Spondin-1

Overview
NameSpondin-1
Smed IDSMED30032088
Uniprot Best hitSpondin-1 OS=Rattus norvegicus GN=Spon1 PE=1 SV=1 (E=3.09003e-16)
Length (bp)1776
Neoblast Clusters

Zeng et. al., 2018


 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017


Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

Download CSV of Expression Data

 

back to top

Expression Details

Spondin-1 ( spondin1-like ) is expressed during Stage 2, Stage 3 and Stage 4 in the primitive ectoderm, primitive ectoderm cell, blastomere compartment and blastomere

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm
Homology
BLAST of Spondin-1 vs. Ensembl Human
Match: SPON1 (spondin 1 [Source:HGNC Symbol;Acc:HGNC:11252])

HSP 1 Score: 85.1149 bits (209), Expect = 1.446e-16
Identity = 66/249 (26.51%), Postives = 104/249 (41.77%), Query Frame = 1
Query:   82 SGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKSNPF-TPD----TPVAEITLTRVEPQKDTQCVKTP------VKGVNEFQNAQKESRSNTLGRNGA---------------------------------VEKYNVLDDPQLAQMAKAFCGFSEWTSWSPCSVKCGEGETSRTRNLIKNLKNELCIQLPRKEQKNC 696
            S   SV+RT +L S ++MMGPSPDW  G+S  DLC   C W   +   L P DAG  +G TY+  N   + + + IR +  +    +PF  P+    T VA + + R+  +K  QC   P      V  +   +  + ++    +  N +                                  + +     P  +    + C  SEW +WSPCS+ CG G  SR R + +  ++     LP +E + C
Sbjct:  302 SAEFSVDRTRHLMSFLTMMGPSPDWNVGLSAEDLCTKECGWVQKVVQDLIPWDAGTDSGVTYESPNKPTIPQ-EKIRPLTSLDHPQSPFYDPEGGSITQVARVVIERIA-RKGEQCNIVPDNVDDIVADLAPEEKDEDDTPETCIYSNWSPWSACSSSTCDKGKRMRQRMLKAQLDLSVPCPDTQDFQPCMGPGCSDEDGSTCTMSEWITWSPCSISCGMGMRSRERYVKQFPEDGSVCTLPTEETEKC 548          

HSP 2 Score: 53.9138 bits (128), Expect = 6.440e-7
Identity = 23/54 (42.59%), Postives = 34/54 (62.96%), Query Frame = 1
Query: 1414 VDCQVSEWSLWRPCSKSCGWGTQYKKRVIQKDSLNGGLPCPVLYESRKCFSKPC 1575
            +DC+++EWS W  C+KSCG G   + R+IQ +   GG PCP   + +KC  + C
Sbjct:  667 IDCELTEWSQWSECNKSCGKGHVIRTRMIQMEPQFGGAPCPETVQRKKCRIRKC 720          
BLAST of Spondin-1 vs. Ensembl Human
Match: SPON2 (spondin 2 [Source:HGNC Symbol;Acc:HGNC:11253])

HSP 1 Score: 77.411 bits (189), Expect = 7.205e-15
Identity = 61/199 (30.65%), Postives = 85/199 (42.71%), Query Frame = 1
Query:   76 ERSGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKSNPFTPDT-----------PVAEITLTRVEPQKDTQCVKTPVKGVNEFQNAQKESRSNTLGRNGAVEKYNVLDDPQLAQMAKAFCGFSEWTSWSPCSVKCGE-GETSRTRNL 636
            + S  + V R H+L S +  + PSPDW  GV  +DLC DG +W+    + LYP DAG  +G T+   N   + + DT+ EI      S+P  P             P+A +TL R+           PV            SR N +  + +V +   LD           C  S W+SW  C   CG  G  SRTR +
Sbjct:  135 QTSAELEVQRRHSLVSFVVRIVPSPDWFVGVDSLDLC-DGDRWREQAALDLYPYDAGTDSGFTFSSPNFATIPQ-DTVTEIT----SSSPSHPANSFYYPRLKALPPIARVTLVRLRQSPRAFIPPAPV----------LPSRDNEIVDSASVPE-TPLD-----------CEVSLWSSWGLCGGHCGRLGTKSRTRYV 305          
BLAST of Spondin-1 vs. Ensembl Human
Match: SPON2 (spondin 2 [Source:HGNC Symbol;Acc:HGNC:11253])

HSP 1 Score: 77.411 bits (189), Expect = 7.205e-15
Identity = 61/199 (30.65%), Postives = 85/199 (42.71%), Query Frame = 1
Query:   76 ERSGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKSNPFTPDT-----------PVAEITLTRVEPQKDTQCVKTPVKGVNEFQNAQKESRSNTLGRNGAVEKYNVLDDPQLAQMAKAFCGFSEWTSWSPCSVKCGE-GETSRTRNL 636
            + S  + V R H+L S +  + PSPDW  GV  +DLC DG +W+    + LYP DAG  +G T+   N   + + DT+ EI      S+P  P             P+A +TL R+           PV            SR N +  + +V +   LD           C  S W+SW  C   CG  G  SRTR +
Sbjct:  135 QTSAELEVQRRHSLVSFVVRIVPSPDWFVGVDSLDLC-DGDRWREQAALDLYPYDAGTDSGFTFSSPNFATIPQ-DTVTEIT----SSSPSHPANSFYYPRLKALPPIARVTLVRLRQSPRAFIPPAPV----------LPSRDNEIVDSASVPE-TPLD-----------CEVSLWSSWGLCGGHCGRLGTKSRTRYV 305          
BLAST of Spondin-1 vs. Ensembl Human
Match: SPON2 (spondin 2 [Source:HGNC Symbol;Acc:HGNC:11253])

HSP 1 Score: 77.411 bits (189), Expect = 7.205e-15
Identity = 61/199 (30.65%), Postives = 85/199 (42.71%), Query Frame = 1
Query:   76 ERSGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKSNPFTPDT-----------PVAEITLTRVEPQKDTQCVKTPVKGVNEFQNAQKESRSNTLGRNGAVEKYNVLDDPQLAQMAKAFCGFSEWTSWSPCSVKCGE-GETSRTRNL 636
            + S  + V R H+L S +  + PSPDW  GV  +DLC DG +W+    + LYP DAG  +G T+   N   + + DT+ EI      S+P  P             P+A +TL R+           PV            SR N +  + +V +   LD           C  S W+SW  C   CG  G  SRTR +
Sbjct:  135 QTSAELEVQRRHSLVSFVVRIVPSPDWFVGVDSLDLC-DGDRWREQAALDLYPYDAGTDSGFTFSSPNFATIPQ-DTVTEIT----SSSPSHPANSFYYPRLKALPPIARVTLVRLRQSPRAFIPPAPV----------LPSRDNEIVDSASVPE-TPLD-----------CEVSLWSSWGLCGGHCGRLGTKSRTRYV 305          
BLAST of Spondin-1 vs. Ensembl Human
Match: TFPI (tissue factor pathway inhibitor [Source:HGNC Symbol;Acc:HGNC:11760])

HSP 1 Score: 53.9138 bits (128), Expect = 3.460e-7
Identity = 37/140 (26.43%), Postives = 67/140 (47.86%), Query Frame = 1
Query:  979 TRFFYHIKTGKCEPFKYYDCKKGNLNNFPTIDSCENVCSKVIQELPKIRRSNLALLQARTSYSAEESLSQKAKNIPEFCFHEVDSSKTCMKSKPKTI-------WYYSHRNRKCQSLVDYDCKGTLNKFSTFDDCMKTCR 1377
            TR+FY+ +T +CE FKY  C  GN+NNF T++ C+N+C    ++ P   + +    Q     +   SL+ ++  +P     E      C+    + +       +YY+    KC+      C G  N F++  +C++ C+
Sbjct:  139 TRYFYNNQTKQCERFKYGGC-LGNMNNFETLEECKNIC----EDGPNGFQVDNYGTQLN---AVNNSLTPQSTKVPS--LFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACK 268          

HSP 2 Score: 51.2174 bits (121), Expect = 2.175e-6
Identity = 36/131 (27.48%), Postives = 64/131 (48.85%), Query Frame = 1
Query:  982 RFFYHIKTGKCEPFKYYDCKKGNLNNFPTIDSCENVCSKVIQELPKIRRSNLALLQARTSYSAEESLSQKAKNIPEFCFHEVDSSKTCMKSKPKTIWYYSHRNRKCQSLVDYDCKGTLNKFSTFDDCMKTC 1374
            RFF++I T +CE F Y  C+ GN N F +++ C+ +C++      +I ++ L                Q+ K  P+FCF E D     +     T ++Y+++ ++C+      C G +N F T ++C   C
Sbjct:   69 RFFFNIFTRQCEEFIYGGCE-GNQNRFESLEECKKMCTR--DNANRIIKTTL----------------QQEK--PDFCFLEEDPG---ICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNIC 175          
BLAST of Spondin-1 vs. Ensembl Celegans
Match: spon-1 (SPONdin (extracellular matrix glycoprotein) family [Source:RefSeq peptide;Acc:NP_495473])

HSP 1 Score: 108.227 bits (269), Expect = 2.445e-24
Identity = 115/399 (28.82%), Postives = 169/399 (42.36%), Query Frame = 1
Query:   79 RSGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETY-KPNNVTRLDEPDTIREINKIWMKSNPFTP------DT-PVAEITLTRVEPQKDTQC-----VKTPVKGV-NEFQNAQKESR--------------SNTLGRNGAVEKYNVLDDPQLAQM----------------------AKAF---CGFSEWTSWSPCSVKCGEGETSRTRNLI--KNLKNELCIQLPRKEQKNCAGARL-ECDLXXXXXXXXXXXXXXX--XASCTTEGKMIRIRKFARSKEKDECMKNVKPEIILQQVKTCKLD--KTDFRCDPISICSAGKLA-PCINGKPKTRFFYHIKTGKCEPFKYYDCKKGNLNNFPTIDSCENVC 1092
            +S FV VN+ H+  S+ +M GPSPDWC G+S ++LC+  C W    T  L P DAG  +G TY  PN  T   EP     I+ I  K NP +P      DT P     + R +    ++C     +K     + N  ++ + + R              S T G+ G   +  V   P  AQ+                      ++AF   C  S W SW  CSV+CG G  SR R  +       +  + L RK+   C G    +C+++        +       SASC  EG  +R R F  S+ +  CM      + LQ+  TC +   +     +   IC   K A  C    P  R++Y+ +  +CE F +  C KGN N F T + C+ +C
Sbjct:  292 KSQFV-VNKYHHFVSLATMFGPSPDWCVGLSSVNLCLPDCTWAEERTFELQPFDAGTDSGPTYMSPNEPTEPREP-----IHWITTKLNPLSPFYNSKSDTIPTLAKVILRRKNVTSSECKSDDILKAEAHNITNTSEDEEYKDRRECMMTQWEPWSLCSATCGK-GIRIRSRVYVFPIKAQVFHCHRQTTEKQFCNAKINECENSEAFSSKCQVSSWGSWGECSVQCGHGMRSRNRTFLNPATKSGDCSVDLERKDI--CVGENGDDCNVTPDPLCKTTAWSDWSPCSASC-DEGVRVRTRLFFYSEHEKRCM-----HVNLQEKDTCVMQSCRRFIEINSEEICQEDKQAGQCAGNFP--RYWYNHEKTQCERFIFTGC-KGNRNQFETEEECKQIC 672          

