ATP binding cassette subfamily A member 1

Overview
NameATP binding cassette subfamily A member 1
Smed IDSMED30032074
Length (bp)6489
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ATP binding cassette subfamily A member 1 (SMED30032074) t-SNE clustered cells

Violin plots show distribution of expression levels for ATP binding cassette subfamily A member 1 (SMED30032074) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ATP binding cassette subfamily A member 1 (SMED30032074) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ATP binding cassette subfamily A member 1 (SMED30032074) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032074

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30032074SMESG000068605.1 SMESG000068606.1 SmedASXL_080944SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30032074SMESG000068605.1 SmedASXL_008576SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30032074SMESG000068605.1 SmedASXL_000149SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30032074SMESG000056983.1 dd_Smed_v4_10304_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30032074SMESG000056983.1 dd_Smed_v4_10304_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30032074SMESG000056983.1 dd_Smed_v4_10304_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30032074SMESG000068605.1 dd_Smed_v6_41749_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30032074SMESG000056983.1 dd_Smed_v4_10304_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30032074SMESG000056983.1 dd_Smed_v4_10304_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Human
Match: ABCA1 (ATP binding cassette subfamily A member 1 [Source:HGNC Symbol;Acc:HGNC:29])

HSP 1 Score: 584.334 bits (1505), Expect = 0.000e+0
Identity = 371/1009 (36.77%), Postives = 554/1009 (54.91%), Query Frame = 2
Query:  737 VLYPIIGPLVFGKIYYTPNSAFTQEIIRRANSTFRILDNLRLASVEWR-LTFSNW-LINNSTNMGLLN----------------DARNYCANSRTLMC-----QIINNSLSIETIQSTIASLSAMFVLIENSLNCTQLNKFTPMPSSIDIDNLSKQ--SSLGILAGIVFTDDFQYVTPQNATF---LNYQIRMPASRIDSTKNFKVLDRFWTPIPRVNTLTNFNYYTSGFLFLQEIIDQAFIELITDNASVNIGSSMQIMPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTXXXXXXXXXXXXXXXXXGKXXXXXXXXXXXXXXXXXXXXXXCQCFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGL-SKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFL-EKSFE---------------IQSETCHNNKASESG--------------TKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTI--------NTANINGPKVSFEFENNLVL----------LSGLSLIFQQISGLFIKRFHHTKRNIKGLFSE 3532
            +++  + PL+ GKI YTP++  T++++   N TF+ L         W  L+   W  + NS  M L+                 D  ++ A             + +++ S+ T +      +     I   + C  LNK  P+ + + + N S +        AGIVFT     +TP +      + Y+IRM    ++ T   K+ D +W P PR +   +  Y   GF +LQ++++QA I ++T       G  MQ MPYPCY++D  +  +S  MP  + +AW  +V  +IK IVYEKE RLKE MR+MG+ N + W SWF S+++ L++   L+ +ILKLG +L +S P ++F+ L  + V  I QCF+IS  F  +N+AA  GGI+YF  YLP+++ + +QD +   +     LL+ V+F     +    E+   G Q+ NLF S + +  F +   + M+  D+  Y ++ WY+EAVFPG+YG+P+PWYF  T+ YW  F + +D      + ++R   I +   E+EP  L++G+ I+NLVK +      A+D L L FY+ QIT FLGHNGAGKTTT+SILTG+  PTSGTA+IL  DIR +M  IR  +G+CPQHN+LF  LTVE+HI+FY  LKG+++  +K ++  +  +VGL S KLK  +  LSGGM+RKLS+A+AFVG S+++ LDEPTAGVDP+SRRGIW+L++KYR   RTIIL+THHMDEAD L DRIAIIS GKL C GSSLFLK   G GYYL L +K  E               ++ E   +  +S++G              + +   I+K +  ++L+++   + T VL + +     F  LF ++D  L  L I+SYG+S+T+LEE+FLKVA++                 +D  T  G LP   +  +F  K          + A+ N   +  E     +L          + G  L  QQ   L  KR    +R+ KG F++
Sbjct:  370 IIWKALKPLLVGKILYTPDTPATRQVMAEVNKTFQELAVFHDLEGMWEELSPKIWTFMENSQEMDLVRMLLDSRDNDHFWEQQLDGLDWTAQDIVAFLAKHPEDVQSSNGSVYTWREAFNETNQAIRTISRFMECVNLNKLEPIATEVWLINKSMELLDERKFWAGIVFTG----ITPGSIELPHHVKYKIRMDIDNVERTN--KIKDGYWDPGPRADPFEDMRYVWGGFAYLQDVVEQAIIRVLTGTEK-KTGVYMQQMPYPCYVDDIFLRVMSRSMPLFMTLAWIYSVAVIIKGIVYEKEARLKETMRIMGLDNSILWFSWFISSLIPLLVSAGLLVVILKLGNLLPYSDPSVVFVFLSVFAVVTILQCFLISTLFSRANLAAACGGIIYFTLYLPYVLCVAWQDYVGFTLKIFASLLSPVAFGFGCEYFALFEEQGIGVQWDNLFESPVEEDGFNLTTSVSMMLFDTFLYGVMTWYIEAVFPGQYGIPRPWYFPCTKSYW--FGEESDEKSHPGSNQKRISEICM---EEEPTHLKLGVSIQNLVKVYRDGMKVAVDGLALNFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYILGKDIRSEMSTIRQNLGVCPQHNVLFDMLTVEEHIWFYARLKGLSEKHVKAEMEQMALDVGLPSSKLKSKTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYSRRGIWELLLKYRQ-GRTIILSTHHMDEADVLGDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKKDVESSLSSCRNSSSTVSYLKKEDSVSQSSSDAGLGSDHESDTLTIDVSAISNLIRKHVSEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGISETTLEEIFLKVAEESG---------------VDAETSDGTLPARRNRRAFGDKQSCLRPFTEDDAADPNDSDIDPESRETDLLSGMDGKGSYQVKGWKLTQQQFVALLWKRLLIARRSRKGFFAQ 1350          

HSP 2 Score: 507.679 bits (1306), Expect = 0.000e+0
Identity = 314/908 (34.58%), Postives = 494/908 (54.41%), Query Frame = 1
Query: 3604 PSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCM------NTSLYQLENFKCLYP--------YNTNKWSEKSPIEISLVTPECDCSTTGNQ----ICSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMK-----------QYGGLQFILPSFFGQSCQVIGESQIWFD----FRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNIS---GGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSV-KLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDS 6216
            PS+ + PW+   +       TF   +   D  + +L      D G  G RCM      +T     E      P        +    W+ ++P      +P C CS+   +    +C     G      R   ++D L DL+  NISDYL+K +   I K           +YGG      S    + Q +  SQ   D     ++ +  ++D++++    +FLN    F      K N+ ++W N+KG+ ++ ++ N+ +N +LR+ +   +   +YGI   N+PL  T+  L         ++V ++I VIF +SF+PASFV+FLI+ERV+ +K  Q++SGV P +YW+SNF WD   Y +   +VI+ F+ F  +SY+ S N+    +LL LY  ++ P MYP SF     STA+VV+++ NL +G   ++ TF L+L+   D  L + ND LK +FLIFP + LGRG+ID+  +    +     G +   +   WD+ G  + ++ +  V + LI V ++  ++  +  +  + KL P   + DED DV +ER+RI L+    ND+L++  LTKIY                      KRK AV+ I  G+  GECFGLLGVNGAGK++TFKML G+  +T G+A +N  SI+ +  + H+NMG+CPQFDA+  LLT  E + F+  +RG+   ++    + +++ L L  +  K     SGGNKRK+ TA+ALIG P +VFLDEPT GMD  ARRFLW    ++  E + +V+LTSH+MEECE LC R+AIMV+G  + +GSVQHLK++FG  Y + +R+  +   L    +   +     +  + +KE++  +++Y+  SS+  L+ IF +    +    +++YSVSQ +LD+VF+NFAK+ S
Sbjct: 1375 PSLELQPWMYNEQY------TFVSNDAPEDTGTLELLNALTKDPG-FGTRCMEGNPIPDTPCQAGEEEWTTAPVPQTIMDLFQNGNWTMQNP------SPACQCSSDKIKKMLPVCPPGAGGL-PPPQRKQNTADILQDLTGRNISDYLVKTYVQIIAKSLKNKIWVNEFRYGGF-----SLGVSNTQALPPSQEVNDAIKQMKKHLKLAKDSSAD----RFLNSLGRFMTGLDTKNNV-KVWFNNKGWHAISSFLNVINNAILRANLQKGENPSHYGITAFNHPLNLTKQQLSEVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVSKAKHLQFISGVKPVIYWLSNFVWDMCNYVVPATLVIIIFICFQQKSYVSSTNLPVLALLLLLYGWSITPLMYPASFVFKIPSTAYVVLTSVNLFIGINGSVATFVLELFT--DNKLNNINDILKSVFLIFPHFCLGRGLIDMVKNQAMADALERFGENRFVSPLSWDLVGRNLFAMAVEGVVFFLITVLIQ--YRFFIRPRPVNAKLSP---LNDEDEDVRRERQRI-LDGGGQNDILEIKELTKIY--------------------RRKRKPAVDRICVGIPPGECFGLLGVNGAGKSSTFKMLTGDTTVTRGDAFLNKNSILSNIHEVHQNMGYCPQFDAITELLTGREHVEFFALLRGVPEKEVGKVGEWAIRKLGLVKYGEKYAGNYSGGNKRKLSTAMALIGGPPVVFLDEPTTGMDPKARRFLWNCALSVVKEGR-SVVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGYTIVVRIAGSNPDLKPVQDFFGL----AFPGSVLKEKHRNMLQYQLPSSLSSLARIFSILSQSKKRLHIEDYSVSQTTLDQVFVNFAKDQS 2225          

