGTCTTTCGCAAAAAGCCAAAAAC
ATTCCGGAATTCTGCTTTCATGAAGTGGATTCCAGTAAGACCTGCATGAA
ATCCAAACCAAAGACAATCTGGTATTATAGTCATCGAAATCGAAAATGCC
AATCACTGGTGGATTATGATTGTAAAGGAACTTTAAATAAGTTTTCGACT
TTCGACGATTGCATGAAAACCTGCCGACCTGATTCACAACTCGAATCATT
GAAACTTGATAAAGTAGATTGTCAGGTCTCTGAATGGAGTTTATGGAGGC
CATGTTCAAAGTCATGCGGTTGGGGAACTCAATACAAGAAAAGAGTCATT
CAAAAGGATTCATTGAATGGGGGCTTACCATGTCCGGTGCTATATGAATC
TCGAAAATGCTTTTCCAAACCTTGTTAATCTGTCAATATTTATTTAAAAA
TTGTTTTTTGTGAATTATAATTTCTATTTCTTAATCTATTTGAAAATGTA
ATAAATATTACTTTGCGTATTTGATTTAGTTTAAAGTTTTCTCATTGGTC
AATCCGCCGTTGCTAACCAATGAGATCGGCTACTACATCAATTGCGATAA
TTGACAGTGGTGAGCAAACCTTTAAG
back to top

protein sequence of SMED30032088-orf-1

>SMED30032088-orf-1 ID=SMED30032088-orf-1|Name=SMED30032088-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=526bp
LPENRLNVKSLFTSGWLNGEEQLNEERSGFVSVNRTHNLFSMISMMGPSP
DWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEP
DTIREINKIWMKSNPFTPDTPVAEITLTRVEPQKDTQCVKTPVKGVNEFQ
NAQKESRSNTLGRNGAVEKYNVLDDPQLAQMAKAFCGFSEWTSWSPCSVK
CGEGETSRTRNLIKNLKNELCIQLPRKEQKNCAGARLECDLSKKCSLLPW
SSWSPCSASCTTEGKMIRIRKFARSKEKDECMKNVKPEIILQQVKTCKLD
KTDFRCDPISICSAGKLAPCINGKPKTRFFYHIKTGKCEPFKYYDCKKGN
LNNFPTIDSCENVCSKVIQELPKIRRSNLALLQARTSYSAEESLSQKAKN
IPEFCFHEVDSSKTCMKSKPKTIWYYSHRNRKCQSLVDYDCKGTLNKFST
FDDCMKTCRPDSQLESLKLDKVDCQVSEWSLWRPCSKSCGWGTQYKKRVI
QKDSLNGGLPCPVLYESRKCFSKPC*
back to top
Aliases
The feature 'Spondin-1' has the following synonyms
Synonym
spondin1-like
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000211primitive ectoderm cell
PLANA:0004517blastomere
PLANA:0000029primitive ectoderm
Vocabulary: INTERPRO
TermDefinition
IPR038678Spondin_N_sf
IPR036383TSP1_rpt_sf
IPR036880Kunitz_BPTI_sf
IPR000884TSP1_rpt
IPR002223Kunitz_BPTI
IPR009465Spondin_N
Vocabulary: molecular function
TermDefinition
GO:0004867serine-type endopeptidase inhibitor activity
Vocabulary: biological process
TermDefinition
GO:0010951negative regulation of endopeptidase activity
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000003Stage 3
PLANA:0000002Stage 2
PLANA:0000004Stage 4
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002223Pancreatic trypsin inhibitor Kunitz domainSMARTSM00131KU_2coord: 403..459
e-value: 1.1E-6
score: 38.2
coord: 310..365
e-value: 6.7E-8
score: 42.2
IPR002223Pancreatic trypsin inhibitor Kunitz domainPFAMPF00014Kunitz_BPTIcoord: 320..364
e-value: 3.5E-10
score: 39.9
coord: 405..459
e-value: 1.5E-7
score: 31.5
IPR002223Pancreatic trypsin inhibitor Kunitz domainPROSITEPS50279BPTI_KUNITZ_2coord: 313..364
score: 11.742
IPR002223Pancreatic trypsin inhibitor Kunitz domainPROSITEPS50279BPTI_KUNITZ_2coord: 405..458
score: 10.517
IPR002223Pancreatic trypsin inhibitor Kunitz domainCDDcd00109KUcoord: 327..364
e-value: 1.71104E-9
score: 51.4818
IPR000884Thrombospondin type-1 (TSP1) repeatSMARTSM00209TSP1_2coord: 476..524
e-value: 6.2E-6
score: 35.7
coord: 247..303
e-value: 0.015
score: 24.5
coord: 188..240
e-value: 3.6E-8
score: 43.1
IPR000884Thrombospondin type-1 (TSP1) repeatPFAMPF00090TSP_1coord: 477..525
e-value: 1.9E-7
score: 31.2
coord: 249..300
e-value: 1.1E-6
score: 28.7
coord: 189..221
e-value: 8.9E-6
score: 25.8
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 185..240
score: 10.101
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 473..524
score: 9.869
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 244..301
score: 8.365
IPR009465Spondin, N-terminalPFAMPF06468Spond_Ncoord: 21..109
e-value: 3.1E-23
score: 82.9
IPR009465Spondin, N-terminalPROSITEPS51020SPONDINcoord: 1..118
score: 26.209
IPR038678Spondin, N-terminal domain superfamilyGENE3DG3DSA:2.60.40.2130coord: 3..116
e-value: 2.0E-25
score: 91.8
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilyGENE3DG3DSA:2.20.100.10coord: 183..239
e-value: 1.3E-9
score: 40.1
coord: 242..302
e-value: 3.5E-7
score: 32.3
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilyGENE3DG3DSA:2.20.100.10coord: 471..520
e-value: 4.2E-14
score: 54.6
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILYSSF82895TSP-1 type 1 repeatcoord: 244..283
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILYSSF82895TSP-1 type 1 repeatcoord: 186..232
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILYSSF82895TSP-1 type 1 repeatcoord: 472..521
IPR036880Pancreatic trypsin inhibitor Kunitz domain superfamilyGENE3DG3DSA:4.10.410.10coord: 383..460
e-value: 7.9E-10
score: 40.5
IPR036880Pancreatic trypsin inhibitor Kunitz domain superfamilyGENE3DG3DSA:4.10.410.10coord: 307..368
e-value: 2.4E-11
score: 45.4
IPR036880Pancreatic trypsin inhibitor Kunitz domain superfamilySUPERFAMILYSSF57362BPTI-likecoord: 321..368
IPR036880Pancreatic trypsin inhibitor Kunitz domain superfamilySUPERFAMILYSSF57362BPTI-likecoord: 400..460
NoneNo IPR availablePANTHERPTHR11311:SF23FAT-SPONDINcoord: 23..95
coord: 402..525
NoneNo IPR availablePANTHERPTHR11311F-SPONDINcoord: 182..373
NoneNo IPR availablePANTHERPTHR11311F-SPONDINcoord: 23..95
coord: 402..525
NoneNo IPR availablePANTHERPTHR11311:SF23FAT-SPONDINcoord: 182..373