HSP 2 Score: 65.855 bits (159), Expect = 5.681e-11
Identity = 50/190 (26.32%), Postives = 84/190 (44.21%), Query Frame = 1
Query: 1090 CSKVIQELPKIRRSNLALLQARTSYSAEESLSQKAKNIPEFC--FHEVDSSKTCMKSKPKTI-------WYYSHRNRKCQSLVDYDCKGTLNKFSTFDDCMKTCRPDSQ-----------LESLK-------LDKVDCQVSEWSLWRPCSKSCGWGTQYKKRVIQKDSLNGGLPCP-VLYESRKCFSKPC 1575
            CS    E  ++R + L             +L +K   + + C  F E++S + C + K           ++Y+H   +C+  +   CKG  N+F T ++C + C P  +           LE           ++VDC+VS+W+ W  CS SCG G + + R + K + NGG  C   L +  +C  +PC
Sbjct:  570 CSASCDEGVRVR-TRLFFYSEHEKRCMHVNLQEKDTCVMQSCRRFIEINSEEICQEDKQAGQCAGNFPRYWYNHEKTQCERFIFTGCKGNRNQFETEEECKQICLPGYEKSKSLIPNNQLLEDFGNTEVDDGGERVDCEVSKWTAWGSCSVSCGRGKKSRSRHVVKLARNGGHQCSEHLMQELQCRLRPC 758          
BLAST of Spondin-1 vs. Ensembl Celegans
Match: E01G6.1 (pep:known chromosome:WBcel235:X:12260884:12266557:1 gene:WBGene00008449 transcript:E01G6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:E01G6.1)

HSP 1 Score: 66.6254 bits (161), Expect = 3.874e-11
Identity = 48/157 (30.57%), Postives = 69/157 (43.95%), Query Frame = 1
Query:  937 SAGKLAPCIN-GKPKTRFFYHIKTGKCEPFKYYDCKKGNLNNFPTIDSCENVC----SKVIQELPKIRRSNLALLQAR------TSYSAEESLSQKAKNIPEFCFHEVDSSKTCMKSKPKTIWYYSHRNRKCQSLVDYDCKGTLNKFSTFDDCMKTC 1374
            SAG   PC   G    RF+++  T KC+PF YY C  GN NNF T+D C+N C          L  ++  N  L +          Y   +S S    +    C   +     C  S  +++W+Y    +KC   V   C GT N+F+T   C ++C
Sbjct:  443 SAG--TPCFGRGLTIQRFYFNPSTQKCQPFHYYGCS-GNGNNFETVDQCQNFCLHSADSACDGLVPLKNPNSELQRCSEEDPCPAGYECNDS-SYCCPSSENACNANMSRGNGCKGSTQRSMWFYDKSKKKCSQFVYNGCGGTPNRFTTKVACTESC 595          
BLAST of Spondin-1 vs. Ensembl Celegans
Match: K10D3.4 (pep:known chromosome:WBcel235:I:7134743:7139973:-1 gene:WBGene00010738 transcript:K10D3.4 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:K10D3.4)

HSP 1 Score: 58.9214 bits (141), Expect = 7.365e-9
Identity = 43/155 (27.74%), Postives = 61/155 (39.35%), Query Frame = 1
Query:  967 GKPKTRFFYHIKTGKCEPFKYYDCKKGNLNNFPTIDSCENVCSKVIQELPKIRRSNLALLQARTSYSAEESLSQKAKNIPEFCFHEVDSSKTC----------MKSKPK-----TIWYYSHRNRKCQSLVDYDCKGTLNKFSTFDDCMKTCRPDS 1386
            G    R++++ KTG CE F Y  C+ GN NNF T   C++ C     E   I+ + L             S +        +C+++  +   C           KS        T WYY    R CQ+     C G  N F+T  DC   CR +S
Sbjct:  421 GTYSNRWWFNAKTGNCEEFIYSGCQ-GNANNFETYKECQDYCRDARSEPQCIQGTALTDSNGNFIICGGSSAASTTCPANHYCYYDGTTYGCCPTQAYTCSLSYKSGASCGPAVTRWYYDSTTRTCQTYSFNGCDGNSNNFATQQDCKDYCRVES 574          
BLAST of Spondin-1 vs. Ensembl Celegans
Match: mlt-11 (pep:known chromosome:WBcel235:V:20667234:20678540:1 gene:WBGene00012186 transcript:W01F3.3c gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mlt-11)

HSP 1 Score: 52.7582 bits (125), Expect = 7.162e-7
Identity = 42/143 (29.37%), Postives = 62/143 (43.36%), Query Frame = 1
Query:  958 CINGKPKTRFFYHIKTGKCEPFKYYDCKKGNLNNFPTIDSCENVC--SKVIQELPKIRRSNLALLQARTSYSAEESLSQKAKNIPEFCFHEVDSSKTCMKSKPKTIWYYSHRNRKCQSLVDYDCKGTLNKFSTFDDCMKTCRP 1380
            C N  P  R+F++ +TG+CE F Y  C  GN NNF   ++CE  C    VI          LA +  R S+  ++S S K  N+                      WY++ +N +C+  V     G  N+F T  +C + C P
Sbjct: 2057 CTNYTP--RWFFNSQTGQCEQFAYGSCG-GNENNFFDRNTCERKCMPHHVI----------LAQVPDRCSFD-KDSGSGKGYNV---------------------KWYFNMKNLRCEQFVFEGLGGNTNQFETLSECERICTP 2164          
BLAST of Spondin-1 vs. Ensembl Celegans
Match: mlt-11 (pep:known chromosome:WBcel235:V:20667211:20678540:1 gene:WBGene00012186 transcript:W01F3.3b gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mlt-11)

HSP 1 Score: 52.7582 bits (125), Expect = 7.496e-7
Identity = 42/143 (29.37%), Postives = 62/143 (43.36%), Query Frame = 1
Query:  958 CINGKPKTRFFYHIKTGKCEPFKYYDCKKGNLNNFPTIDSCENVC--SKVIQELPKIRRSNLALLQARTSYSAEESLSQKAKNIPEFCFHEVDSSKTCMKSKPKTIWYYSHRNRKCQSLVDYDCKGTLNKFSTFDDCMKTCRP 1380
            C N  P  R+F++ +TG+CE F Y  C  GN NNF   ++CE  C    VI          LA +  R S+  ++S S K  N+                      WY++ +N +C+  V     G  N+F T  +C + C P
Sbjct: 2186 CTNYTP--RWFFNSQTGQCEQFAYGSCG-GNENNFFDRNTCERKCMPHHVI----------LAQVPDRCSFD-KDSGSGKGYNV---------------------KWYFNMKNLRCEQFVFEGLGGNTNQFETLSECERICTP 2293          
BLAST of Spondin-1 vs. Ensembl Fly
Match: fat-spondin (fat-spondin [Source:FlyBase gene name;Acc:FBgn0026721])

HSP 1 Score: 93.9745 bits (232), Expect = 1.024e-19
Identity = 73/228 (32.02%), Postives = 111/228 (48.68%), Query Frame = 1
Query:   67 LNEERSGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETY-KPNNVTRLDEPDTIREINKIWMKS------NPFTPD-TPVAEITLTRVEPQKDTQCVKTPVKGVNEFQNAQKESRSNTLGRNGAVEKYNVLDDPQLAQMAKAFCGFSEWTSWSPCSVKCGEGETSRTRNLIKNL---KNELCIQLPRKEQKNCAGARLEC 717
            +N+  S    V+R H   S++SM GPSPDW  G+SG+DLC + C WK ++   L+P DAG  +G +Y  PN+ T+   P+ +  I  ++ +       NP + + TP+A++ L R E      C        +EF  A +                 V DD +  Q  +A C   ++++WSPCSV CG+G   R+R  +      +N+   QL  KE   C  A  EC
Sbjct:  281 VNQNTSSKFRVDRKHPKVSLVSMFGPSPDWVVGISGLDLCTEDCSWKESMDFDLFPWDAGTDSGISYMSPNSETQ--PPERMYRITTMYPEDPRAPFYNPKSREMTPLAKLYLRR-EKIVSRNCD-------DEFLQALQ---------------LEVSDDAE-EQDTRAECRVGDYSAWSPCSVSCGKGIRMRSRQYLYPAAADQNKCARQLVAKEM--CVAAIPEC 480          

HSP 2 Score: 69.3218 bits (168), Expect = 5.205e-12
Identity = 38/104 (36.54%), Postives = 54/104 (51.92%), Query Frame = 1
Query: 1270 WYYSHRNRKCQSLVDYDCKGTLNKFSTFDDCMKTCRPDSQLESLKLDKV-DCQVSEWSLWRPCSKSCGWGTQYKKRVIQKDSLNGGLPCP-VLYESRKCFSKPC 1575
            + Y  +N+ C S     C+G  N F T +DC+ TC       S ++D+   C +S+WS+W PCS SCG G    +R +  +  NGG PC   L +SR C    C
Sbjct:  660 YAYDPQNQHCYSFTYGGCRGNRNNFLTENDCLNTCNVLRSPYSSRVDQPRACVLSDWSVWSPCSVSCGVGVSESRRYVVTEPQNGGQPCSKRLVKSRSCAMPAC 763          

HSP 3 Score: 51.9878 bits (123), Expect = 1.287e-6
Identity = 62/225 (27.56%), Postives = 89/225 (39.56%), Query Frame = 1
Query:  454 AQKESRSNTLGRNGAVEKYNVLDDPQLAQMAKAFCGFSEWTSWSPCSVKCGEGETSRTRNLIKNLKNELCIQLPRKEQKNCAGARLEC-----DLXXXXXXXXXXXXXXXXASCTTEGKMIRIR--KFARSKEKDECMKNVKPEIILQQVKTCKLDKTDFRCD---PISIC-SAGKLAPCINGKPKTRFFYHIKTGKCEPFKYYDCKKGNLNNFPTIDSCENVCS 1095
            AQ + R +  G N A  +  V  + + A      C  S W+ WS CS  CG G T RTR  + +L  + C  +   E+  C   R +C     +L          S     +S    G  IR R        +K+ C + ++    L Q K C ++  D   +      IC  A    PC       R+ Y  +   C  F Y  C +GN NNF T + C N C+
Sbjct:  485 AQSKDRDDDEGENLANSQSLVGSNGEGA----GLCKTSPWSVWSECSASCGIGITMRTRTFVNHLGRKRCPHITIVEKNKC--MRPDCTYEQVELPDPQCPTSQWSDWSPCSSTCGRGVTIRTRLLLLENGPDKESCTQRME----LHQQKEC-VNPIDCHINAEQAKDICVQAPDPGPCRGT--YMRYAYDPQNQHCYSFTYGGC-RGNRNNFLTENDCLNTCN 695          
BLAST of Spondin-1 vs. Ensembl Fly
Match: CG30046 (pep:known chromosome:BDGP6:2R:12314117:12317219:1 gene:FBgn0050046 transcript:FBtr0087895 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CG30046)

HSP 1 Score: 93.5893 bits (231), Expect = 1.570e-19
Identity = 75/266 (28.20%), Postives = 112/266 (42.11%), Query Frame = 1
Query:   91 VSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKS--NPF-----TPDTPVAEITLTRV--------------EPQKDTQCVKTP-----------------------------VKGVNEFQNAQKESRSNTLGRNGAV---EKYNVLD-DP-----QLAQMAKAFCGFSEWTSWSPCSVKCGEGETSRTRNLIKNLKNELCIQLPR---KEQKNCAG 702
            V V+  H++ S  S + PSPDW  GV+G++LC+  C W     I LYP D G  +G TY  ++  ++  PD IR +   +     +PF     TP  P+A +T+ R               +P    +C   P                             V   NE Q  ++E +    G+N  +   E++  L+ DP     Q +Q  +A C  S W SWSPCSV CG+G   R R  +       C  + R   +E + C+G
Sbjct:  294 VRVDPIHHMVSFASKIEPSPDWIVGVTGLELCLRNCTWMEEKVINLYPWDVGTDSGPTYTSSDQPQV-PPDVIRRMRSDFPNDPRSPFYDISGTPMKPMAILTVKRQRIYERRCADEDSNNDPDVPRECFTHPWSSWSDCSSKCGVGMQYRRRVYKQPELARVYNCNEAQYEERECQGEMCGQNNLMREPEEFEDLEPDPRRIGYQPSQQRRAECELSSWGSWSPCSVTCGDGYEMRQRQYLNPQAEFDCQGVHRMELQETRKCSG 558          
BLAST of Spondin-1 vs. Ensembl Fly
Match: CG30046 (pep:known chromosome:BDGP6:2R:12314117:12317573:1 gene:FBgn0050046 transcript:FBtr0339627 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CG30046)