HSP 3 Score: 182.57 bits (462), Expect = 3.937e-45
Identity = 131/417 (31.41%), Postives = 208/417 (49.88%), Query Frame = 2
Query: 2027 VGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKT--QWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISH 3271
            VG  L  + ++ V + LI   ++  F           F+  R      S  ND  E     RQR     +DG  +  D LEI    + L K + + + PA+D + +     +  G LG NGAGK++T  +LTG  T T G AF+  N I  ++  +   +G CPQ + +   LT  +H+ F+ LL+G+ + E+       ++++GL K  +  + N SGG KRKLS AMA +G   ++FLDEPT G+DP +RR +W+  +      R+++LT+H M+E + LC R+AI+  G+ +C GS   LK  FGDGY + +  +            ++     + +F     P S L ++ +   Q+ +  S +S  R     +F  L  S   L I  Y +S T+L++VF+  A D S   H
Sbjct: 1849 VGRNLFAMAVEGVVFFLITVLIQYRF-----------FIRPRPVNAKLSPLNDEDEDVRRERQR----ILDGGGQN-DILEI----KELTKIYRRKRKPAVDRICVGIPPGECFGLLGVNGAGKSSTFKMLTGDTTVTRGDAFLNKNSILSNIHEVHQNMGYCPQFDAITELLTGREHVEFFALLRGVPEKEVGKVGEWAIRKLGLVKYGEKYAGNYSGGNKRKLSTAMALIGGPPVVFLDEPTTGMDPKARRFLWNCALSVVKEGRSVVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGYTIVVRIA-----------GSNPDLKPVQDFFGLAFPGSVLKEKHRNMLQYQLPSSLSSLAR-----IFSILSQSKKRLHIEDYSVSQTTLDQVFVNFAKDQSDDDH 2229          

HSP 4 Score: 159.458 bits (402), Expect = 4.185e-38
Identity = 102/360 (28.33%), Postives = 170/360 (47.22%), Query Frame = 1
Query: 5293 EDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSL-TPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKI--------------------------------------RLHPNRNSLSDRNEIETIINKEIWSSARMKE----ENAVIIEYRFDSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRNISNGN 6243
             D  K+AV+ ++    EG+    LG NGAGKTTT  +L G    T G A I G  I  +     +N+G CPQ + L  +LT EE ++FY R++G+    +   ++    ++ L +      T  +SGG +RK+  A+A +G  K+V LDEPT G+D  +RR +W L+  L       +IL++H+M+E +VL  R+AI+  G++  +GS   LK++ G  YY+ +                                        H +     D + I  +I K + S AR+ E    E   ++ Y         ++F   +D  ++  +  Y +S+ +L+E+F+  A+   V    S+G 
Sbjct:  909 RDGMKVAVDGLALNFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYILGKDIRSEMSTIRQNLGVCPQHNVLFDMLTVEEHIWFYARLKGLSEKHVKAEMEQMALDVGLPSSKLKSKTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYSRRGIWELL--LKYRQGRTIILSTHHMDEADVLGDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKKDVESSLSSCRNSSSTVSYLKKEDSVSQSSSDAGLGSDHESDTLTIDVSAISNLIRKHV-SEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGISETTLEEIFLKVAEESGVDAETSDGT 1265          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Human
Match: ABCA7 (ATP binding cassette subfamily A member 7 [Source:HGNC Symbol;Acc:HGNC:37])

HSP 1 Score: 570.466 bits (1469), Expect = 1.442e-167
Identity = 340/979 (34.73%), Postives = 547/979 (55.87%), Query Frame = 2
Query:  737 VLYPIIGPLVFGKIYYTPNSAFTQEIIRRANSTFRILDNLRLASVEWRLTFSN--WLINNSTNMGLLN--------DARNYCANSRTLMCQI---INNSLSIETIQSTIASLSAMFVLIENSLNCTQLNKFTPMPSSIDIDNLSKQ--SSLGILAGIVF------TDDFQYVTPQ-NATFLNYQIRMPASRIDSTKNFKVLDRFWTPIPRVNTLTNFNYYTSGFLFLQEIIDQAFIELITDNASVNIGSSMQIMPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTXXXXXXXXXXXXXXXXXGKXXXXXXXXXXXXXXXXXXXXXXCQCFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFL-----------------EKSFEIQSETCHNNKASESGT-KLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANINGPKVSFEFENN-------LVLLSGLSLIFQQISGLFIKRFHHTKRNIKGLFSE 3532
            +L+  + PL+ GK+ + P++ FT++++ + N TF  L  LR     W +        +N+S+N+ +L           R      R  M  +   ++      + Q   A +  +   +     C  L+K    PS   + + + Q  +     AG+VF      +D  ++ TP      +  +IRM    +  T+  K+ DRFW P P  + LT+  Y   GF++LQ+++++A + +++  A+   G  +Q MPYPCY++D  +  LS  +P  L +AW  +VT  +K++V EKE RL++ MR MG+S  V W+ WF S +   +L   L+ ++LKLG IL +S P ++FL L  + V+ + Q F++S FF  +N+AA  GG+ YF  YLP+++ + ++D L         LL+ V+F      +  LE+  +GAQ+ N+      D+ F +     ++ +D+  Y L  WY+EAV PG+YG+P+PW F F R YW                   +  + +   E+ P  L  G+ + +L K+FP S  PAL  L+L FYQ  IT FLGHNGAGKTTT+SIL+G+  P+ G+AFIL +D+R  M  IR  +G+CPQ+N+LF  LTV++H++FYG LKG++ + +  +   ++++VGL  K    +++LSGGM+RKLS+A+AFVG S+++ LDEPTAGVDP SRRGIW+L++KYR   RT+IL+THH+DEA+ L DR+A+++ G+L CCGS LFL+++ G GYYL L                 E S + + E  + ++ S  GT +LL  ++  +P ++L++E   +  +VL +   +   F +LF +LD+ L  L++  YG+SDTSLEE+FLKV ++ +  +    E     + L T   G ++      L  +     TA  NG       E +       +  + G +L  QQ+  L +KRF   +R+ +GLF++
Sbjct:  282 LLWRRLKPLILGKLLFAPDTPFTRKLMAQVNRTFEELTLLRDVREVWEMLGPRIFTFMNDSSNVAMLQRLLQMQDEGRRQPRPGGRDHMEALRSFLDPGSGGYSWQDAHADVGHLVGTLGRVTECLSLDKLEAAPSEAALVSRALQLLAEHRFWAGVVFLGPEDSSDPTEHPTPDLGPGHVRIKIRMDIDVV--TRTNKIRDRFWDPGPAADPLTDLRYVWGGFVYLQDLVERAAVRVLS-GANPRAGLYLQQMPYPCYVDDVFLRVLSRSLPLFLTLAWIYSVTLTVKAVVREKETRLRDTMRAMGLSRAVLWLGWFLSCLGPFLLSAALLVLVLKLGDILPYSHPGVVFLFLAAFAVATVTQSFLLSAFFSRANLAAACGGLAYFSLYLPYVLCVAWRDRLPAGGRVAASLLSPVAFGFGCESLALLEEQGEGAQWHNVGTRPTADV-FSLAQVSGLLLLDAALYGLATWYLEAVCPGQYGIPEPWNFPFRRSYWCGPRPPKSPAPCPTPL---DPKVLV---EEAPPGLSPGVSVRSLEKRFPGSPQPALRGLSLDFYQGHITAFLGHNGAGKTTTLSILSGLFPPSGGSAFILGHDVRSSMAAIRPHLGVCPQYNVLFDMLTVDEHVWFYGRLKGLSAAVVGPEQDRLLQDVGLVSKQSVQTRHLSGGMQRKLSVAIAFVGGSQVVILDEPTAGVDPASRRGIWELLLKYRE-GRTLILSTHHLDEAELLGDRVAVVAGGRLCCCGSPLFLRRHLGSGYYLTLVKARLPLTTNEKADTDMEGSVDTRQEKKNGSQGSRVGTPQLLALVQHWVPGARLVEELPHELVLVLPYTGAHDGSFATLFRELDTRLAELRLTGYGISDTSLEEIFLKVVEECA--ADTDMEDGSCGQHLCTGIAGLDV-----TLRLKMPPQETALENGEPAGSAPETDQGSGPDAVGRVQGWALTRQQLQALLLKRFLLARRSRRGLFAQ 1242          

HSP 2 Score: 453.751 bits (1166), Expect = 8.995e-129
Identity = 275/831 (33.09%), Postives = 440/831 (52.95%), Query Frame = 1
Query: 3811 TNKWSEKSPIEISLVTPECDCSTTGNQI----CSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMK-----------QYGGLQFILPSFFGQSCQVIGES--QIWFDFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDL--------SFSYLRYNISGGDENYNA-FEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLSDIFRVFEDLRTN---EMVKEYSVSQMSLDEVFINFAKNDS 6216
            +  W+ +SP      +P C CS  G +     C +   G       +  S + + +L+  N+SD+L+K +   + +           +YGG           S Q +G S  ++W         + D        + L     + +S   + +L +IW N+KG+ SM A+ N  SN +LR+ +    A   + I   N+PL  T+  L         ++V ++I V+F +SF+PASF + LIEERVT +K  Q + G++P +YW+ NF WD   Y +   IV+L FLAF  ++Y+   N+ A ++LL LY  ++ P MYP SFF S  STA+VV++  NL +G   ++ TF L+L  + D  L+  +  LK++FLIFP + LGRG+ID+        +F  L      GD  + +   W++ G  +  L ++  G   ++  +  +H+  L   L   +++   ++ +ED DV +ERER+ +      DVL +  LTK+Y                      +R  AV+ +  G+  GECFGLLGVNGAGKT+TF+M+ G+   + G A++ G+S+  +   AH +MG+CPQ DA+  LLT  E L    R+RG+  + +       L  L L+ + ++P    SGGNKRK+ TA+AL+G P +VFLDEPT GMD  ARRFLW  +  +  E + +V+LTSH+MEECE LC RLAIMV+G  + +GS QHLK +F   + + +R+       + R++         +  A ++E +   + ++     + + + RVF +L  +     V+++SVSQ  L+EVF+ F+K+  
Sbjct: 1333 SGNWTPESP------SPACQCSRPGARRLLPDCPAAAGGP-PPPQAVTGSGEVVQNLTGRNLSDFLVKTYPRLVRQGLKTKKWVNEVRYGGFSLGGRDPGLPSGQELGRSVEELWALLSPLPGGALD--------RVLKNLTAWAHSLDAQDSL-KIWFNNKGWHSMVAFVNRASNAILRAHLPPGPARHAHSITTLNHPLNLTKEQLSEGALMASSVDVLVSICVVFAMSFVPASFTLVLIEERVTRAKHLQLMGGLSPTLYWLGNFLWDMCNYLVPACIVVLIFLAFQQRAYVAPANLPALLLLLLLYGWSITPLMYPASFFFSVPSTAYVVLTCINLFIGINGSMATFVLEL--FSDQKLQEVSRILKQVFLIFPHFCLGRGLIDMVRNQAMADAFERL------GDRQFQSPLRWEVVGKNL--LAMVIQGPLFLLFTLLLQHRSQL---LPQPRVRSLPLLGEEDEDVARERERV-VQGATQGDVLVLRNLTKVYR--------------------GQRMPAVDRLCLGIPPGECFGLLGVNGAGKTSTFRMVTGDTLASRGEAVLAGHSVAREPSAAHLSMGYCPQSDAIFELLTGREHLELLARLRGVPEAQVAQTAGSGLARLGLSWYADRPAGTYSGGNKRKLATALALVGDPAVVFLDEPTTGMDPSARRFLWNSLLAVVREGR-SVMLTSHSMEECEALCSRLAIMVNGRFRCLGSPQHLKGRFAAGHTLTLRVP------AARSQPAAAFVAAEFPGAELREAHGGRLRFQLPPGGRCA-LARVFGELAVHGAEHGVEDFSVSQTMLEEVFLYFSKDQG 2105          