HSP 1 Score: 93.5893 bits (231), Expect = 1.570e-19
Identity = 75/266 (28.20%), Postives = 112/266 (42.11%), Query Frame = 1
Query:   91 VSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKS--NPF-----TPDTPVAEITLTRV--------------EPQKDTQCVKTP-----------------------------VKGVNEFQNAQKESRSNTLGRNGAV---EKYNVLD-DP-----QLAQMAKAFCGFSEWTSWSPCSVKCGEGETSRTRNLIKNLKNELCIQLPR---KEQKNCAG 702
            V V+  H++ S  S + PSPDW  GV+G++LC+  C W     I LYP D G  +G TY  ++  ++  PD IR +   +     +PF     TP  P+A +T+ R               +P    +C   P                             V   NE Q  ++E +    G+N  +   E++  L+ DP     Q +Q  +A C  S W SWSPCSV CG+G   R R  +       C  + R   +E + C+G
Sbjct:  294 VRVDPIHHMVSFASKIEPSPDWIVGVTGLELCLRNCTWMEEKVINLYPWDVGTDSGPTYTSSDQPQV-PPDVIRRMRSDFPNDPRSPFYDISGTPMKPMAILTVKRQRIYERRCADEDSNNDPDVPRECFTHPWSSWSDCSSKCGVGMQYRRRVYKQPELARVYNCNEAQYEERECQGEMCGQNNLMREPEEFEDLEPDPRRIGYQPSQQRRAECELSSWGSWSPCSVTCGDGYEMRQRQYLNPQAEFDCQGVHRMELQETRKCSG 558          
BLAST of Spondin-1 vs. Ensembl Fly
Match: CG17739 (pep:known chromosome:BDGP6:2R:12306528:12310412:1 gene:FBgn0033710 transcript:FBtr0087893 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CG17739)

HSP 1 Score: 91.2781 bits (225), Expect = 9.781e-19
Identity = 67/235 (28.51%), Postives = 103/235 (43.83%), Query Frame = 1
Query:   97 VNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKSN-PFTPDTPVAEITLTRVEP-------------------------------------QKDTQCVKTPVKGVNEFQNAQKESRS----------NTLGRN--GAVEKYNVLDDPQLAQMAKAF----CGFSEWTSWSPCSVKCGEGETSRTRNLI 639
            V+  H+L S++SM+ PSPDW  GVSG++LC+  C W  N    LYP DAG  +G +Y   +  ++  PD +R I     KSN P  P +P  + T  +++P                                     +  T+C       + EF+N    SR           N +G    G  E+     +P++A    +     CG S+W+ WS C+V CG GE +R+R+ +
Sbjct:  286 VDSNHHLISLVSMVDPSPDWIVGVSGLELCLPNCSWVENKVHNLYPWDAGTDSGPSYMSADQPQV-PPDVVRRI-----KSNFPNDPRSPFYDPTGAQMKPLATLHINRRRLYEKNCESSDSEQVPPECATNSWSRWDECTTKCGPGKQYRIREFKNPALASRHRCNNALREEKNCVGHKCAGFNEETAEGGEPEVAPSPGSSDDPQCGLSDWSEWSSCTVTCGTGEMTRSRHYL 514          

HSP 2 Score: 67.0106 bits (162), Expect = 3.205e-11
Identity = 40/127 (31.50%), Postives = 62/127 (48.82%), Query Frame = 1
Query: 1201 IPEFCFHEVDSSKTCMKSKPKTIWYYSHRNRKCQSLVDYDCKGTLNKFSTFDDCMKTCRPDSQLESLKLD---KVDCQVSEWSLWRPCSKSCGWGTQYKKRVIQKDSLNGGLPCP-VLYESRKCFSK 1569
            +P FC+ E+  S  C  +     WYY H + +C       C    NKF + ++C +TCR     + L+ D    +DC VS+W +   C+ SCG G Q + R + +    GG PCP  L    +C+ +
Sbjct:  658 VPGFCYDELTDSP-CRDNDVANFWYYDHVSDQCAIYWSDRCDTNRNKFKSKEECEETCRLPRHKQELQHDGIPAIDCLVSDW-VSHSCNASCGDGFQLRTRRVLRTPKYGGKPCPKHLVRLDRCYQR 782          
BLAST of Spondin-1 vs. Ensembl Fly
Match: CG30203 (pep:known chromosome:BDGP6:2R:12310689:12313834:1 gene:FBgn0050203 transcript:FBtr0273303 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CG30203)

HSP 1 Score: 81.6481 bits (200), Expect = 9.507e-16
Identity = 61/254 (24.02%), Postives = 107/254 (42.13%), Query Frame = 1
Query:  109 HNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKSN--PFTPDT-----PVAEITLTRVEPQKDTQCVKTPVKGVNE-------------------FQNAQKESRSNTLGRNGAVEK--------------------------YNVLDDPQLAQMAKAFCGFSEWTSWSPCSVKCGEGETSRTRNLIKNLKNELCI---QLPRKEQKNCAGA 705
            H+  S+ + + PSPDW  GV+G++LC+  C W     + LYP D G  +G +Y  ++  ++  PD +R I   +   +  PF  DT     P+A + LTR +     +C + P +G  E                   + + Q+  ++  L  N   ++                            + + P    MA+  C  + W  WSPC+  CG G ++RTR+       + C+   ++P +E + C G+
Sbjct:  290 HHQISLAAKIDPSPDWILGVAGLELCLSNCTWLERKVLNLYPWDIGTDSGPSYMSSDEPQV-PPDVVRRITSSYPSDHRSPFYDDTGAPMKPLATLYLTRKK-LYIRECEEVPQEGPLECAVHPWNEWTNCSTRCGQGYSHRQRSFKNPNLAANFNCDRRLEEFRQCQGTQCGAAEEELEGEEPGLGMENPPSSGSMAE--CQLTNWGEWSPCTKTCGRGSSTRTRDYYNPQARQRCLSVMRIPLEETRECIGS 539          
BLAST of Spondin-1 vs. Ensembl Zebrafish
Match: spon1b (spondin 1b [Source:ZFIN;Acc:ZDB-GENE-000427-10])

HSP 1 Score: 93.9745 bits (232), Expect = 1.178e-19
Identity = 72/251 (28.69%), Postives = 103/251 (41.04%), Query Frame = 1
Query:   82 SGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKSNPF-----TPDTPVAEITLTRVEPQKDTQCVKTP---VKGVNEFQNAQKESRSNTL---------------------GRNGAVEKYNVLDDPQL----------------AQMAKAFCGFSEWTSWSPCSVKCGEGETSRTRNLIKNLKNELCIQLPRKEQKNCA 699
            S   SV+R  +L S ++M+GPSPDW  G+SG DLC   C W   L   L P DAG  +G +Y+  N   + + + IR +  +    +PF      P TP+  + + R+  +K  QC   P      V +    +KE   NT                      GR           DP L                ++   + C  SEW SWSPCS  CG G  SR R + +  ++     LP +E + C 
Sbjct:  297 SAEFSVDRVRHLMSFLTMLGPSPDWNVGLSGEDLCTRDCGWVQKLVKDLVPWDAGTDSGVSYESPNKPSIPQ-ERIRPLTSLDHPQSPFYDPSGGPMTPLGRVVVERIA-RKGEQCNTVPDTIDDIVADIAQEEKEEGDNTPETCIYSNWSPWSACSSSTCDKGRRMRQRMLKAQLDPNLPCLHTQDFEPCMGPGCSEEEASTCMMSEWISWSPCSASCGMGMRSRERYVKQFPEDGSSCTLPTEETEKCV 545          

HSP 2 Score: 53.1434 bits (126), Expect = 6.888e-7
Identity = 23/54 (42.59%), Postives = 33/54 (61.11%), Query Frame = 1
Query: 1414 VDCQVSEWSLWRPCSKSCGWGTQYKKRVIQKDSLNGGLPCPVLYESRKCFSKPC 1575
             DC +SEWS W  C+KSCG G   + R+++ +   GGLPCP   + +KC  + C
Sbjct:  663 TDCMLSEWSAWSECNKSCGKGHMIRSRMVKLEPQFGGLPCPETVQRKKCKIRKC 716          
BLAST of Spondin-1 vs. Ensembl Zebrafish
Match: spon1b (spondin 1b [Source:ZFIN;Acc:ZDB-GENE-000427-10])

HSP 1 Score: 93.9745 bits (232), Expect = 1.212e-19
Identity = 72/251 (28.69%), Postives = 103/251 (41.04%), Query Frame = 1
Query:   82 SGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKSNPF-----TPDTPVAEITLTRVEPQKDTQCVKTP---VKGVNEFQNAQKESRSNTL---------------------GRNGAVEKYNVLDDPQL----------------AQMAKAFCGFSEWTSWSPCSVKCGEGETSRTRNLIKNLKNELCIQLPRKEQKNCA 699
            S   SV+R  +L S ++M+GPSPDW  G+SG DLC   C W   L   L P DAG  +G +Y+  N   + + + IR +  +    +PF      P TP+  + + R+  +K  QC   P      V +    +KE   NT                      GR           DP L                ++   + C  SEW SWSPCS  CG G  SR R + +  ++     LP +E + C 
Sbjct:  260 SAEFSVDRVRHLMSFLTMLGPSPDWNVGLSGEDLCTRDCGWVQKLVKDLVPWDAGTDSGVSYESPNKPSIPQ-ERIRPLTSLDHPQSPFYDPSGGPMTPLGRVVVERIA-RKGEQCNTVPDTIDDIVADIAQEEKEEGDNTPETCIYSNWSPWSACSSSTCDKGRRMRQRMLKAQLDPNLPCLHTQDFEPCMGPGCSEEEASTCMMSEWISWSPCSASCGMGMRSRERYVKQFPEDGSSCTLPTEETEKCV 508          

HSP 2 Score: 53.1434 bits (126), Expect = 7.136e-7
Identity = 23/54 (42.59%), Postives = 33/54 (61.11%), Query Frame = 1
Query: 1414 VDCQVSEWSLWRPCSKSCGWGTQYKKRVIQKDSLNGGLPCPVLYESRKCFSKPC 1575
             DC +SEWS W  C+KSCG G   + R+++ +   GGLPCP   + +KC  + C
Sbjct:  626 TDCMLSEWSAWSECNKSCGKGHMIRSRMVKLEPQFGGLPCPETVQRKKCKIRKC 679          
BLAST of Spondin-1 vs. Ensembl Zebrafish
Match: spon1a (spondin 1a [Source:ZFIN;Acc:ZDB-GENE-000427-9])