HSP 3 Score: 161.384 bits (407), Expect = 1.191e-38
Identity = 97/338 (28.70%), Postives = 166/338 (49.11%), Query Frame = 2
Query: 2276 ILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQ 3289
            +++ NL K +   + PA+D L L     +  G LG NGAGKT+T  ++TG    + G A +  + +  +       +G CPQ + +F  LT  +H+     L+G+ ++++       +  +GLS      +   SGG KRKL+ A+A VG+  ++FLDEPT G+DP +RR +W+ ++      R+++LT+H M+E + LC R+AI+  G+ +C GS   LK  F  G+ L L      +     +  A+        F+    P ++L +    +    L      R     +F +L        +  + +S T LEEVFL  + D  +     ++K+
Sbjct: 1793 LVLRNLTKVYRGQRMPAVDRLCLGIPPGECFGLLGVNGAGKTSTFRMVTGDTLASRGEAVLAGHSVAREPSAAHLSMGYCPQSDAIFELLTGREHLELLARLRGVPEAQVAQTAGSGLARLGLSWYADRPAGTYSGGNKRKLATALALVGDPAVVFLDEPTTGMDPSARRFLWNSLLAVVREGRSVMLTSHSMEECEALCSRLAIMVNGRFRCLGSPQHLKGRFAAGHTLTL------RVPAARSQPAA-------AFVAAEFPGAELREAHGGRLRFQLPPG--GRCALARVFGELAVHGAEHGVEDFSVSQTMLEEVFLYFSKDQGKDEDTEEQKE 2115          

HSP 4 Score: 152.525 bits (384), Expect = 5.405e-36
Identity = 102/357 (28.57%), Postives = 175/357 (49.02%), Query Frame = 1
Query: 5278 INVSSEDKR-----KLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYY---VKIRLHPNRNSLSD---RNEIETIINK------------------EIW-SSARMKEENA----VIIEYRFDSSVKLSDIFRVFEDLRTNEM-VKEYSVSQMSLDEVFINFAKNDSVTRNISNGN 6243
            ++V S +KR     + A+  +S    +G     LG NGAGKTTT  +L G    + G+A I G+ +         ++G CPQ++ L  +LT +E ++FY R++G+  + +    D  L+++ L    +  T  +SGG +RK+  AIA +G  ++V LDEPT G+D  +RR +W L+  L       +IL++H+++E E+L  R+A++  G +   GS   L+   G  YY   VK RL    N  +D      ++T   K                  + W   AR+ EE      +++ Y        + +FR   D R  E+ +  Y +S  SL+E+F+   +  +   ++ +G+
Sbjct:  807 VSVRSLEKRFPGSPQPALRGLSLDFYQGHITAFLGHNGAGKTTTLSILSGLFPPSGGSAFILGHDVRSSMAAIRPHLGVCPQYNVLFDMLTVDEHVWFYGRLKGLSAAVVGPEQDRLLQDVGLVSKQSVQTRHLSGGMQRKLSVAIAFVGGSQVVILDEPTAGVDPASRRGIWELL--LKYREGRTLILSTHHLDEAELLGDRVAVVAGGRLCCCGSPLFLRRHLGSGYYLTLVKARLPLTTNEKADTDMEGSVDTRQEKKNGSQGSRVGTPQLLALVQHWVPGARLVEELPHELVLVLPYTGAHDGSFATLFREL-DTRLAELRLTGYGISDTSLEEIFLKVVEECAADTDMEDGS 1160          

HSP 5 Score: 54.6842 bits (130), Expect = 2.660e-6
Identity = 24/61 (39.34%), Postives = 34/61 (55.74%), Query Frame = 2
Query:  143 PFSLIIEMLIPLFVIFILVAVRRITSSYSMGTCELREKQMGSMGPIPFLRDFICTFNTSCY 325
            P  L++E+L PLF+ FILVAVR          C    K + S G +P+L+  IC  N +C+
Sbjct:   22 PVQLLVELLWPLFLFFILVAVRHSHPPLEHHECHFPNKPLPSAGTVPWLQGLICNVNNTCF 82          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Human
Match: ABCA4 (ATP binding cassette subfamily A member 4 [Source:HGNC Symbol;Acc:HGNC:34])

HSP 1 Score: 549.28 bits (1414), Expect = 6.430e-160
Identity = 381/1109 (34.36%), Postives = 581/1109 (52.39%), Query Frame = 2
Query:  503 ISPVISSFI--TSIKE--------MQTGDQTLINKNLKILGQLLCGSDQNDIDVFLQ-------NFNLSL-INSTKSIPTCQL-----AFMNYFTKS---NGLS-VLYPIIGPLVFGKIYYTPNSAFTQEIIRRANSTFRILDNLRLASVEWRLTFSN--WLINNSTNMGLLNDARNYCANSRTLMCQIINNSLSIETI--------QSTIASLSAMF-------------VLIENSLNCTQLNKFTPMPSSIDIDNLSKQSSLGIL------AGIVFTDDFQYVTPQNATFLNYQIRMPASRIDSTKNFKVLDRFWTPIPRVNTLTNFNYYTSGFLFLQEIIDQAFIELITDNASVNIGSSMQIMPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTXXXXXXXXXXXXXXXXXGKXXXXXXXXXXXXXXXXXXXXXXCQCFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIP----FSKNNDNIEISDNFRQREEN------ITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFE-IQSE------TCHNNKASESGT-------------------KLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADD-------PSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANINGPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGLFSE 3532
            +SP I  FI   S+++        MQ G      K + IL  LLCG  +      L        N+   L I+ST+  P         +F N   +S   N L+ + +    PL+ GKI YTP+S   + I++ ANSTF  L+++R     W        +  +NST M ++ D          L  Q+    ++ E I        + + A   A F              L+   L C  L+KF     S + +    Q +L +L      AG+VF D + + T      + Y+IRM    ++ T   K+ DR+W   PR + + +F Y   GF +LQ++++Q  I      A   +G  +Q MPYPC+++D  +  L+   P  +V+AW  +V+  +KSIV EKE RLKE ++  G+SN V W +WF  +  I+ + I L+TI +  G+IL +S P I+FL L  +  + I  CF++S FF  +++AA   G++YF  YLP ++   +QD ++ E+   V LL+ V+F     ++   E+   G Q+SN+ NS      F     + M+ +D+  Y L+AWY++ VFPG YG P PWYFL    YW+      ++    +E ++   +  E+      I    FE+E      G+ ++NLVK F     PA+D LN+ FY++QIT FLGHNGAGKTTT+SILTG+L PTSGT  +   DI   ++ +R  +G+CPQHNILF +LTV +H+ FY  LKG ++ E + ++  ++++ GL  K    +++LSGGM+RKLS+A+AFVG+++++ LDEPT+GVDP+SRR IWDL++KYRS  RTII++THHMDEAD L DRIAII+QG+L C G+ LFLK  FG G YL L +  + IQS+      TC  +    S T                   +L++ +   +P +KL++    +   +L + +     + SLF +L+ +L  L ++S+G+SDT LEE+FLKV +D             KR+        L      G  P+  +V S        A+  G            L +G  L+ Q +  L +KRF HT R+ K   ++
Sbjct:  280 MSPRIQEFIHRPSMQDLLWVTRPLMQNGGPETFTKLMGILSDLLCGYPEGGGSRVLSFNWYEDNNYKAFLGIDSTRKDPIYSYDRRTTSFCNALIQSLESNPLTKIAWRAAKPLLMGKILYTPDSPAARRILKNANSTFEELEHVRKLVKAWEEVGPQIWYFFDNSTQMNMIRDTLGNPTVKDFLNRQLGEEGITAEAILNFLYKGPRESQADDMANFDWRDIFNITDRTLRLVNQYLECLVLDKF----ESYNDETQLTQRALSLLEENMFWAGVVFPDMYPW-TSSLPPHVKYKIRMDIDVVEKTN--KIKDRYWDSGPRADPVEDFRYIWGGFAYLQDMVEQG-ITRSQVQAEAPVGIYLQQMPYPCFVDDSFMIILNRCFPIFMVLAWIYSVSMTVKSIVLEKELRLKETLKNQGVSNAVIWCTWFLDSFSIMSMSIFLLTIFIMHGRILHYSDPFILFLFLLAFSTATIMLCFLLSTFFSKASLAAACSGVIYFTLYLPHILCFAWQDRMTAELKKAVSLLSPVAFGFGTEYLVRFEEQGLGLQWSNIGNSPTEGDEFSFLLSMQMMLLDAAVYGLLAWYLDQVFPGDYGTPLPWYFLLQESYWLGGEGCSTREERALEKTEPLTEETEDPEHPEGIHDSFFEREHPGWVPGVCVKNLVKIFEPCGRPAVDRLNITFYENQITAFLGHNGAGKTTTLSILTGLLPPTSGTVLVGGRDIETSLDAVRQSLGMCPQHNILFHHLTVAEHMLFYAQLKGKSQEEAQLEMEAMLEDTGLHHKRNEEAQDLSGGMQRKLSVAIAFVGDAKVVILDEPTSGVDPYSRRSIWDLLLKYRS-GRTIIMSTHHMDEADLLGDRIAIIAQGRLYCSGTPLFLKNCFGTGLYLTLVRKMKNIQSQRKGSEGTCSCSSKGFSTTCPAHVDDLTPEQVLDGDVNELMDVVLHHVPEAKLVECIGQELIFLLPNKNFKHRAYASLFRELEETLADLGLSSFGISDTPLEEIFLKVTEDSDSGPLFAGGAQQKRENVNPRHPCLGPREKAGQTPQDSNVCS---PGAPAAHPEGQPPPEPECPGPQLNTGTQLVLQHVQALLVKRFQHTIRSHKDFLAQ 1376          