HSP 1 Score: 85.1149 bits (209), Expect = 6.961e-17
Identity = 68/250 (27.20%), Postives = 104/250 (41.60%), Query Frame = 1
Query:   82 SGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYK-PNNVTRLDEPDTIREINKIWMKSNPF-TPD----TPVAEITLTRVEPQKDTQCVKTP------VKGVNEFQNAQKESRSNTLGRNGA---------------------------------VEKYNVLDDPQLAQMAKAFCGFSEWTSWSPCSVKCGEGETSRTRNLIKNLKNELCIQLPRKEQKNC 696
            S   SV+RT +L S ++M+GPSPDW  G+S  DLC   C W   +   L P DAG  +G +Y+ PN  T   E   IR +  +    +PF  P+    TPVA + + R+  +K  QC   P      V  + + +  + ++    +  N +                                  + +     P  +    + C  SEW +WSPCSV CG G  SR R + +   +      P +E + C
Sbjct:  302 SAEFSVDRTRHLMSFLTMLGPSPDWNVGLSSEDLCTRECGWVQKVVQDLIPWDAGTDSGVSYESPNKSTAPQE--KIRPLTSLDHPQSPFYDPEGGAITPVARLVVERIA-RKGEQCNIVPDNVDDIVADIAQEEKEEDDTPETCIYSNWSPWSACSSSTCEKGKRMRQRMLKAQLDLSVPCPHTQDFEPCMGPGCSDEDSSTCMMSEWITWSPCSVSCGSGLRSRERYVKQFPDDGFACTHPTEETEPC 548          
BLAST of Spondin-1 vs. Ensembl Zebrafish
Match: spon2b (spondin 2b, extracellular matrix protein [Source:ZFIN;Acc:ZDB-GENE-990415-161])

HSP 1 Score: 72.4034 bits (176), Expect = 2.483e-13
Identity = 55/191 (28.80%), Postives = 87/191 (45.55%), Query Frame = 1
Query:  109 HNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKSNP----FTPDT----PVAEITLTRVEPQKDTQCVKTPVKGVNEFQNAQKESRSNTLGRNGAVEKYNVLDDPQLAQMAKAFCGFSEWTSWSPCSVKCGE-GETSRTRNLIKNLKN 654
            H+L S I  + PSPDW  GV  ++LC +G  WK N+++ LYP DAG  +G T+   N   + + D + +I      S+P    + P      P+A+++LT++   K+ Q    P++     Q                +   N +D P +       C  S W+ W  C  +CGE G   RTR +  +  N
Sbjct:  145 HSLLSFIVRIVPSPDWFIGVDSLNLC-EGDHWKENISLELYPYDAGTDSGFTFSSPNFETIPQ-DKVTQITSS-FPSHPANSFYYPRLKHLPPIAKVSLTKI---KNNQIFSLPIQPTQSNQ----------------IPSGNEIDGPLINTPLD--CEVSVWSPWGLCKGQCGEKGVKHRTRYIHMHPAN 311          
BLAST of Spondin-1 vs. Ensembl Zebrafish
Match: spon2b (spondin 2b, extracellular matrix protein [Source:ZFIN;Acc:ZDB-GENE-990415-161])

HSP 1 Score: 72.4034 bits (176), Expect = 2.483e-13
Identity = 55/191 (28.80%), Postives = 87/191 (45.55%), Query Frame = 1
Query:  109 HNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKSNP----FTPDT----PVAEITLTRVEPQKDTQCVKTPVKGVNEFQNAQKESRSNTLGRNGAVEKYNVLDDPQLAQMAKAFCGFSEWTSWSPCSVKCGE-GETSRTRNLIKNLKN 654
            H+L S I  + PSPDW  GV  ++LC +G  WK N+++ LYP DAG  +G T+   N   + + D + +I      S+P    + P      P+A+++LT++   K+ Q    P++     Q                +   N +D P +       C  S W+ W  C  +CGE G   RTR +  +  N
Sbjct:  145 HSLLSFIVRIVPSPDWFIGVDSLNLC-EGDHWKENISLELYPYDAGTDSGFTFSSPNFETIPQ-DKVTQITSS-FPSHPANSFYYPRLKHLPPIAKVSLTKI---KNNQIFSLPIQPTQSNQ----------------IPSGNEIDGPLINTPLD--CEVSVWSPWGLCKGQCGEKGVKHRTRYIHMHPAN 311          
BLAST of Spondin-1 vs. Ensembl Xenopus
Match: spon1 (spondin 1, extracellular matrix protein [Source:Xenbase;Acc:XB-GENE-991006])

HSP 1 Score: 83.1889 bits (204), Expect = 1.779e-16
Identity = 60/195 (30.77%), Postives = 87/195 (44.62%), Query Frame = 1
Query:   82 SGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKSNPF-----TPDTPVAEITLTRVEPQKDTQCVKTPVKGVNEFQNAQKESRSNTLGRNGAVEKYNVLDDPQLAQMAKAFCGFSEWTSWSPC-SVKCGEGETSRTRNLIKNL 648
            S   SV+R+ +L S ++MMGPSPDW  G+S  DLC   C W   +   L P DAG  +G TY+  N   + + D IR +  +    +PF      P  PVA + + R+  +K  QC   P                + +  +   E+    D P+        C +S W+ WS C S  C +G+  R R L   L
Sbjct:  309 SAEFSVDRSRHLMSFLAMMGPSPDWNVGLSSEDLCTKECGWVQKVIQDLIPWDAGTDSGVTYESPNKPSIPQ-DKIRPLTSLDHPQSPFYDPEGGPIIPVARVVIERIA-RKGDQCNIVP-------------DNVDDIVPDLVTEEKEEDDTPET-------CIYSNWSPWSACSSATCDKGKRMRQRMLKAQL 481          
BLAST of Spondin-1 vs. Ensembl Xenopus
Match: spon2 (spondin 2, extracellular matrix protein [Source:Xenbase;Acc:XB-GENE-945214])

HSP 1 Score: 61.2326 bits (147), Expect = 5.675e-10
Identity = 59/208 (28.37%), Postives = 91/208 (43.75%), Query Frame = 1
Query:   19 NVKSLFTSGWLNGEEQLNEERSGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKSNPFTPDTPVAEITLTRVEPQKDTQCVKTPVKG-VNEFQNAQKESRSNTLGRNGAVEKYNVLDDPQLAQMAKAFCGFSEWTSWSPCSVKCG-EGETSRTRNL 636
            +V  +F++  ++G     +  + F + +R H   S +  + PSPDW  GV  ++LC +G  WK   T+ L+P DAG  +G T+   N   + +   + EI      S+P  P        L  + P    + V T VKG ++ F +    S   T G   A      + +  L       C  S W+SW  C   CG  G  SRTR +
Sbjct:  119 SVHGIFSTASISG--GTGQASTEFEAHSR-HPFVSFMVRIVPSPDWFVGVDTLNLC-EGKHWKQTATLELHPYDAGTDSGFTFSSPNFATIPQ-GIVTEITA----SSPSHPANSFYYPRLKSLPPI--AKVVFTKVKGRLSSFLDIV--SNVTTTGNEIAEHILVFVSETPLD------CEVSVWSSWGLCRGSCGTAGVKSRTRYI 307          
BLAST of Spondin-1 vs. Ensembl Xenopus
Match: thsd7b (thrombospondin, type I, domain containing 7B [Source:Xenbase;Acc:XB-GENE-6043658])

HSP 1 Score: 51.9878 bits (123), Expect = 1.121e-6
Identity = 23/57 (40.35%), Postives = 36/57 (63.16%), Query Frame = 1
Query: 1417 DCQVSEWSLWRPCSKSCGWGTQYKKRVIQKDSLNGGLPCPVL------YESRKCFSK 1569
            DC++S+WS W PCS SCG G + + + +++   NGG PCP L      YE+  C+++
Sbjct:  955 DCKLSDWSAWSPCSSSCGTGVKIRSKWLKEKPYNGGRPCPKLDIKNQVYEAVPCYNE 1011          
BLAST of Spondin-1 vs. Ensembl Mouse
Match: Spon1 (spondin 1, (f-spondin) extracellular matrix protein [Source:MGI Symbol;Acc:MGI:2385287])

HSP 1 Score: 85.8853 bits (211), Expect = 4.845e-17
Identity = 69/249 (27.71%), Postives = 104/249 (41.77%), Query Frame = 1
Query:   82 SGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKSNPF-TPD----TPVAEITLTRVEPQKDTQCVKTPVKGVNEFQNAQKESR--------------------SNTLGRNGAVEKYNVLD-------------------DPQLAQMAKAFCGFSEWTSWSPCSVKCGEGETSRTRNLIKNLKNELCIQLPRKEQKNC 696
            S   SV+RT +L S ++MMGPSPDW  G+S  DLC   C W   +   L P DAG  +G TY+  N   + + + IR +  +    +PF  P+    T VA + + R+  +K  QC   P    +   +   E +                    S++    G   +  +L                     P  +    + C  SEW +WSPCSV CG G  SR R + +  ++     LP +E + C
Sbjct:  302 SAEFSVDRTRHLMSFLTMMGPSPDWNVGLSAEDLCTKECGWVQKVVQDLIPWDAGTDSGVTYESPNKPTIPQ-EKIRPLTSLDHPQSPFYDPEGGSITQVARVVIERIA-RKGEQCNIVPDNVDDIVADLAPEEKDEDDTPETCIYSNWSPWSACSSSTCEKGKRMRQRMLKAQLDLSVPCPDTQDFQPCMGPGCSDEDGSTCTMSEWITWSPCSVSCGMGMRSRERYVKQFPEDGSVCMLPTEETEKC 548          

HSP 2 Score: 57.3806 bits (137), Expect = 4.065e-8
Identity = 24/54 (44.44%), Postives = 35/54 (64.81%), Query Frame = 1
Query: 1414 VDCQVSEWSLWRPCSKSCGWGTQYKKRVIQKDSLNGGLPCPVLYESRKCFSKPC 1575
            +DC++SEWS W  C+KSCG G   + R IQ +   GG+PCP   + +KC ++ C
Sbjct:  667 IDCELSEWSQWSECNKSCGKGHMIRTRTIQMEPQFGGVPCPETVQRKKCRTRKC 720          
BLAST of Spondin-1 vs. Ensembl Mouse
Match: Spon2 (spondin 2, extracellular matrix protein [Source:MGI Symbol;Acc:MGI:1923724])

HSP 1 Score: 73.9442 bits (180), Expect = 7.582e-14
Identity = 63/217 (29.03%), Postives = 97/217 (44.70%), Query Frame = 1
Query:   91 VSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKSNPFTPDT-----------PVAEITLTRVEPQKDTQCVKTPVKGVNEFQNAQKESRSNTLGRNGAVEKYNVLDDPQLAQMAKAFCGFSEWTSWSPCSVKCGE-GETSRTRNLIKNLKNE--LCIQLPRKEQKNCA 699
            + V+  H+L S +  + PSPDW  G+  +DLC +G +WK  + + LYP DAG  +G T+   N   + + DT+ EI      S+P  P             P+A++T  R+  Q+  +    P        +    SR N +     V+  +V + P         C  S W+SW  C   CG+ G  SRTR +     N    C +L  +E+  CA
Sbjct:  139 LEVHPRHSLVSFVVRIVPSPDWFVGIDSLDLC-EGGRWKEQVVLDLYPHDAGTDSGFTFSSPNFATIPQ-DTVTEIT----ASSPSHPANSFYYPRLKSLPPIAKVTFVRL--QQSPRAFAPP--------SLDLASRGNEI-----VDSLSVPETP-------LDCEVSLWSSWGLCGGPCGKLGAKSRTRYVRVQPANNGTPCPEL--EEEAECA 325          
BLAST of Spondin-1 vs. Ensembl Mouse
Match: Spint2 (serine protease inhibitor, Kunitz type 2 [Source:MGI Symbol;Acc:MGI:1338031])