HSP 2 Score: 513.842 bits (1322), Expect = 5.454e-148
Identity = 308/835 (36.89%), Postives = 477/835 (57.13%), Query Frame = 1
Query: 3805 YNTNKWSEKSPIEISLVTPECDCSTTG--NQICSSPL-SGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIM-----------KQYGGLQFILPSFFGQ--SCQVIGESQIWF--DFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFS------YLRYNISGGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPY-EIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLH-PNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRNI 6231
            +   KW++ +P      +P C CST      +   P  +GG     R   S++ L DL+  NISD+L+K +   I            ++YGG+     S  G+     + GE+ + F  D  + +N S    +     +  ++ +       IK     +W N+KG+ ++ ++ N+  N +LR+++   ++ + YGI V + PL  T+  L         ++  +AI VIF +SF+PASFV++LI+ERV  SK  Q++SGV+P  YW++NF WD + YS+S  +V+  F+ F  ++Y   +N+ A + LL LY  AVIP MYP SF     STA+V +S  NL +G  ++  TF L+L++ ++ +L   N  L+K+ ++FP + LGRG+IDL+ S      Y R+   G + + N F WD+ G  + ++ +  V + L+ + ++ +H       L     +P  E I DED DV +ER+RI +      D+L+++ LTKIY                  SS      AV+ +  GV+ GECFGLLGVNGAGKTTTFKML G+  +T G+A + G SI+ +  + H+NMG+CPQFDA+  LLT  E LY Y R+RG+   +I    + S+K+L LT + +      SGGNKRK+ TAIALIG P +V LDEPT GMD  ARR LW +I ++  E + AV+LTSH+MEECE LC RLAIMV G  + +G++QHLKSKFG  Y V +++  P  + L D N +E         S + +E +  +++++  SS  L+ IF++    + + +++EYSV+Q +LD+VF+NFAK  + + ++
Sbjct: 1474 FQKQKWTQVNP------SPSCRCSTREKLTMLPECPEGAGGLPPPQRTQRSTEILQDLTDRNISDFLVKTYPALIRSSLKSKFWVNEQRYGGI-----SIGGKLPVVPITGEALVGFLSDLGRIMNVSGGPITREASKEIPDFLKHLETEDNIK-----VWFNNKGWHALVSFLNVAHNAILRASLPKDRSPEEYGITVISQPLNLTKEQLSEITVLTTSVDAVVAICVIFSMSFVPASFVLYLIQERVNKSKHLQFISGVSPTTYWVTNFLWDIMNYSVSAGLVVGIFIGFQKKAYTSPENLPALVALLLLYGWAVIPMMYPASFLFDVPSTAYVALSCANLFIGINSSAITFILELFE-NNRTLLRFNAVLRKLLIVFPHFCLGRGLIDLALSQAVTDVYARF---GEEHSANPFHWDLIGKNLFAMVVEGVVYFLLTLLVQ-RH-----FFLSQWIAEPTKEPIVDEDDDVAEERQRI-ITGGNKTDILRLHELTKIYP---------------GTSSP-----AVDRLCVGVRPGECFGLLGVNGAGKTTTFKMLTGDTTVTSGDATVAGKSILTNISEVHQNMGYCPQFDAIDELLTGREHLYLYARLRGVPAEEIEKVANWSIKSLGLTVYADCLAGTYSGGNKRKLSTAIALIGCPPLVLLDEPTTGMDPQARRMLWNVIVSIIREGR-AVVLTSHSMEECEALCTRLAIMVKGAFRCMGTIQHLKSKFGDGYIVTMKIKSPKDDLLPDLNPVEQFFQGNFPGSVQ-RERHYNMLQFQVSSS-SLARIFQLLLSHKDSLLIEEYSVTQTTLDQVFVNFAKQQTESHDL 2258          

HSP 3 Score: 174.096 bits (440), Expect = 1.749e-42
Identity = 125/415 (30.12%), Postives = 205/415 (49.40%), Query Frame = 2
Query: 2027 VGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISH 3271
            +G  L  + ++ V Y L+   V+             +F  ++  WI        ++  D+  +  + I   G   + D L +      L K +P + +PA+D L +     +  G LG NGAGKTTT  +LTG  T TSG A +    I  ++  +   +G CPQ + +   LT  +H+Y Y  L+G+   EI+      +K +GL+    C++   SGG KRKLS A+A +G   ++ LDEPT G+DP +RR +W++IV      R ++LT+H M+E + LC R+AI+ +G  +C G+   LK  FGDGY +    + +I+S     +        + +F +   P S   +         +S +S  R     +F+ L S  D L I  Y ++ T+L++VF+  A   ++ SH
Sbjct: 1875 IGKNLFAMVVEGVVYFLLTLLVQR------------HFFLSQ--WIAEPTKEPIVDEDDDVAEERQRIITGG--NKTDILRL----HELTKIYPGTSSPAVDRLCVGVRPGECFGLLGVNGAGKTTTFKMLTGDTTVTSGDATVAGKSILTNISEVHQNMGYCPQFDAIDELLTGREHLYLYARLRGVPAEEIEKVANWSIKSLGLTVYADCLAGTYSGGNKRKLSTAIALIGCPPLVLLDEPTTGMDPQARRMLWNVIVSIIREGRAVVLTSHSMEECEALCTRLAIMVKGAFRCMGTIQHLKSKFGDGYIV----TMKIKSP---KDDLLPDLNPVEQFFQGNFPGSVQRERHYNMLQFQVSSSSLAR-----IFQLLLSHKDSLLIEEYSVTQTTLDQVFVNFAKQQTE-SH 2256          

HSP 4 Score: 130.954 bits (328), Expect = 2.206e-29
Identity = 71/219 (32.42%), Postives = 118/219 (53.88%), Query Frame = 1
Query: 5305 KLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKI 5961
            + AV+ ++    E +    LG NGAGKTTT  +L G    T G  ++ G  I        +++G CPQ + L   LT  E + FY +++G    +  + ++  L++  L    N+    +SGG +RK+  AIA +G  K+V LDEPT G+D  +RR +W L+  L       +I+++H+M+E ++L  R+AI+  G +   G+   LK+ FG   Y+ +
Sbjct:  943 RPAVDRLNITFYENQITAFLGHNGAGKTTTLSILTGLLPPTSGTVLVGGRDIETSLDAVRQSLGMCPQHNILFHHLTVAEHMLFYAQLKGKSQEEAQLEMEAMLEDTGLHHKRNEEAQDLSGGMQRKLSVAIAFVGDAKVVILDEPTSGVDPYSRRSIWDLL--LKYRSGRTIIMSTHHMDEADLLGDRIAIIAQGRLYCSGTPLFLKNCFGTGLYLTL 1159          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Human
Match: ABCA4 (ATP binding cassette subfamily A member 4 [Source:HGNC Symbol;Acc:HGNC:34])

HSP 1 Score: 515.768 bits (1327), Expect = 7.733e-157
Identity = 308/835 (36.89%), Postives = 477/835 (57.13%), Query Frame = 1
Query: 3805 YNTNKWSEKSPIEISLVTPECDCSTTG--NQICSSPL-SGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIM-----------KQYGGLQFILPSFFGQ--SCQVIGESQIWF--DFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFS------YLRYNISGGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPY-EIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLH-PNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRNI 6231
            +   KW++ +P      +P C CST      +   P  +GG     R   S++ L DL+  NISD+L+K +   I            ++YGG+     S  G+     + GE+ + F  D  + +N S    +     +  ++ +       IK     +W N+KG+ ++ ++ N+  N +LR+++   ++ + YGI V + PL  T+  L         ++  +AI VIF +SF+PASFV++LI+ERV  SK  Q++SGV+P  YW++NF WD + YS+S  +V+  F+ F  ++Y   +N+ A + LL LY  AVIP MYP SF     STA+V +S  NL +G  ++  TF L+L++ ++ +L   N  L+K+ ++FP + LGRG+IDL+ S      Y R+   G + + N F WD+ G  + ++ +  V + L+ + ++ +H       L     +P  E I DED DV +ER+RI +      D+L+++ LTKIY                  SS      AV+ +  GV+ GECFGLLGVNGAGKTTTFKML G+  +T G+A + G SI+ +  + H+NMG+CPQFDA+  LLT  E LY Y R+RG+   +I    + S+K+L LT + +      SGGNKRK+ TAIALIG P +V LDEPT GMD  ARR LW +I ++  E + AV+LTSH+MEECE LC RLAIMV G  + +G++QHLKSKFG  Y V +++  P  + L D N +E         S + +E +  +++++  SS  L+ IF++    + + +++EYSV+Q +LD+VF+NFAK  + + ++
Sbjct:  266 FQKQKWTQVNP------SPSCRCSTREKLTMLPECPEGAGGLPPPQRTQRSTEILQDLTDRNISDFLVKTYPALIRSSLKSKFWVNEQRYGGI-----SIGGKLPVVPITGEALVGFLSDLGRIMNVSGGPITREASKEIPDFLKHLETEDNIK-----VWFNNKGWHALVSFLNVAHNAILRASLPKDRSPEEYGITVISQPLNLTKEQLSEITVLTTSVDAVVAICVIFSMSFVPASFVLYLIQERVNKSKHLQFISGVSPTTYWVTNFLWDIMNYSVSAGLVVGIFIGFQKKAYTSPENLPALVALLLLYGWAVIPMMYPASFLFDVPSTAYVALSCANLFIGINSSAITFILELFE-NNRTLLRFNAVLRKLLIVFPHFCLGRGLIDLALSQAVTDVYARF---GEEHSANPFHWDLIGKNLFAMVVEGVVYFLLTLLVQ-RH-----FFLSQWIAEPTKEPIVDEDDDVAEERQRI-ITGGNKTDILRLHELTKIYP---------------GTSSP-----AVDRLCVGVRPGECFGLLGVNGAGKTTTFKMLTGDTTVTSGDATVAGKSILTNISEVHQNMGYCPQFDAIDELLTGREHLYLYARLRGVPAEEIEKVANWSIKSLGLTVYADCLAGTYSGGNKRKLSTAIALIGCPPLVLLDEPTTGMDPQARRMLWNVIVSIIREGR-AVVLTSHSMEECEALCTRLAIMVKGAFRCMGTIQHLKSKFGDGYIVTMKIKSPKDDLLPDLNPVEQFFQGNFPGSVQ-RERHYNMLQFQVSSS-SLARIFQLLLSHKDSLLIEEYSVTQTTLDQVFVNFAKQQTESHDL 1050          