HSP 1 Score: 59.6918 bits (143), Expect = 1.586e-9
Identity = 36/135 (26.67%), Postives = 63/135 (46.67%), Query Frame = 1
Query:  982 RFFYHIKTGKCEPFKYYDCKKGNLNNFPT----IDSCENVCSKVIQELPKIRRSNLALLQARTSYSAEESLSQKAKNIPEFCFHEVDSSKTCMKSKPKTIWYYSHRNRKCQSLVDYDCKGTLNKFSTFDDCMKTC 1374
            R++Y+I  G C+PF Y  C+ GN NN+ +    +D C  V      ++ + R    + + +     + E LS +  N  E+C  +  +   C  + P+  WYY      C S +   C+G  N + + + CM+ C
Sbjct:   53 RWWYNITDGSCQPFVYGGCE-GNGNNYQSKEECLDKCAGVTENTTDDMARNRNGADSSVLSVPRKQSAEDLSAEIFNYEEYCVPKAVTGP-CRAAFPR--WYYDTEKNSCISFIYGGCRGNKNSYLSQEACMQHC 183          
BLAST of Spondin-1 vs. Ensembl Mouse
Match: Tfpi (tissue factor pathway inhibitor [Source:MGI Symbol;Acc:MGI:1095418])

HSP 1 Score: 50.8322 bits (120), Expect = 1.261e-6
Identity = 37/132 (28.03%), Postives = 61/132 (46.21%), Query Frame = 1
Query:  985 FFYHIKTGKCEPFKYYDCKKGNLNNFPTIDSCENVCSKVIQELPKIRRSNLALLQARTSYSAEESLSQKAKNIPEFCFHEVDSS--KTCMKSKPKTIWYYSHRNRKCQSLVDYDCKGTLNKFSTFDDCMKTC 1374
            +F+++ T +CE F Y  C+ GN N F T++ C+  C      +P   ++       + +  AE          P+FCF E D    +  MK      + Y+++ ++C+  V   C G  N F T D+C K C
Sbjct:   66 YFFNMYTHQCEEFIYGGCE-GNENRFDTLEECKKTC------IPGYEKT-----AVKAASGAER---------PDFCFLEEDPGLCRGYMKR-----YLYNNQTKQCERFVYGGCLGNRNNFETLDECKKIC 171          
BLAST of Spondin-1 vs. Ensembl Mouse
Match: Tfpi (tissue factor pathway inhibitor [Source:MGI Symbol;Acc:MGI:1095418])

HSP 1 Score: 50.8322 bits (120), Expect = 1.261e-6
Identity = 37/132 (28.03%), Postives = 61/132 (46.21%), Query Frame = 1
Query:  985 FFYHIKTGKCEPFKYYDCKKGNLNNFPTIDSCENVCSKVIQELPKIRRSNLALLQARTSYSAEESLSQKAKNIPEFCFHEVDSS--KTCMKSKPKTIWYYSHRNRKCQSLVDYDCKGTLNKFSTFDDCMKTC 1374
            +F+++ T +CE F Y  C+ GN N F T++ C+  C      +P   ++       + +  AE          P+FCF E D    +  MK      + Y+++ ++C+  V   C G  N F T D+C K C
Sbjct:   66 YFFNMYTHQCEEFIYGGCE-GNENRFDTLEECKKTC------IPGYEKT-----AVKAASGAER---------PDFCFLEEDPGLCRGYMKR-----YLYNNQTKQCERFVYGGCLGNRNNFETLDECKKIC 171          
BLAST of Spondin-1 vs. UniProt
Match: sp|P35446|SPON1_RAT (Spondin-1 OS=Rattus norvegicus GN=Spon1 PE=1 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 3.090e-16
Identity = 69/249 (27.71%), Postives = 104/249 (41.77%), Query Frame = 1
Query:   82 SGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKSNPF-TPD----TPVAEITLTRVEPQKDTQCVKTPVKGVNEFQNAQKESR--------------------SNTLGRNGAVEKYNVLD-------------------DPQLAQMAKAFCGFSEWTSWSPCSVKCGEGETSRTRNLIKNLKNELCIQLPRKEQKNC 696
            S   SV+RT +L S ++MMGPSPDW  G+S  DLC   C W   +   L P DAG  +G TY+  N   + + + IR +  +    +PF  P+    T VA + + R+  +K  QC   P    +   +   E +                    S++    G   +  +L                     P  +    + C  SEW +WSPCSV CG G  SR R + +  ++     LP +E + C
Sbjct:  302 SAEFSVDRTRHLMSFLTMMGPSPDWNVGLSAEDLCTKECGWVQKVVQDLIPWDAGTDSGVTYESPNKPTIPQ-EKIRPLTSLDHPQSPFYDPEGGSITQVARVVIERIA-RKGEQCNIVPDNVDDIVADLAPEEKDEDDTPETCIYSNWSPWSACSSSTCEKGKRMRQRMLKAQLDLSVPCPDTQDFQPCMGPGCSDEDGSTCTMSEWITWSPCSVSCGMGMRSRERYVKQFPEDGSVCMLPTEETEKC 548          

HSP 2 Score: 56.6102 bits (135), Expect = 5.443e-7
Identity = 24/54 (44.44%), Postives = 34/54 (62.96%), Query Frame = 1
Query: 1414 VDCQVSEWSLWRPCSKSCGWGTQYKKRVIQKDSLNGGLPCPVLYESRKCFSKPC 1575
            +DC++SEWS W  C+KSCG G   + R IQ +   GG PCP   + +KC ++ C
Sbjct:  667 IDCELSEWSQWSECNKSCGKGHMIRTRTIQMEPQFGGAPCPETVQRKKCRARKC 720          
BLAST of Spondin-1 vs. UniProt
Match: sp|Q8VCC9|SPON1_MOUSE (Spondin-1 OS=Mus musculus GN=Spon1 PE=1 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 3.774e-16
Identity = 69/249 (27.71%), Postives = 104/249 (41.77%), Query Frame = 1
Query:   82 SGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKSNPF-TPD----TPVAEITLTRVEPQKDTQCVKTPVKGVNEFQNAQKESR--------------------SNTLGRNGAVEKYNVLD-------------------DPQLAQMAKAFCGFSEWTSWSPCSVKCGEGETSRTRNLIKNLKNELCIQLPRKEQKNC 696
            S   SV+RT +L S ++MMGPSPDW  G+S  DLC   C W   +   L P DAG  +G TY+  N   + + + IR +  +    +PF  P+    T VA + + R+  +K  QC   P    +   +   E +                    S++    G   +  +L                     P  +    + C  SEW +WSPCSV CG G  SR R + +  ++     LP +E + C
Sbjct:  302 SAEFSVDRTRHLMSFLTMMGPSPDWNVGLSAEDLCTKECGWVQKVVQDLIPWDAGTDSGVTYESPNKPTIPQ-EKIRPLTSLDHPQSPFYDPEGGSITQVARVVIERIA-RKGEQCNIVPDNVDDIVADLAPEEKDEDDTPETCIYSNWSPWSACSSSTCEKGKRMRQRMLKAQLDLSVPCPDTQDFQPCMGPGCSDEDGSTCTMSEWITWSPCSVSCGMGMRSRERYVKQFPEDGSVCMLPTEETEKC 548          

HSP 2 Score: 57.3806 bits (137), Expect = 3.166e-7
Identity = 24/54 (44.44%), Postives = 35/54 (64.81%), Query Frame = 1
Query: 1414 VDCQVSEWSLWRPCSKSCGWGTQYKKRVIQKDSLNGGLPCPVLYESRKCFSKPC 1575
            +DC++SEWS W  C+KSCG G   + R IQ +   GG+PCP   + +KC ++ C
Sbjct:  667 IDCELSEWSQWSECNKSCGKGHMIRTRTIQMEPQFGGVPCPETVQRKKCRTRKC 720          
BLAST of Spondin-1 vs. UniProt
Match: sp|Q9GLX9|SPON1_BOVIN (Spondin-1 OS=Bos taurus GN=SPON1 PE=1 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 5.727e-16
Identity = 66/249 (26.51%), Postives = 104/249 (41.77%), Query Frame = 1
Query:   82 SGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKSNPF-TPD----TPVAEITLTRVEPQKDTQCVKTP------VKGVNEFQNAQKESRSNTLGRNGA---------------------------------VEKYNVLDDPQLAQMAKAFCGFSEWTSWSPCSVKCGEGETSRTRNLIKNLKNELCIQLPRKEQKNC 696
            S   SV+RT +L S ++MMGPSPDW  G+S  DLC   C W   +   L P DAG  +G TY+  N   + + + IR +  +    +PF  P+    T VA + + R+  +K  QC   P      V  +   +  + ++    +  N +                                  + +     P  +    + C  SEW +WSPCS+ CG G  SR R + +  ++     LP +E + C
Sbjct:  302 SAEFSVDRTRHLMSFLTMMGPSPDWNVGLSAEDLCTKECGWVQKVVQDLIPWDAGTDSGVTYESPNKPTIPQ-EKIRPLTSLDHPQSPFYDPEGGSITQVARVVIERIA-RKGEQCNIVPDNVDDIVADLAPEEKDEDDTPETCIYSNWSPWSACSSSTCDKGKRMRQRMLKAQLDLSVPCPDTQDFQPCMGPGCSDEDGSTCTMSEWITWSPCSISCGTGTRSRERYVKQFPEDGSVCTLPTEETEKC 548          

HSP 2 Score: 54.6842 bits (130), Expect = 2.191e-6
Identity = 23/54 (42.59%), Postives = 34/54 (62.96%), Query Frame = 1
Query: 1414 VDCQVSEWSLWRPCSKSCGWGTQYKKRVIQKDSLNGGLPCPVLYESRKCFSKPC 1575
            +DC+++EWS W  C+KSCG G   + R+IQ +   GG PCP   + +KC  + C
Sbjct:  667 IDCELTEWSQWSECNKSCGKGHMIRTRMIQMEPQFGGTPCPETVQRKKCRIRKC 720          
BLAST of Spondin-1 vs. UniProt
Match: sp|Q9HCB6|SPON1_HUMAN (Spondin-1 OS=Homo sapiens GN=SPON1 PE=1 SV=2)

HSP 1 Score: 85.1149 bits (209), Expect = 7.432e-16
Identity = 66/249 (26.51%), Postives = 104/249 (41.77%), Query Frame = 1
Query:   82 SGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKSNPF-TPD----TPVAEITLTRVEPQKDTQCVKTP------VKGVNEFQNAQKESRSNTLGRNGA---------------------------------VEKYNVLDDPQLAQMAKAFCGFSEWTSWSPCSVKCGEGETSRTRNLIKNLKNELCIQLPRKEQKNC 696
            S   SV+RT +L S ++MMGPSPDW  G+S  DLC   C W   +   L P DAG  +G TY+  N   + + + IR +  +    +PF  P+    T VA + + R+  +K  QC   P      V  +   +  + ++    +  N +                                  + +     P  +    + C  SEW +WSPCS+ CG G  SR R + +  ++     LP +E + C
Sbjct:  302 SAEFSVDRTRHLMSFLTMMGPSPDWNVGLSAEDLCTKECGWVQKVVQDLIPWDAGTDSGVTYESPNKPTIPQ-EKIRPLTSLDHPQSPFYDPEGGSITQVARVVIERIA-RKGEQCNIVPDNVDDIVADLAPEEKDEDDTPETCIYSNWSPWSACSSSTCDKGKRMRQRMLKAQLDLSVPCPDTQDFQPCMGPGCSDEDGSTCTMSEWITWSPCSISCGMGMRSRERYVKQFPEDGSVCTLPTEETEKC 548          

HSP 2 Score: 53.9138 bits (128), Expect = 3.309e-6
Identity = 23/54 (42.59%), Postives = 34/54 (62.96%), Query Frame = 1
Query: 1414 VDCQVSEWSLWRPCSKSCGWGTQYKKRVIQKDSLNGGLPCPVLYESRKCFSKPC 1575
            +DC+++EWS W  C+KSCG G   + R+IQ +   GG PCP   + +KC  + C
Sbjct:  667 IDCELTEWSQWSECNKSCGKGHVIRTRMIQMEPQFGGAPCPETVQRKKCRIRKC 720          
BLAST of Spondin-1 vs. UniProt
Match: sp|Q9BUD6|SPON2_HUMAN (Spondin-2 OS=Homo sapiens GN=SPON2 PE=1 SV=3)

HSP 1 Score: 77.7962 bits (190), Expect = 3.439e-14
Identity = 61/199 (30.65%), Postives = 85/199 (42.71%), Query Frame = 1
Query:   76 ERSGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKSNPFTPDT-----------PVAEITLTRVEPQKDTQCVKTPVKGVNEFQNAQKESRSNTLGRNGAVEKYNVLDDPQLAQMAKAFCGFSEWTSWSPCSVKCGE-GETSRTRNL 636
            + S  + V R H+L S +  + PSPDW  GV  +DLC DG +W+    + LYP DAG  +G T+   N   + + DT+ EI      S+P  P             P+A +TL R+           PV            SR N +  + +V +   LD           C  S W+SW  C   CG  G  SRTR +
Sbjct:  135 QTSAELEVQRRHSLVSFVVRIVPSPDWFVGVDSLDLC-DGDRWREQAALDLYPYDAGTDSGFTFSSPNFATIPQ-DTVTEIT----SSSPSHPANSFYYPRLKALPPIARVTLVRLRQSPRAFIPPAPV----------LPSRDNEIVDSASVPE-TPLD-----------CEVSLWSSWGLCGGHCGRLGTKSRTRYV 305          
BLAST of Spondin-1 vs. TrEMBL
Match: tr|A0A068XLR8|A0A068XLR8_HYMMI (SPONdin (Extracellular matrix glycoprotein) OS=Hymenolepis microstoma GN=HmN_000333900 PE=4 SV=1)

HSP 1 Score: 325.094 bits (832), Expect = 2.479e-95
Identity = 218/597 (36.52%), Postives = 293/597 (49.08%), Query Frame = 1
Query:   22 VKSLFTSGWLNGEEQLNEERSGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKSNPFTPDTPVAEITLTRVEPQKDTQCVKTPVKGVNEF-----------------------QNAQKESRSNTLGR----------------NGAVEKYNVLDDPQLAQMAKAFCGFSEWTSWSPCSVKCGEGETSRTRNLIKNLKNELCIQLPRKEQKNCAGARLECDLXXXXXXXXXXXXXXXXASCTTE-GKMIRIRKFARSKEKDEC--MKNVKP---EIILQQVKTCKLDKTDFRCDPISICSAGKLAPCINGKPKTRFFYHIKTGKCEPFKYYDCKKGNLNNFPTIDSCENVCSKVIQELPKIRRSNLALLQARTSY---SAEESLSQKAKNIPEFCFHEVDSSKTCMKSKPKTI---WYYSHRNRKCQSLVDYDCKGTLNKFSTFDDCMKTCRPDSQLESLKLDKV-----------------------------DCQVSEWSLWRPCSKSCG--WGTQYKKRVIQKDSLNGGLPCPVLYESRKCFS 1566
            ++SL ++  + GEE L E+R+   SVNRTH LFSM++M+GPSPDWCTG+SG  LC   C W  N+T+ L+P DAGI+ G TY P    R + PD IR I++ WM  NPF    P+A + + R+ P+ D +C      GV  F                       +NA   ++    G+                +G +   N L DP LAQMA   C  SEW++WS CSV CG G  +RTR LI N K ELC  +P   +++C G +  CD S  CS LPWS WSPC+A+C +  G   R R  AR +E  +C  +   +P   E +L++V+ C++      CDP++IC  G       GKP  R++Y     KC  F+Y  CK G  N F T + CENVC   ++ LP  RR  + LLQ +TS    S  ++   + K  P  CF+EVD+   C    PK I   WYY  R   C       C GT N+F     CM  C P    +S  L KV                             DC+V+ W  W PCS  C    G QY+ R I++ +  GG  C  LYE R C+ 
Sbjct:  385 LRSLISTPGMWGEETLMEQRTTLFSVNRTHPLFSMLTMLGPSPDWCTGISGQSLCKADCTWVKNMTLYLHPWDAGIREGNTYMPKESDRKEIPDPIRYIDESWMPGNPFREKKPIARVNIERILPKNDWECTNKDADGVQLFIMGGGIRVSGKAAEEVKDKMFDNKNAASATQQIVTGKGRGKSSKSVGFGGPGSSGTLGTNNPLSDPSLAQMATFLCITSEWSAWSQCSVTCGVGTKTRTRELIANKKPELCQHVPLVMEESCEGRKRTCDYSAPCSFLPWSLWSPCNATCESPIGVRSRTRALARPEEAAQCEYLWRDQPGGMESVLKEVEECRVSSE--ACDPVTICGEGAKQGYPCGKPMKRYYYSAIDHKCLEFEYLGCKGGR-NMFETKEQCENVCIPAVEALPAWRRERMGLLQFKTSQLLNSDADNNDVELKQDPA-CFYEVDTGYEC--DSPKEIGSFWYYYPRKNICSDFFYLGCGGTPNRFINHTACMAACMPKELRQSQILAKVRSSTGSGNKNESGDLEMPDGLEVAVSPKQDCRVTPWGGWGPCSTRCASQLGHQYRLRAIERPARYGGEGCGPLYEKRDCYG 975          
BLAST of Spondin-1 vs. TrEMBL
Match: tr|A0A0R3SRQ7|A0A0R3SRQ7_HYMDI (Uncharacterized protein OS=Hymenolepis diminuta PE=4 SV=1)

HSP 1 Score: 318.161 bits (814), Expect = 7.586e-93
Identity = 220/597 (36.85%), Postives = 291/597 (48.74%), Query Frame = 1
Query:   22 VKSLFTSGWLNGEEQLNEERSGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKSNPFTPDTPVAEITLTRVEPQKDTQCVKTPVKGVNEF------------------------------------QNAQKESRSNTLG---RNGAVEKYNVLDDPQLAQMAKAFCGFSEWTSWSPCSVKCGEGETSRTRNLIKNLKNELCIQLPRKEQKNCAGARLECDLXXXXXXXXXXXXXXXXASCTTE-GKMIRIRKFARSKEKDEC---MKNVKPEII--LQQVKTCKLDKTDFRCDPISICSAG--KLAPCINGKPKTRFFYHIKTGKCEPFKYYDCKKGNLNNFPTIDSCENVCSKVIQELPKIRRSNLALLQARTSY---SAEESLSQKAKNIPEFCFHEVDSSKTCMKSKPKTI---WYYSHRNRKCQSLVDYDCKGTLNKFSTFDDCMKTCRPDSQLESLKLDKV-----------------------------DCQVSEWSLWRPCSKSCG--WGTQYKKRVIQKDSLNGGLPCPVLYESRKC 1560
            ++SL ++  + GEE L E+R+   SVNRTH LFSM++M+GPSPDWCTG+SG  LC   C W  N+T+ L P DAGI+ G TY P    R D PD IR I++ WM  NPF  + PVA + + R+ P+ D +C      GV  F                                    +   K S+S   G    +G +   N L DP LAQMA   C  SEW++WS CSV CG G  +RTR LI N K ELC  +P   +++C G +  CD S  CS LPWS WSPC+A+C +  G   R R  AR KE  +C    K++   +   L +V+ C++      CDP +IC  G  +  PC  GK   R++Y      C  F+Y  CK G  N F T + CEN+C   ++ LP  RR  + LLQ +TS    SA ++ + + K  P  CF+EV++   C    PK I   WYY  R   C       C GT N+F     CM  C P+   +S  L KV                             DC+V+ W  W PCS  C    G QY+ R I + +  GG  C  LYE R C
Sbjct:  376 LRSLISTPGMWGEETLMEQRTTLFSVNRTHPLFSMLTMLGPSPDWCTGISGQSLCKADCTWVRNMTLYLRPWDAGIREGNTYMPKESDRKDIPDPIRYIDESWMPGNPFRENKPVARVEIERILPKNDWECTNVDADGVQLFVMGGGIRVSGKKVEEVKNKAADNMHTPSATQQIVTGKGRGKSSKSVGFGGPGSSGTLGTNNPLSDPSLAQMATFLCITSEWSAWSQCSVTCGVGTKTRTRELIANKKPELCQHVPLVMEESCEGRKRTCDYSAPCSFLPWSLWSPCNATCESPIGVRSRTRALARPKEAPQCEHLWKDLPGGMTSALNEVEECRIASEA--CDPATICGEGPKQGYPC--GKSMKRYYYSAIDHHCLEFEYLGCKGGR-NMFETREQCENICIPAVEALPAWRRERMGLLQFKTSQLSNSAADTCNMELKQDPA-CFYEVNTGYEC--DSPKEIGSYWYYYPRKNICSDFFYLGCGGTPNRFPNHTACMAACMPNDLRQSQILAKVRSNAGSNNPGELGDSEVPDGLEVAVSPKQDCRVTPWGGWGPCSTRCASQIGYQYRLRAIIRPARYGGEGCGPLYEKRNC 964          
BLAST of Spondin-1 vs. TrEMBL
Match: tr|A0A0R3U498|A0A0R3U498_9CEST (Uncharacterized protein OS=Mesocestoides corti PE=4 SV=2)

HSP 1 Score: 316.235 bits (809), Expect = 5.382e-92
Identity = 217/605 (35.87%), Postives = 292/605 (48.26%), Query Frame = 1
Query:   22 VKSLFTSGWLNGEEQLNEERSGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKSNPFTPDTPVAEITLTRVEPQKDTQCVKTPVKGVNEFQNA----------QKESRSNTL------------------------------GRNGAVEKYNVLDDPQLAQMAKAFCGFSEWTSWSPCSVKCGEGETSRTRNLIKNLKNELCIQLPRKEQKNCAGARLECDLXXXXXXXXXXXXXXXXASC-TTEGKMIRIRKFARSKEKDECM-------KNVKPEIILQQVKTCKLDKTDFRCDPISICSAG--KLAPCINGKPKTRFFYHIKTGKCEPFKYYDCKKGNLNNFPTIDSCENVCSKVIQELPKIRRSNLALLQARTSY---SAEESLSQKAKNIPEFCFHEVDSSKTCMKSKPKTI---WYYSHRNRKCQSLVDYDCKGTLNKFSTFDDCMKTCRPDSQLESLKLDKV--------------------------------DCQVSEWSLWRPCSKSCG--WGTQYKKRVIQKDSLNGGLPCPVLYESRKCFS 1566
            ++SL T+  + GEE L EERS   SVNRTH L SM++M+GPSPDWCTG+SG  LC   C W +NLT+ LYP DAGI+ G TY P    R + PD IR I++ WM  NPF    PVA + + RV P+ D  C  T   GV  F+             KES  ++L                              G +G +   N L DP LAQMA   C   EW++WS CSV CG G  +RTR LI N K ELC  +P   +++C G +  CD S  CSLLPW+ WSPC+ +C +  G   R R  AR +E  +C        +  + + I+ +V+ C++      C+P +IC  G  +  PC  G    RF+Y     +C  F+Y  CK G  N F T   CE +C   ++ LP  RR  + LLQ +TS    S+ + L    K  P  C++EV++   C    PK +   WY+  R  +C+      C GT N+F+    CM  C P+    S  L KV                                DC+V++W  W PCS  C    G Q + R I++ S  GG  C  LYE R C+ 
Sbjct:  381 LRSLITTPGMWGEETLMEERSTLFSVNRTHPLVSMLTMLGPSPDWCTGISGQSLCKADCTWVNNLTLHLYPWDAGIREGNTYMPKESDRREIPDPIRYIDESWMPGNPFRERKPVAVVKIQRVRPKYDWACTNTDEDGVQLFKMGGGIYVTGKKNDKESDESSLKEKAREQRCTTITAGKQKGKRTKSVGFGGPGASGTIGSNNPLSDPSLAQMATFLCITDEWSAWSACSVTCGVGTKTRTRRLIANKKPELCQHVPLVMEESCEGRKRTCDYSAPCSLLPWTLWSPCTGTCDSPRGHRSRKRALARPEEAAQCGHLWEGRNQEGREQGIMSEVEECQVPSET--CEPATICGEGPKQGYPC--GPKLRRFYYSAIDHECLEFEYLGCKGGR-NMFETKQDCEKLCIPAVEALPAWRRERMGLLQFKTSQLTSSSPDDLEDSLKRDP-VCYYEVNTGYEC--DPPKELGNYWYFCSRTNRCRDFFYLGCGGTPNRFANHTACMAACMPNELRHSQLLAKVRSATASRKAAANATDADEEAPDGLEVGVSPRQDCRVTQWGAWGPCSVRCSSQRGQQIRLRAIERPSRYGGEACGPLYERRSCYG 977          
BLAST of Spondin-1 vs. TrEMBL
Match: tr|A0A0X3Q224|A0A0X3Q224_SCHSO (Spondin-1 OS=Schistocephalus solidus GN=SPON1 PE=4 SV=1)