HSP 2 Score: 174.481 bits (441), Expect = 4.808e-43
Identity = 125/415 (30.12%), Postives = 205/415 (49.40%), Query Frame = 2
Query: 2027 VGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISH 3271
            +G  L  + ++ V Y L+   V+             +F  ++  WI        ++  D+  +  + I   G   + D L +      L K +P + +PA+D L +     +  G LG NGAGKTTT  +LTG  T TSG A +    I  ++  +   +G CPQ + +   LT  +H+Y Y  L+G+   EI+      +K +GL+    C++   SGG KRKLS A+A +G   ++ LDEPT G+DP +RR +W++IV      R ++LT+H M+E + LC R+AI+ +G  +C G+   LK  FGDGY +    + +I+S     +        + +F +   P S   +         +S +S  R     +F+ L S  D L I  Y ++ T+L++VF+  A   ++ SH
Sbjct:  667 IGKNLFAMVVEGVVYFLLTLLVQR------------HFFLSQ--WIAEPTKEPIVDEDDDVAEERQRIITGG--NKTDILRL----HELTKIYPGTSSPAVDRLCVGVRPGECFGLLGVNGAGKTTTFKMLTGDTTVTSGDATVAGKSILTNISEVHQNMGYCPQFDAIDELLTGREHLYLYARLRGVPAEEIEKVANWSIKSLGLTVYADCLAGTYSGGNKRKLSTAIALIGCPPLVLLDEPTTGMDPQARRMLWNVIVSIIREGRAVVLTSHSMEECEALCTRLAIMVKGAFRCMGTIQHLKSKFGDGYIV----TMKIKSP---KDDLLPDLNPVEQFFQGNFPGSVQRERHYNMLQFQVSSSSLAR-----IFQLLLSHKDSLLIEEYSVTQTTLDQVFVNFAKQQTE-SH 1048          

HSP 3 Score: 65.855 bits (159), Expect = 9.286e-10
Identity = 44/164 (26.83%), Postives = 73/164 (44.51%), Query Frame = 2
Query: 3062 IPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQ-------ISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANINGPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGLFSE 3532
            +P +KL++    +   +L + +     + SLF +L+ +L  L ++S+G+SDT LEE+FLKV +D             KR+        L      G  P+  +V S        A+  G            L +G  L+ Q +  L +KRF HT R+ K   ++
Sbjct:    8 VPEAKLVECIGQELIFLLPNKNFKHRAYASLFRELEETLADLGLSSFGISDTPLEEIFLKVTEDSDSGPLFAGGAQQKRENVNPRHPCLGPREKAGQTPQDSNVCS---PGAPAAHPEGQPPPEPECPGPQLNTGTQLVLQHVQALLVKRFQHTIRSHKDFLAQ 168          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Human
Match: ABCA2 (ATP binding cassette subfamily A member 2 [Source:HGNC Symbol;Acc:HGNC:32])

HSP 1 Score: 494.582 bits (1272), Expect = 2.451e-149
Identity = 307/815 (37.67%), Postives = 468/815 (57.42%), Query Frame = 2
Query: 1325 YYTSGFLFLQEIIDQAFIELITDNASVNIGSSMQIMPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTXXXXXXXXXXXXXXXXXGKXXXXXXXXXXXXXXXXXXXXXXCQCFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYG-----VGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWI------------PFSKN------NDNIEISDNFRQREENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFE----------IQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLT----------DGGNLPRPVSVLSFRKKTINTANINGPKVSFE--------------FEN-----NLVL-----------------LSGLSLIFQQISGLFIKRFHHTKRNIKGLFSE 3532
            Y+  GF+++Q+++++A I+    +  V  GS +Q+ PYPCY  D  +  + ++MP  +VI+W  +V   I+ IV EKE+RLKE M+ MG++N VHWV+WF +  + L + +  +T ILK G++L  S  +II+L L  Y V+ I  CF++SV +  + +A+  GGI+YF+ Y+P++ ++  ++E++ +           L++  +F     +    E A  G Q+     S +   +F +   + M+ +D+V Y ++ WY+EAV PG YG+P+PWYF   + YW+            P+++        ++   +   R+ EE     G E+EP  L + + ++ L K +   K  AL+ L+L  Y++Q+  FLGHNGAGKTTT+SILTG+  PTSG+A I  +DIR +M+ IR  +G+CPQHN+LF  LTVE+H++FY  LK M + EI+ ++  +++++ LS K   + + LSGGMKRKLS+A+AFVG SR I LDEPTAGVDP++RR IWDLI+KY+   RTI+L+THHMDEAD L DRIAIIS GKLKCCGS LFLK  +GDGY L L K               S       +S S  ++ +FI+K + +  L+ +T T+ + +L   +  +  F  LF+ L+ SLD L ++S+GL DT+LEEVFLKV+++   +  +  E  +     D L             GNL R  S L+  + ++ +A+  G     E              F+N     N+ L                 L G  L  +Q  GL +KRFH  +RN K LFS+
Sbjct:    2 YFLYGFVWIQDMMERAIIDTFVGHDVVEPGSYVQMFPYPCYTRDDFLFVIEHMMPLCMVISWVYSVAMTIQHIVAEKEHRLKEVMKTMGLNNAVHWVAWFITGFVQLSISVTALTAILKYGQVLMHSHVVIIWLFLAVYAVATIMFCFLVSVLYSKAKLASACGGIIYFLSYVPYM-YVAIREEVAHDKITAFEKCIASLMSTTAFGLGSKYFALYEVAGVGIQWHTFSQSPVEGDDFNLLLAVTMLMVDAVVYGILTWYIEAVHPGMYGLPRPWYFPLQKSYWLGSGRTEAWEWSWPWARTPRLSVMEEDQACAMESRRFEET---RGMEEEPTHLPLVVCVDKLTKVYKDDKKLALNKLSLNLYENQVVSFLGHNGAGKTTTMSILTGLFPPTSGSATIYGHDIRTEMDEIRKNLGMCPQHNVLFDRLTVEEHLWFYSRLKSMAQEEIRREMDKMIEDLELSNKRHSLVQTLSGGMKRKLSVAIAFVGGSRAIILDEPTAGVDPYARRAIWDLILKYKP-GRTILLSTHHMDEADLLGDRIAIISHGKLKCCGSPLFLKGTYGDGYRLTLVKRPAEPGGPQEPGLASSPPGRAPLSSCSELQVSQFIRKHVASCLLVSDTSTELSYILPSEAAKKGAFERLFQHLERSLDALHLSSFGLMDTTLEEVFLKVSEEDQSL--ENSEADVKESRKDVLPGAEGPASGEGHAGNLAR-CSELTQSQASLQSASSVGSARGDEGAGYTDVYGDYRPLFDNPQDPDNVSLQEVEAEALSRVGQGSRKLDGGWLKVRQFHGLLVKRFHCARRNSKALFSQ 808          

HSP 2 Score: 162.155 bits (409), Expect = 3.044e-39
Identity = 104/334 (31.14%), Postives = 172/334 (51.50%), Query Frame = 1
Query: 5293 EDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKI----------------RLHPNRNSLSDRNEIET--IINKEIWSSARMKEENAVIIEYRFDSSVKLSDIF-RVFEDLRTN---EMVKEYSVSQMSLDEVFINFAKNDSVTRN 6228
            +D +KLA+N +S  + E +    LG NGAGKTTT  +L G    T G+A I G+ I  +  +  KN+G CPQ + L   LT EE L+FY+R++ +   +I   +D  +++L L+   +     +SGG KRK+  AIA +G  + + LDEPT G+D  ARR +W LI  L  +    ++L++H+M+E ++L  R+AI+  G++K  GS   LK  +G  Y + +                   P R  LS  +E++    I K + +S  +  + +  + Y   S       F R+F+ L  +     +  + +   +L+EVF+  ++ D    N
Sbjct:  348 KDDKKLALNKLSLNLYENQVVSFLGHNGAGKTTTMSILTGLFPPTSGSATIYGHDIRTEMDEIRKNLGMCPQHNVLFDRLTVEEHLWFYSRLKSMAQEEIRREMDKMIEDLELSNKRHSLVQTLSGGMKRKLSVAIAFVGGSRAIILDEPTAGVDPYARRAIWDLI--LKYKPGRTILLSTHHMDEADLLGDRIAIISHGKLKCCGSPLFLKGTYGDGYRLTLVKRPAEPGGPQEPGLASSPPGRAPLSSCSELQVSQFIRKHV-ASCLLVSDTSTELSYILPSEAAKKGAFERLFQHLERSLDALHLSSFGLMDTTLEEVFLKVSEEDQSLEN 678          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Celegans
Match: abt-2 (ABC Transporter family [Source:UniProtKB/TrEMBL;Acc:Q1RS86])