HSP 1 Score: 313.538 bits (802), Expect = 6.155e-92
Identity = 204/598 (34.11%), Postives = 288/598 (48.16%), Query Frame = 1
Query:   22 VKSLFTSGWLNGEEQLNEERSGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKSNPFTPDTPVAEITLTRVEPQKDTQCVKTPVKGVNEFQN-----------------------AQKESRSNT-------LGRNGAVEKYNVLDDPQLAQMAKAFCGFSEWTSWSPCSVKCGEGETSRTRNLIKNLKNELCIQLPRKEQKNCAGARLECDLXXXXXXXXXXXXXXXXASCTTEGKM-IRIRKFARSKEKDECMKNVKPEI------ILQQVKTCKLDKTDFRCDPISICSAGKLAPCINGKPKTRFFYHIKTGKCEPFKYYDCKKGNLNNFPTIDSCENVCSKVIQELPKIRRSNLALLQARTSY-----SAEESLSQKAKNIPEFCFHEVDSSKTC-MKSKPKTIWYYSHRNRKCQSLVDYDCKGTLNKFSTFDDCMKTCRPDSQLESLKLDKV----------------------------------------DCQVSEWSLWRPCSKSCG--WGTQYKKRVIQKDSLNGGLPCPVLYESRKC 1560
            + SL ++  + GEE LNE R+  ++VNRTH L S+++M+GPSPDWCTG+SG  +C   C W   L I LYP DAG++ G TY P N  RLD PD IR I++ WM  NPF    PVA +T+ R+ P+   QC      GV+ FQ                        +QK+ R           G +G++   + L DP LAQMA   C  S+W++W PCSV CG G   R R +I N K ELC  +    +++C G +  CD S  CSLLPW++WSPC+A+C +   +  R+RK   ++  +E   ++ P         L Q + C+L      CDP +IC  G       G+P   F+Y      C PF Y  CK G  N F + ++C+  C  V++ LP  RR  + LLQ +TS      + +ES     +N    C  EV++ + C    + ++ WYY  R  +C+  V   CKGT N+F+    CM  C P+    S +L ++                                        DCQV+ W  W PCS  C    G +++ R I + S  GG  C  LYE   C
Sbjct:  254 LHSLLSTPGMWGEETLNEPRTALIAVNRTHPLISLVTMLGPSPDWCTGISGQSVCKSDCTWVDKLEINLYPWDAGVRQGNTYMPKNADRLDIPDPIRYIDEKWMPGNPFYEHKPVARVTVQRILPEHAWQCTNRVADGVHLFQMGGTVMVSGKPANGSESVGAVQQVSQKKGRKGGKAVGFGGPGASGSLGTNDPLSDPSLAQMATFLCITSDWSAWGPCSVTCGVGSRKRQRTMISNKKPELCQHVQLTMEESCEGRQRTCDFSAPCSLLPWTAWSPCNATCQSPNHLGTRVRKRTLARRNEEGCDHLFPSARELATRTLVQTEECQLPPET--CDPATICGEGPKEGFPCGEPTPAFYYSAIEHDCLPFTYLGCKGGR-NRFSSAEACKTFCLPVVEALPAWRRERMGLLQFKTSQLSSTGATDESEGPVGQN--PACHEEVNTGEECDPPVEWESYWYYCPRTHRCRDFVYLGCKGTANRFTNHTACMAACMPNELRRSQQLARLRHSATKTSNMTGSEQKLQPEDNADFPVGLESMVDIANPKQDCQVTAWGAWGPCSAKCASEQGRRFRLRAILRPSRYGGKTCGPLYERTVC 846          
BLAST of Spondin-1 vs. TrEMBL
Match: tr|A0A0X3PKV3|A0A0X3PKV3_SCHSO (Uncharacterized protein OS=Schistocephalus solidus GN=TR92381 PE=4 SV=1)

HSP 1 Score: 313.923 bits (803), Expect = 2.844e-91
Identity = 204/598 (34.11%), Postives = 288/598 (48.16%), Query Frame = 1
Query:   22 VKSLFTSGWLNGEEQLNEERSGFVSVNRTHNLFSMISMMGPSPDWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEPDTIREINKIWMKSNPFTPDTPVAEITLTRVEPQKDTQCVKTPVKGVNEFQN-----------------------AQKESRSNT-------LGRNGAVEKYNVLDDPQLAQMAKAFCGFSEWTSWSPCSVKCGEGETSRTRNLIKNLKNELCIQLPRKEQKNCAGARLECDLXXXXXXXXXXXXXXXXASCTTEGKM-IRIRKFARSKEKDECMKNVKPEI------ILQQVKTCKLDKTDFRCDPISICSAGKLAPCINGKPKTRFFYHIKTGKCEPFKYYDCKKGNLNNFPTIDSCENVCSKVIQELPKIRRSNLALLQARTSY-----SAEESLSQKAKNIPEFCFHEVDSSKTC-MKSKPKTIWYYSHRNRKCQSLVDYDCKGTLNKFSTFDDCMKTCRPDSQLESLKLDKV----------------------------------------DCQVSEWSLWRPCSKSCG--WGTQYKKRVIQKDSLNGGLPCPVLYESRKC 1560
            + SL ++  + GEE LNE R+  ++VNRTH L S+++M+GPSPDWCTG+SG  +C   C W   L I LYP DAG++ G TY P N  RLD PD IR I++ WM  NPF    PVA +T+ R+ P+   QC      GV+ FQ                        +QK+ R           G +G++   + L DP LAQMA   C  S+W++W PCSV CG G   R R +I N K ELC  +    +++C G +  CD S  CSLLPW++WSPC+A+C +   +  R+RK   ++  +E   ++ P         L Q + C+L      CDP +IC  G       G+P   F+Y      C PF Y  CK G  N F + ++C+  C  V++ LP  RR  + LLQ +TS      + +ES     +N    C  EV++ + C    + ++ WYY  R  +C+  V   CKGT N+F+    CM  C P+    S +L ++                                        DCQV+ W  W PCS  C    G +++ R I + S  GG  C  LYE   C
Sbjct:  357 LHSLLSTPGMWGEETLNEPRTALIAVNRTHPLISLVTMLGPSPDWCTGISGQSVCKSDCTWVDKLEINLYPWDAGVRQGNTYMPKNADRLDIPDPIRYIDEKWMPGNPFYEHKPVARVTVQRILPEHAWQCTNRVADGVHLFQMGGTVMVSGKPANGSESVGAVQQVSQKKGRKGGKAVGFGGPGASGSLGTNDPLSDPSLAQMATFLCITSDWSAWGPCSVTCGVGSRKRQRTMISNKKPELCQHVQLTMEESCEGRQRTCDFSAPCSLLPWTAWSPCNATCQSPNHLGTRVRKRTLARRNEEGCDHLFPSARELATRTLVQTEECQLPPET--CDPATICGEGPKEGFPCGEPTPAFYYSAIEHDCLPFTYLGCKGGR-NRFSSAEACKTFCLPVVEALPAWRRERMGLLQFKTSQLSSTGATDESEGPVGQN--PACHEEVNTGEECDPPVEWESYWYYCPRTHRCRDFVYLGCKGTANRFTNHTACMAACMPNELRRSQQLARLRHSATKTSNMTGSEQKLQPEDNADFPVGLESMVDIANPKQDCQVTAWGAWGPCSAKCASEQGRRFRLRAILRPSRYGGKTCGPLYERTVC 949          
The following BLAST results are available for this feature:
BLAST of Spondin-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Human)
Total hits: 5
Match NameE-valueIdentityDescription
SPON11.446e-1626.51spondin 1 [Source:HGNC Symbol;Acc:HGNC:11252][more]
SPON27.205e-1530.65spondin 2 [Source:HGNC Symbol;Acc:HGNC:11253][more]
SPON27.205e-1530.65spondin 2 [Source:HGNC Symbol;Acc:HGNC:11253][more]
SPON27.205e-1530.65spondin 2 [Source:HGNC Symbol;Acc:HGNC:11253][more]
TFPI3.460e-726.43tissue factor pathway inhibitor [Source:HGNC Symbo... [more]
back to top
BLAST of Spondin-1 vs. Ensembl Celegans
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Celegan)
Total hits: 5
Match NameE-valueIdentityDescription
spon-12.445e-2428.82SPONdin (extracellular matrix glycoprotein) family... [more]
E01G6.13.874e-1130.57pep:known chromosome:WBcel235:X:12260884:12266557:... [more]
K10D3.47.365e-927.74pep:known chromosome:WBcel235:I:7134743:7139973:-1... [more]
mlt-117.162e-729.37pep:known chromosome:WBcel235:V:20667234:20678540:... [more]
mlt-117.496e-729.37pep:known chromosome:WBcel235:V:20667211:20678540:... [more]
back to top
BLAST of Spondin-1 vs. Ensembl Fly
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Drosophila)
Total hits: 5
Match NameE-valueIdentityDescription
fat-spondin1.024e-1932.02fat-spondin [Source:FlyBase gene name;Acc:FBgn0026... [more]
CG300461.570e-1928.20pep:known chromosome:BDGP6:2R:12314117:12317219:1 ... [more]
CG300461.570e-1928.20pep:known chromosome:BDGP6:2R:12314117:12317573:1 ... [more]
CG177399.781e-1928.51pep:known chromosome:BDGP6:2R:12306528:12310412:1 ... [more]
CG302039.507e-1624.02pep:known chromosome:BDGP6:2R:12310689:12313834:1 ... [more]
back to top
BLAST of Spondin-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Zebrafish)
Total hits: 5
Match NameE-valueIdentityDescription
spon1b1.178e-1928.69spondin 1b [Source:ZFIN;Acc:ZDB-GENE-000427-10][more]
spon1b1.212e-1928.69spondin 1b [Source:ZFIN;Acc:ZDB-GENE-000427-10][more]
spon1a6.961e-1727.20spondin 1a [Source:ZFIN;Acc:ZDB-GENE-000427-9][more]
spon2b2.483e-1328.80spondin 2b, extracellular matrix protein [Source:Z... [more]
spon2b2.483e-1328.80spondin 2b, extracellular matrix protein [Source:Z... [more]
back to top
BLAST of Spondin-1 vs. Ensembl Xenopus
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Xenopus)
Total hits: 3
Match NameE-valueIdentityDescription
spon11.779e-1630.77spondin 1, extracellular matrix protein [Source:Xe... [more]
spon25.675e-1028.37spondin 2, extracellular matrix protein [Source:Xe... [more]
thsd7b1.121e-640.35thrombospondin, type I, domain containing 7B [Sour... [more]
back to top
BLAST of Spondin-1 vs. Ensembl Mouse
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Mouse)
Total hits: 5
Match NameE-valueIdentityDescription
Spon14.845e-1727.71spondin 1, (f-spondin) extracellular matrix protei... [more]
Spon27.582e-1429.03spondin 2, extracellular matrix protein [Source:MG... [more]
Spint21.586e-926.67serine protease inhibitor, Kunitz type 2 [Source:M... [more]
Tfpi1.261e-628.03tissue factor pathway inhibitor [Source:MGI Symbol... [more]
Tfpi1.261e-628.03tissue factor pathway inhibitor [Source:MGI Symbol... [more]
back to top
BLAST of Spondin-1 vs. UniProt
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P35446|SPON1_RAT3.090e-1627.71Spondin-1 OS=Rattus norvegicus GN=Spon1 PE=1 SV=1[more]
sp|Q8VCC9|SPON1_MOUSE3.774e-1627.71Spondin-1 OS=Mus musculus GN=Spon1 PE=1 SV=1[more]
sp|Q9GLX9|SPON1_BOVIN5.727e-1626.51Spondin-1 OS=Bos taurus GN=SPON1 PE=1 SV=1[more]
sp|Q9HCB6|SPON1_HUMAN7.432e-1626.51Spondin-1 OS=Homo sapiens GN=SPON1 PE=1 SV=2[more]
sp|Q9BUD6|SPON2_HUMAN3.439e-1430.65Spondin-2 OS=Homo sapiens GN=SPON2 PE=1 SV=3[more]
back to top
BLAST of Spondin-1 vs. TrEMBL
Analysis Date: 2017-05-17 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
tr|A0A068XLR8|A0A068XLR8_HYMMI2.479e-9536.52SPONdin (Extracellular matrix glycoprotein) OS=Hym... [more]
tr|A0A0R3SRQ7|A0A0R3SRQ7_HYMDI7.586e-9336.85Uncharacterized protein OS=Hymenolepis diminuta PE... [more]
tr|A0A0R3U498|A0A0R3U498_9CEST5.382e-9235.87Uncharacterized protein OS=Mesocestoides corti PE=... [more]
tr|A0A0X3Q224|A0A0X3Q224_SCHSO6.155e-9234.11Spondin-1 OS=Schistocephalus solidus GN=SPON1 PE=4... [more]
tr|A0A0X3PKV3|A0A0X3PKV3_SCHSO2.844e-9134.11Uncharacterized protein OS=Schistocephalus solidus... [more]
back to top
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2016-09-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 21..43
NoneNo IPR availableTMHMMTMhelixcoord: 71..93
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..33
score: 0.504
NoneNo IPR availableTMHMMTMhelixcoord: 36..58
NoneNo IPR availableTMHMMTMhelixcoord: 10..29
NoneNo IPR availableGENE3DG3DSA:2.20.100.10coord: 186..232
e-value: 7.5E-11
score: 41.2
coord: 471..520
e-value: 2.7E-12
score: 45.9
NoneNo IPR availableGENE3DG3DSA:2.20.100.10coord: 245..298
e-value: 9.8E-7
score: 28.4
IPR000884Thrombospondin type-1 (TSP1) repeatSMARTSM00209TSP1_2coord: 247..303
e-value: 0.015
score: 24.5
coord: 188..240
e-value: 3.6E-8
score: 43.1
coord: 476..524
e-value: 6.2E-6
score: 35.7
IPR000884Thrombospondin type-1 (TSP1) repeatPFAMPF00090TSP_1coord: 477..525
e-value: 1.7E-7
score: 31.2
coord: 249..300
e-value: 1.0E-6
score: 28.7
coord: 189..221
e-value: 8.1E-6
score: 25.8
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 244..301
score: 8.364
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 473..524
score: 9.867
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 185..240
score: 10.099
IPR000884Thrombospondin type-1 (TSP1) repeatSUPERFAMILYSSF82895TSP-1 type 1 repeatcoord: 472..521
IPR000884Thrombospondin type-1 (TSP1) repeatSUPERFAMILYSSF82895TSP-1 type 1 repeatcoord: 186..232
IPR000884Thrombospondin type-1 (TSP1) repeatSUPERFAMILYSSF82895TSP-1 type 1 repeatcoord: 244..283
IPR002223Pancreatic trypsin inhibitor Kunitz domainSMARTSM00131KU_2coord: 403..459
e-value: 1.1E-6
score: 38.2
coord: 310..365
e-value: 6.7E-8
score: 42.2
IPR002223Pancreatic trypsin inhibitor Kunitz domainGENE3DG3DSA:4.10.410.10coord: 323..366
e-value: 5.5E-11
score: 41.9
IPR002223Pancreatic trypsin inhibitor Kunitz domainGENE3DG3DSA:4.10.410.10coord: 389..462
e-value: 1.9E-10
score: 40.0
IPR002223Pancreatic trypsin inhibitor Kunitz domainPFAMPF00014Kunitz_BPTIcoord: 320..364
e-value: 3.2E-10
score: 39.9
coord: 405..459
e-value: 1.4E-7
score: 31.5
IPR002223Pancreatic trypsin inhibitor Kunitz domainPROSITEPS50279BPTI_KUNITZ_2coord: 405..458
score: 10.517
IPR002223Pancreatic trypsin inhibitor Kunitz domainPROSITEPS50279BPTI_KUNITZ_2coord: 313..364
score: 11.742
IPR002223Pancreatic trypsin inhibitor Kunitz domainSUPERFAMILYSSF57362BPTI-likecoord: 321..368
IPR002223Pancreatic trypsin inhibitor Kunitz domainSUPERFAMILYSSF57362BPTI-likecoord: 400..460
IPR009465Spondin, N-terminalPFAMPF06468Spond_Ncoord: 8..110
e-value: 1.0E-23
score: 84.4
IPR009465Spondin, N-terminalPROSITEPS51020SPONDINcoord: 1..118
score: 26.152

Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000884TSP1_rpt
IPR002223Kunitz_BPTI
IPR009465Spondin_N
Vocabulary: molecular function
TermDefinition
GO:0004867serine-type endopeptidase inhibitor activity
Vocabulary: biological process
TermDefinition
GO:0010951negative regulation of endopeptidase activity
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000002Stage 2
PLANA:0000004Stage 4
PLANA:0000003Stage 3
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000029primitive ectoderm
PLANA:0000211primitive ectoderm cell
PLANA:0004517blastomere
PLANA:0000212blastomere compartment
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032088 ID=SMED30032088|Name=Spondin-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1776bp
TTACCTGAAAATAGATTAAATGTTAAGAGTCTCTTTACGTCAGGCTGGTT
AAATGGGGAAGAACAGCTAAATGAAGAGCGTTCTGGATTCGTTTCTGTTA
ATAGAACTCATAATTTATTTAGTATGATTTCAATGATGGGACCAAGTCCG
GATTGGTGTACCGGAGTGTCAGGAATCGATCTTTGTATGGACGGATGCAA
ATGGAAATCAAATCTAACAATTCCTCTTTATCCTATCGACGCTGGAATAC
AAACTGGAGAGACCTACAAACCAAATAATGTCACAAGACTTGATGAACCC
GACACTATTAGAGAAATTAATAAAATTTGGATGAAAAGTAATCCTTTTAC
TCCAGATACTCCAGTAGCAGAAATCACCCTCACCAGAGTAGAGCCACAGA
AAGACACACAATGTGTTAAAACTCCAGTTAAGGGTGTAAATGAATTTCAA
AATGCACAAAAAGAGTCTAGATCTAACACGCTCGGTAGAAATGGTGCCGT
GGAAAAATATAATGTTCTAGATGATCCTCAGTTAGCTCAAATGGCAAAAG
CCTTTTGTGGATTTTCCGAATGGACCAGCTGGTCACCATGTTCCGTAAAA
TGTGGAGAAGGTGAAACGTCTCGTACTAGAAATTTGATAAAAAACTTGAA
AAATGAATTGTGTATTCAATTGCCAAGAAAGGAGCAAAAAAATTGTGCCG
GTGCTCGATTGGAATGTGATCTCTCAAAGAAATGTAGTCTATTACCTTGG
AGCTCATGGAGTCCGTGTTCTGCATCTTGTACAACTGAAGGGAAAATGAT
CAGAATTAGAAAATTTGCGAGGTCAAAAGAAAAGGACGAATGCATGAAAA
ACGTCAAACCAGAAATTATTCTTCAACAAGTGAAAACTTGTAAATTGGAT
AAAACGGACTTCCGATGTGATCCGATATCAATTTGCAGCGCCGGTAAATT
GGCACCTTGCATCAATGGTAAACCCAAGACGAGATTTTTCTACCACATCA
AAACTGGAAAATGCGAACCGTTTAAATACTATGATTGCAAAAAAGGAAAT
CTGAACAATTTCCCAACTATAGATTCATGTGAAAATGTTTGCTCTAAAGT
TATTCAGGAATTACCAAAAATAAGACGATCTAATTTAGCCTTGCTTCAAG
CAAGAACATCTTATTCAGCTGAAGAGAGTCTTTCGCAAAAAGCCAAAAAC
ATTCCGGAATTCTGCTTTCATGAAGTGGATTCCAGTAAGACCTGCATGAA
ATCCAAACCAAAGACAATCTGGTATTATAGTCATCGAAATCGAAAATGCC
AATCACTGGTGGATTATGATTGTAAAGGAACTTTAAATAAGTTTTCGACT
TTCGACGATTGCATGAAAACCTGCCGACCTGATTCACAACTCGAATCATT
GAAACTTGATAAAGTAGATTGTCAGGTCTCTGAATGGAGTTTATGGAGGC
CATGTTCAAAGTCATGCGGTTGGGGAACTCAATACAAGAAAAGAGTCATT
CAAAAGGATTCATTGAATGGGGGCTTACCATGTCCGGTGCTATATGAATC
TCGAAAATGCTTTTCCAAACCTTGTTAATCTGTCAATATTTATTTAAAAA
TTGTTTTTTGTGAATTATAATTTCTATTTCTTAATCTATTTGAAAATGTA
ATAAATATTACTTTGCGTATTTGATTTAGTTTAAAGTTTTCTCATTGGTC
AATCCGCCGTTGCTAACCAATGAGATCGGCTACTACATCAATTGCGATAA
TTGACAGTGGTGAGCAAACCTTTAAG
back to top

protein sequence of SMED30032088-orf-1

>SMED30032088-orf-1 ID=SMED30032088-orf-1|Name=SMED30032088-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=526bp
LPENRLNVKSLFTSGWLNGEEQLNEERSGFVSVNRTHNLFSMISMMGPSP
DWCTGVSGIDLCMDGCKWKSNLTIPLYPIDAGIQTGETYKPNNVTRLDEP
DTIREINKIWMKSNPFTPDTPVAEITLTRVEPQKDTQCVKTPVKGVNEFQ
NAQKESRSNTLGRNGAVEKYNVLDDPQLAQMAKAFCGFSEWTSWSPCSVK
CGEGETSRTRNLIKNLKNELCIQLPRKEQKNCAGARLECDLSKKCSLLPW
SSWSPCSASCTTEGKMIRIRKFARSKEKDECMKNVKPEIILQQVKTCKLD
KTDFRCDPISICSAGKLAPCINGKPKTRFFYHIKTGKCEPFKYYDCKKGN
LNNFPTIDSCENVCSKVIQELPKIRRSNLALLQARTSYSAEESLSQKAKN
IPEFCFHEVDSSKTCMKSKPKTIWYYSHRNRKCQSLVDYDCKGTLNKFST
FDDCMKTCRPDSQLESLKLDKVDCQVSEWSLWRPCSKSCGWGTQYKKRVI
QKDSLNGGLPCPVLYESRKCFSKPC*
back to top
Aliases
The feature 'Spondin-1' has the following synonyms
Synonym
spondin1-like