HSP 1 Score: 360.533 bits (924), Expect = 4.930e-100
Identity = 232/593 (39.12%), Postives = 352/593 (59.36%), Query Frame = 2
Query: 1157 GIVFTDDFQYVTPQNAT----FLNYQIRMPASRIDSTKNFKVLDRFWTPIPRVNTLTNFNYYTSGFLFLQEIIDQAFIELITDNASVNIGSSMQIMPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTXXXXXXXXXXXXXXXXXGKXXXXXXXXXXXXXXXXXXXXXXCQCFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLL---TQVSFCNAINFIGYLEQ--ASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENITI---DGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQ 2899
            GIVF  D       NAT    F  Y+IR     +DST +F  +D    P  R   L +  Y T GF FLQE ID+A +  +T+    N+G   Q  PYPC + D     L   MP  L+I++      L+K+IVYEKE ++KE MR MG+ + VH++SW   ++++  + +++++II K+ KI  ++   ++  +L  ++ S I      S  F N+N+A     +++F+F++PF +     D +S+  +  + L+   T +  C  +     LE   A + A +S+L+      L   V  C+IM+ +D+  ++++AWY+ AV PG +GV +P +F FT +YW P    N  +E  D+    E   TI   D F+ EP +L + + I ++ K + ++ T ALD LNL+ Y+ QITG LGHNGAGKTTT+SIL G+  P+SGTA I   DIR D+  +R  +G+CPQHN+LF++LTV + +  +  LKG+  SE+  Q+ +I+  V L++K   ++  LSGGMKR+L I +AF+G SR + LDEPTAGVD  +R+ IW L+ + +   RTI+L+THHMDEAD L DRIAI+SQ
Sbjct:  566 GIVFNID------SNATEFDGFTTYKIRHYPEMVDSTTSF--MDSKSNPFSRDKPLIDLKYITFGFSFLQESIDRAIMSELTNQTDANLGVYAQQEPYPCTVKDTFNVAL--FMPLFLLISFIFPSALLVKNIVYEKEQKIKEQMRAMGLGDAVHFISWGLISLVLNFISVLIISIISKVAKIFDYTDYTLLLFVLILFLFSSIAMSIFFSTLFTNANIATAATCVLWFVFFIPFQLLRT--DRISSPTFNRISLILPPTAMGHCFKL-----LESFNAMERATWSDLWEMNNPVLGISVELCMIMLVVDTAVFLILAWYISAVAPGDFGVRQPLWFPFTLKYWAPGLYKN-RVEFVDD----EHFDTIPNSDSFDSEPTNLTLAVHINSMSKVY-ENGTKALDCLNLRLYEGQITGLLGHNGAGKTTTMSILCGLYAPSSGTAKIYQRDIRTDLRRVRDVLGICPQHNVLFSHLTVSEQLRLFAALKGVPDSELTSQVDEILASVSLTEKANKLASTLSGGMKRRLCIGIAFIGGSRFVILDEPTAGVDVTARKDIWKLLQRNKE-GRTILLSTHHMDEADVLSDRIAILSQ 1134          

HSP 2 Score: 335.495 bits (859), Expect = 2.846e-92
Identity = 224/711 (31.50%), Postives = 368/711 (51.76%), Query Frame = 1
Query: 4225 RIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQS-----DLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIG-SKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNISGGDENY----------------NAFEWDITGNKICSL--GILFVGWCLIIVFMES-----KHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIEL----NHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLI-----GEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFD-SSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRNISNG 6240
            ++W N+K +   P  +NI SN LLR    A    ++ GI   N+P+  T S     +   F  A     +++ + V   LS IPA F ++L+E+R+  +   Q V G+    YW++++ +D + Y++ +++++L +L F    +        AF++L F++ ++ I + Y F    S ++ +FV+I+  +  VG +  +T   L+     D SL  A+     +FL+ PQY+LG   I +    + Y +     N+                +   +D  G  I  L   ++    CLI   M+      K ++ L      + L+  E  T +D DV KER+R++     + D  N  L V  L K YNP +                     LAV  ISF V+ GECFGLLG+NGAGKTTTF ML      G  +I + N  IN  S  D  ++  + +G+CPQFDAL+  L+  E L FY RIRGI P+ I   +D  L  L L P+ N  T  +SGGN+RK+  A+AL+  P ++FLDEP+ GMD G+++FLW++I+ L    K AV+LTSH+MEECE LC R+AIM  G ++ +G  QHLKSK+G    + +++  + N+     EI  I+  ++   +R++  +   I    +  +  ++ +  +   ++    V +++++Q +LD VF + A++D+++    +G
Sbjct: 1457 KVWFNNKIWPGFPIASNILSNALLRQEDYAIDP-EDLGILTMNHPMNKTISQTLDQNALKFTQALAVFRITILLLV---LSMIPAGFTVYLVEDRICEALHLQLVGGLRKVTYWVTSYLYDMVVYTLVIIVIMLIYLCFRVSDFTADGATFFAFLLLFFVHGMSTILYAYVFQKAFSVAALSFVLIAIGSYFVGIVCALTVIMLESLMVQDPSLIPAHTVCSIVFLVLPQYNLG---IAIFRGLMIYQVRAIGSNFLQQMNRPDMINQLPLPSLLAFDQMGIHIMCLFIHVIIATICLIFSQMDEFGFVRKRERNLT---DAMMLR--EPSTCDDEDVVKERQRVDAIPMDSSD--NHALIVRNLAKAYNPEL---------------------LAVKGISFAVEPGECFGLLGLNGAGKTTTFAMLTAKIRPGHGSIEMQNTRINTGSFSD--VRNFQQLGYCPQFDALNMKLSTRENLKFYARIRGIVPTQIDSIIDRLLIALHLRPYANTQTSSLSGGNRRKLSVAVALVSQPSLIFLDEPSAGMDPGSQQFLWKVIERLCKSGK-AVVLTSHSMEECEALCTRIAIMDRGRIRCLGGKQHLKSKYGKGSMLTMKMGKDENA----KEIAGIMRSKLGDGSRVEAIHCSTIFIHIEQGTASVARVLEIVNQVKKMYDVDDFTLTQSTLDNVFQSIAESDNLSEEGHHG 2125          

HSP 3 Score: 138.272 bits (347), Expect = 4.409e-32
Identity = 74/191 (38.74%), Postives = 113/191 (59.16%), Query Frame = 1
Query: 5311 AVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIM 5883
            A++ ++  + EG+  GLLG NGAGKTTT  +L G    + G A I    I  D  +    +G CPQ + L S LT  E+L  +  ++G+  S++   VD  L ++SLT   NK    +SGG KR++   IA IG  + V LDEPT G+D  AR+ +W+L+Q   N+    ++L++H+M+E +VL  R+AI+
Sbjct:  944 ALDCLNLRLYEGQITGLLGHNGAGKTTTMSILCGLYAPSSGTAKIYQRDIRTDLRRVRDVLGICPQHNVLFSHLTVSEQLRLFAALKGVPDSELTSQVDEILASVSLTEKANKLASTLSGGMKRRLCIGIAFIGGSRFVILDEPTAGVDVTARKDIWKLLQ--RNKEGRTILLSTHHMDEADVLSDRIAIL 1132          

HSP 4 Score: 132.88 bits (333), Expect = 1.948e-30
Identity = 97/362 (26.80%), Postives = 179/362 (49.45%), Query Frame = 2
Query: 2210 RQREENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRY-DMEIIRS--KIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQ---WTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVA--DDPSQISH 3271
            RQR + I +D  +         +++ NL K +   +  A+  ++      +  G LG NGAGKTTT ++LT  + P  G+  + +  I       +R+  ++G CPQ + L   L+  +++ FY  ++G+  ++I   +  ++  + L       + +LSGG +RKLS+A+A V    +IFLDEP+AG+DP S++ +W +I +     + ++LT+H M+E + LC RIAI+ +G+++C G    LK  +G G  L ++   +        N    +G          I  SKL D ++ +    + +  H          + E ++       +  + L+ ++L+ VF  +A  D+ S+  H
Sbjct: 1786 RQRVDAIPMDSSDNH------ALIVRNLAKAY-NPELLAVKGISFAVEPGECFGLLGLNGAGKTTTFAMLTAKIRPGHGSIEMQNTRINTGSFSDVRNFQQLGYCPQFDALNMKLSTRENLKFYARIRGIVPTQIDSIIDRLLIALHLRPYANTQTSSLSGGNRRKLSVAVALVSQPSLIFLDEPSAGMDPGSQQFLWKVIERLCKSGKAVVLTSHSMEECEALCTRIAIMDRGRIRCLGGKQHLKSKYGKGSMLTMKMGKD-------ENAKEIAG----------IMRSKLGDGSRVEAIHCSTIFIHIEQGTASVARVLEIVNQVKKMYDVDDFTLTQSTLDNVFQSIAESDNLSEEGH 2123          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Celegans
Match: abt-2 (ABC Transporter family [Source:UniProtKB/TrEMBL;Acc:Q1RS86])

HSP 1 Score: 360.533 bits (924), Expect = 5.333e-100
Identity = 232/593 (39.12%), Postives = 352/593 (59.36%), Query Frame = 2
Query: 1157 GIVFTDDFQYVTPQNAT----FLNYQIRMPASRIDSTKNFKVLDRFWTPIPRVNTLTNFNYYTSGFLFLQEIIDQAFIELITDNASVNIGSSMQIMPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTXXXXXXXXXXXXXXXXXGKXXXXXXXXXXXXXXXXXXXXXXCQCFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLL---TQVSFCNAINFIGYLEQ--ASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENITI---DGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQ 2899
            GIVF  D       NAT    F  Y+IR     +DST +F  +D    P  R   L +  Y T GF FLQE ID+A +  +T+    N+G   Q  PYPC + D     L   MP  L+I++      L+K+IVYEKE ++KE MR MG+ + VH++SW   ++++  + +++++II K+ KI  ++   ++  +L  ++ S I      S  F N+N+A     +++F+F++PF +     D +S+  +  + L+   T +  C  +     LE   A + A +S+L+      L   V  C+IM+ +D+  ++++AWY+ AV PG +GV +P +F FT +YW P    N  +E  D+    E   TI   D F+ EP +L + + I ++ K + ++ T ALD LNL+ Y+ QITG LGHNGAGKTTT+SIL G+  P+SGTA I   DIR D+  +R  +G+CPQHN+LF++LTV + +  +  LKG+  SE+  Q+ +I+  V L++K   ++  LSGGMKR+L I +AF+G SR + LDEPTAGVD  +R+ IW L+ + +   RTI+L+THHMDEAD L DRIAI+SQ
Sbjct:  529 GIVFNID------SNATEFDGFTTYKIRHYPEMVDSTTSF--MDSKSNPFSRDKPLIDLKYITFGFSFLQESIDRAIMSELTNQTDANLGVYAQQEPYPCTVKDTFNVAL--FMPLFLLISFIFPSALLVKNIVYEKEQKIKEQMRAMGLGDAVHFISWGLISLVLNFISVLIISIISKVAKIFDYTDYTLLLFVLILFLFSSIAMSIFFSTLFTNANIATAATCVLWFVFFIPFQLLRT--DRISSPTFNRISLILPPTAMGHCFKL-----LESFNAMERATWSDLWEMNNPVLGISVELCMIMLVVDTAVFLILAWYISAVAPGDFGVRQPLWFPFTLKYWAPGLYKN-RVEFVDD----EHFDTIPNSDSFDSEPTNLTLAVHINSMSKVY-ENGTKALDCLNLRLYEGQITGLLGHNGAGKTTTMSILCGLYAPSSGTAKIYQRDIRTDLRRVRDVLGICPQHNVLFSHLTVSEQLRLFAALKGVPDSELTSQVDEILASVSLTEKANKLASTLSGGMKRRLCIGIAFIGGSRFVILDEPTAGVDVTARKDIWKLLQRNKE-GRTILLSTHHMDEADVLSDRIAILSQ 1097          

HSP 2 Score: 335.109 bits (858), Expect = 3.573e-92
Identity = 224/711 (31.50%), Postives = 368/711 (51.76%), Query Frame = 1
Query: 4225 RIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQS-----DLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIG-SKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNISGGDENY----------------NAFEWDITGNKICSL--GILFVGWCLIIVFMES-----KHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIEL----NHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLI-----GEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFD-SSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRNISNG 6240
            ++W N+K +   P  +NI SN LLR    A    ++ GI   N+P+  T S     +   F  A     +++ + V   LS IPA F ++L+E+R+  +   Q V G+    YW++++ +D + Y++ +++++L +L F    +        AF++L F++ ++ I + Y F    S ++ +FV+I+  +  VG +  +T   L+     D SL  A+     +FL+ PQY+LG   I +    + Y +     N+                +   +D  G  I  L   ++    CLI   M+      K ++ L      + L+  E  T +D DV KER+R++     + D  N  L V  L K YNP +                     LAV  ISF V+ GECFGLLG+NGAGKTTTF ML      G  +I + N  IN  S  D  ++  + +G+CPQFDAL+  L+  E L FY RIRGI P+ I   +D  L  L L P+ N  T  +SGGN+RK+  A+AL+  P ++FLDEP+ GMD G+++FLW++I+ L    K AV+LTSH+MEECE LC R+AIM  G ++ +G  QHLKSK+G    + +++  + N+     EI  I+  ++   +R++  +   I    +  +  ++ +  +   ++    V +++++Q +LD VF + A++D+++    +G
Sbjct: 1420 KVWFNNKIWPGFPIASNILSNALLRQEDYAIDP-EDLGILTMNHPMNKTISQTLDQNALKFTQALAVFRITILLLV---LSMIPAGFTVYLVEDRICEALHLQLVGGLRKVTYWVTSYLYDMVVYTLVIIVIMLIYLCFRVSDFTADGATFFAFLLLFFVHGMSTILYAYVFQKAFSVAALSFVLIAIGSYFVGIVCALTVIMLESLMVQDPSLIPAHTVCSIVFLVLPQYNLG---IAIFRGLMIYQVRAIGSNFLQQMNRPDMINQLPLPSLLAFDQMGIHIMCLFIHVIIATICLIFSQMDEFGFVRKRERNLT---DAMMLR--EPSTCDDEDVVKERQRVDAIPMDSSD--NHALIVRNLAKAYNPEL---------------------LAVKGISFAVEPGECFGLLGLNGAGKTTTFAMLTAKIRPGHGSIEMQNTRINTGSFSD--VRNFQQLGYCPQFDALNMKLSTRENLKFYARIRGIVPTQIDSIIDRLLIALHLRPYANTQTSSLSGGNRRKLSVAVALVSQPSLIFLDEPSAGMDPGSQQFLWKVIERLCKSGK-AVVLTSHSMEECEALCTRIAIMDRGRIRCLGGKQHLKSKYGKGSMLTMKMGKDENA----KEIAGIMRSKLGDGSRVEAIHCSTIFIHIEQGTASVARVLEIVNQVKKMYDVDDFTLTQSTLDNVFQSIAESDNLSEEGHHG 2088          

HSP 3 Score: 138.272 bits (347), Expect = 4.527e-32
Identity = 74/191 (38.74%), Postives = 113/191 (59.16%), Query Frame = 1
Query: 5311 AVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIM 5883
            A++ ++  + EG+  GLLG NGAGKTTT  +L G    + G A I    I  D  +    +G CPQ + L S LT  E+L  +  ++G+  S++   VD  L ++SLT   NK    +SGG KR++   IA IG  + V LDEPT G+D  AR+ +W+L+Q   N+    ++L++H+M+E +VL  R+AI+
Sbjct:  907 ALDCLNLRLYEGQITGLLGHNGAGKTTTMSILCGLYAPSSGTAKIYQRDIRTDLRRVRDVLGICPQHNVLFSHLTVSEQLRLFAALKGVPDSELTSQVDEILASVSLTEKANKLASTLSGGMKRRLCIGIAFIGGSRFVILDEPTAGVDVTARKDIWKLLQ--RNKEGRTILLSTHHMDEADVLSDRIAIL 1095          

HSP 4 Score: 132.88 bits (333), Expect = 1.871e-30
Identity = 97/362 (26.80%), Postives = 179/362 (49.45%), Query Frame = 2
Query: 2210 RQREENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRY-DMEIIRS--KIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQ---WTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVA--DDPSQISH 3271
            RQR + I +D  +         +++ NL K +   +  A+  ++      +  G LG NGAGKTTT ++LT  + P  G+  + +  I       +R+  ++G CPQ + L   L+  +++ FY  ++G+  ++I   +  ++  + L       + +LSGG +RKLS+A+A V    +IFLDEP+AG+DP S++ +W +I +     + ++LT+H M+E + LC RIAI+ +G+++C G    LK  +G G  L ++   +        N    +G          I  SKL D ++ +    + +  H          + E ++       +  + L+ ++L+ VF  +A  D+ S+  H
Sbjct: 1749 RQRVDAIPMDSSDNH------ALIVRNLAKAY-NPELLAVKGISFAVEPGECFGLLGLNGAGKTTTFAMLTAKIRPGHGSIEMQNTRINTGSFSDVRNFQQLGYCPQFDALNMKLSTRENLKFYARIRGIVPTQIDSIIDRLLIALHLRPYANTQTSSLSGGNRRKLSVAVALVSQPSLIFLDEPSAGMDPGSQQFLWKVIERLCKSGKAVVLTSHSMEECEALCTRIAIMDRGRIRCLGGKQHLKSKYGKGSMLTMKMGKD-------ENAKEIAG----------IMRSKLGDGSRVEAIHCSTIFIHIEQGTASVARVLEIVNQVKKMYDVDDFTLTQSTLDNVFQSIAESDNLSEEGH 2086          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Celegans
Match: abt-4 (ABC Transporter family [Source:UniProtKB/TrEMBL;Acc:Q9TXV8])

HSP 1 Score: 358.607 bits (919), Expect = 8.206e-100
Identity = 260/760 (34.21%), Postives = 413/760 (54.34%), Query Frame = 2
Query: 1148 ILAGIVFTDDF--QYVTPQNATFLNYQIRMPASRIDSTKNFKVLDRFWT------------PI-PRVNTLTNFNYYTSGFLFLQEIIDQAFIELIT--DNASVNIGSSMQI--MPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTXXXXXXXXXXXXXXXXXGKXXXXXXXXXXXXXXXXXXXXXXCQCFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGV--GLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVP-KPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENITIDGFEKEPDDLEIGILIENLVK-------------KFPKS-KTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKV---ADDPSQISHKRQEKQITSEMLD 3310
            +LAGIVF D        P    F  Y IR+  +   S   F      W             PI P  N   +  Y+  GF+ +Q  +D A  E+IT  D     +  S Q+   P+P Y + ++I   +  MP +++ ++  +V  +++++V EKE+RLKE+MRVMG+S F++WV+ F      L   +I++TI++    + +  + + +FL+++ + V +    FMIS F +++  A ++  + + + Y  +  F +        + Y +   +   ++    +  +   E  +DG ++  LF     D N   GH LI + +D +  I++ WY+EAV PG  GVP KPW+F+    YW P S  +  ++ SD F+Q +    +   EKEP DL   I + NL K             KF KS +  A+ NLNLK Y  Q T  LGHNGAGK+TT S+LTG+ +P+SG+A++ D DIR  +  IR ++GLCPQ+N LF ++TV +H+ F+  LK  T      +  +I+  + +  K   M+  LSGG KRKLS+A+A +G S ++ LDEPT+G+DP +R   W LI + +   RTI+LTTH M+EAD L DRIAI++ G+L+CCGS +FLKQ +GDGY+L +           ++  ++   +K  + I++ IP + +      + T +LS  +T+R  F  LF++L+       I S+G+S T++EEVFLKV   AD+     H  +     SEM++
Sbjct:  193 LLAGIVFDDSIAKDLKNPDKRDF-TYTIRLSNTHRRSRNAFGDNSYPWDTSVSFAVQYVSGPINPDDNDGGSPGYWQEGFMTVQRAVDVAITEIITGEDAQLTPLLDSYQVSRFPFPGY-STKIIEIGAFFMPVIVIFSFMTSVIYIVRAVVVEKEDRLKEYMRVMGLSQFINWVAHFIINYAKLTFAVIVLTILMHFVALKSDMTLMFVFLMIYAFDVVYFA--FMISSFMNSATSATLISVVFWMLLYFWYAFFSSIDQTNPYPLGYRLINCINPDIALNYGLQLLAAYETQADGLKWGELFTPPSPDNNLTFGHALIALIVDGIIMIILTWYIEAVIPGGEGVPQKPWFFVLPS-YWFPNS-GSKTVDSSDQFQQIQYADHVK-LEKEPTDLIPTINVVNLTKTYGTSFFKKLFDCKFGKSGEKRAVSNLNLKMYPGQCTVLLGHNGAGKSTTFSMLTGVASPSSGSAYVNDFDIRTSLPKIRREMGLCPQYNTLFGFMTVMEHLEFFAKLKERTWD--PEEAREILARLRIDFKADFMAGALSGGQKRKLSLAIALIGGSEVVMLDEPTSGMDPGARHETWTLIQREKE-RRTILLTTHFMEEADLLGDRIAIMAHGQLECCGSPMFLKQQYGDGYHLTI----------VYDTTSTPDVSKTTDIIREYIPEAHVFSYIGQEATYLLS--ATHRPIFPKLFKELEDHQTQCGITSFGVSITTMEEVFLKVGHTADERYNYEHGIEND--ISEMIE 928          

HSP 2 Score: 243.047 bits (619), Expect = 4.242e-64
Identity = 126/309 (40.78%), Postives = 196/309 (63.43%), Query Frame = 1
Query: 5311 AVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLSDIFRVFEDLRTNEMV---KEYSVSQMSLDEVFINFAKNDSVTRN 6228
            AV  ++F V   +CFGLLGVNGAGKT+TF+ML GE +I+ G+A +NG+S+ ++  +A  N G+CPQ+DA+   ++ EE LY + RIRGI   DIP  V+  +  + +  + ++     SGGNKR++   IA++G P ++ LDEPT G+D  ARR +W ++  L  +   A++LTSH+M+ECE LC  LAIMV G+ +  GS QH+KS++G  Y + IRL  NRN   D  + ++ I K+ +  + +KEE+  +++  FD         R+FE L T        +YS+SQ +L++VFI F+++  V+ +
Sbjct: 1464 AVKGVNFHVNSKDCFGLLGVNGAGKTSTFQMLTGENSISSGDAYVNGWSVKNNWREAGANTGYCPQYDAIIKEMSGEETLYMFARIRGIPEKDIPKKVNAVIHAIGIGMYASRQIKTYSGGNKRRLSLGIAIVGLPDVLLLDEPTSGVDPKARRIIWNILNRL-RDLGTALVLTSHSMDECEALCTELAIMVYGKFRCYGSCQHIKSRYGSGYTLLIRLK-NRN---DAEKTKSTI-KQTFRGSVIKEEH--VLQLNFDIPRDGDSWSRLFEKLETVSTSLNWDDYSLSQTTLEQVFIEFSRDAGVSSD 1764          

HSP 3 Score: 170.629 bits (431), Expect = 5.323e-42
Identity = 184/727 (25.31%), Postives = 330/727 (45.39%), Query Frame = 1
Query: 4396 YAQMFLEVS---LAIFVIFGLSFIPASFVIFLIEERVTGS--KLQQY--VSGVNPYVYWISNFF--WDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMI-----DLSFSYLRYNISGGDENYNAFEWDITGNKICSLGILFVGWCLI-------IVFMESKHKKTLCIKLKDVKLKPYEII------------TDEDLDVFKERE-----RIELNHDVLNDVLQVYGLTKIYNPSIDFRN--KC-FGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVK--LSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRNISNGNALIQKPNFNNDGYLNEGFEKTDF*YEIFQ*SVDIILQIR*IVFRNYFVETSKKEFIKNINYIFSMFYF 6447
            Y+   +E+    + + VIF  SF+ +  VI+++   V     +L++Y  V G++ ++ W+++F   +  + +++ VL +++ F+A          ++    V L +Y+  V+   +  S F++ +++A ++   + +L+        F+   +    +S+   N            Y LG  +I     D++ +Y    ++  +   +  +W            L  G  LI       I+ + + + + +    + V  KP+  +            T +  D F++ +     ++E     L   + V  LTK Y  S  F+    C FGK      S +KR  AV+N++  +  G+C  LLG NGAGK+TTF ML G  + + G+A +N + I     K  + MG CPQ++ L   +T  E L F+ +++  + +  P      L  L +    +     +SGG KRK+  AIALIG  ++V LDEPT GMD GAR   W LIQ    + +  ++LT+H MEE ++L  R+AIM  G+++  GS   LK ++G  Y++ I    +  S  D ++   II + I   A +         Y   ++ +     +F+  ED +T   +  + VS  +++EVF+          N  +G          ND  ++E  EK D    I Q   D+  Q+R   F      T + +  K + Y  ++F+F
Sbjct:  310 YSTKIIEIGAFFMPVIVIF--SFMTS--VIYIVRAVVVEKEDRLKEYMRVMGLSQFINWVAHFIINYAKLTFAVIVLTILMHFVALK-------SDMTLMFVFLMIYAFDVVYFAFMISSFMNSATSATLISVVFWMLL-------YFWYAFF----SSIDQTN-----------PYPLGYRLINCINPDIALNYGLQLLAAYETQADGLKWGELFTPPSPDNNLTFGHALIALIVDGIIMIILTWYIEAVIPGGEGVPQKPWFFVLPSYWFPNSGSKTVDSSDQFQQIQYADHVKLEKEPTDLIPTINVVNLTKTYGTSF-FKKLFDCKFGK------SGEKR--AVSNLNLKMYPGQCTVLLGHNGAGKSTTFSMLTGVASPSSGSAYVNDFDIRTSLPKIRREMGLCPQYNTLFGFMTVMEHLEFFAKLK--ERTWDPEEAREILARLRIDFKADFMAGALSGGQKRKLSLAIALIGGSEVVMLDEPTSGMDPGARHETWTLIQ--REKERRTILLTTHFMEEADLLGDRIAIMAHGQLECCGSPMFLKQQYGDGYHLTIVY--DTTSTPDVSKTTDIIREYI-PEAHVFSYIGQEATYLLSATHRPIFPKLFKELEDHQTQCGITSFGVSITTMEEVFLKVGHTADERYNYEHG--------IEND--ISEMIEKDD---PILQ---DLRAQVRVTGF------TLQMQHAKAMFYKRAIFFF 965          

HSP 4 Score: 155.606 bits (392), Expect = 1.998e-37
Identity = 93/310 (30.00%), Postives = 166/310 (53.55%), Query Frame = 2
Query: 2324 ALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADD 3253
            A+  +N         G LG NGAGKT+T  +LTG  + +SG A++    ++ +     +  G CPQ++ +   ++ E+ +Y +  ++G+ + +I  ++  ++  +G+        K  SGG KR+LS+ +A VG   ++ LDEPT+GVDP +RR IW+++ + R +   ++LT+H MDE + LC  +AI+  GK +C GS   +K  +G GY L +           + N A ++ +     IK+    S + +E   Q    +  +    + ++ LFE+L++    L    Y LS T+LE+VF++ + D
Sbjct: 1464 AVKGVNFHVNSKDCFGLLGVNGAGKTSTFQMLTGENSISSGDAYVNGWSVKNNWREAGANTGYCPQYDAIIKEMSGEETLYMFARIRGIPEKDIPKKVNAVIHAIGIGMYASRQIKTYSGGNKRRLSLGIAIVGLPDVLLLDEPTSGVDPKARRIIWNILNRLRDLGTALVLTSHSMDECEALCTELAIMVYGKFRCYGSCQHIKSRYGSGYTLLIRLK--------NRNDAEKTKST----IKQTFRGSVIKEEHVLQLNFDIPRDG---DSWSRLFEKLETVSTSLNWDDYSLSQTTLEQVFIEFSRD 1758          

HSP 5 Score: 82.8037 bits (203), Expect = 3.328e-15
Identity = 56/212 (26.42%), Postives = 96/212 (45.28%), Query Frame = 1
Query: 4171 LNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLF-LYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTI 4803
            L +    FN S +     + + N+ G +  PA A  F++    S + + K  + Y     N+PL  +  D              +A  +I   +   A +  FLI ER   SK  Q +SG+ P+++W++ F WDA  + I +L     F  FN  +Y     ++  + L F LY    +P  Y F FF   +   F++++ Y++L G + +I
Sbjct: 1080 LGFVPSMFNFSTVSVPSLKTFFNNFG-LYTPALAITFTD----SMILSQKQKKQYSFTAVNHPLPPSTQDTLKNTNRSDGAAFLIAYGLIVSFAVCVAGYSQFLITERKKKSKHMQLLSGIRPWMFWLTAFIWDAAWFVIRILCFDAIFYIFNITAYTHDFGVMLILTLSFLLYGWTALPFTYWFQFFFESAPKGFMMVTMYHILTGMIGSI 1286          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Celegans
Match: ced-7 (ABC transporter ced-7 [Source:UniProtKB/Swiss-Prot;Acc:P34358])

HSP 1 Score: 251.521 bits (641), Expect = 1.086e-66
Identity = 191/674 (28.34%), Postives = 324/674 (48.07%), Query Frame = 1
Query: 4237 NSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLL-FLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFL-IFPQYDLGRGMIDLSFSYLRYNISGGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLD------VFKERERIELNHDV--LNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLH-PNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLSDI----FRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKND 6213
            N + Y  +P   ++ +   L  TV+A          +++    Y++S   S +     ++V LA  +I   + + ++FV+FLIEER      QQ+++G++P  ++ ++  +D I YS+  LI +  FLAF++       + LA ++L  FLY  + +P +Y  SF     S A V++  + +++ G   +  F + +    D  LKS    L  IF+ + P Y  G  +I ++   +   I   +E  N   WD  G     +G   V    + V ++ K  +    ++  V+   +  +     D      V +ERER+   H V   N  L +  LTK +                       R  AVN +   V + ECFGLLGVNGAGKTTTF +L G+   + G A+I G  + +       ++G+CPQFDAL   LT  E L    ++ G +  +     +L L+ + +  H +K     SGG KRK+   +AL+   +++ LDEPT G+D  ARR +W L+         A++LTSH+M+ECE LC R+A++  G +  IGS Q LKS +G++Y + + L+ PN+     R+ +  ++   + +S          +  ++    +  D     F + + L  +  VK++ ++Q SL+E F+  A  D
Sbjct: 1060 NMRYYHVLPTLISMINRARLTGTVDAE---------ISSGVFLYSKSTSNSNLLPSQLIDVLLAPMLILIFAMVTSTFVMFLIEERTCQFAHQQFLTGISPITFYSASLIYDGILYSLICLIFLFMFLAFHWM-----YDHLAIVILFWFLYFFSSVPFIYAVSFLFQSPSKANVLLIIWQVVISGAALLAVFLIFMIFNIDEWLKSI---LVNIFMFLLPSYAFGSAIITINTYGM---ILPSEELMN---WDHCGKNAWLMGTFGVCSFALFVLLQFKFVRRFLSQVWTVRRSSHNNVQPMMGDLPVCESVSEERERV---HRVNSQNSALVIKDLTKTFG----------------------RFTAVNELCLAVDQKECFGLLGVNGAGKTTTFNILTGQSFASSGEAMIGGRDVTELI-----SIGYCPQFDALMLDLTGRESLEILAQMHGFE--NYKAKAELILECVGMIAHADKLVRFYSGGQKRKISVGVALLAPTQMIILDEPTAGIDPKARREVWELLLWCREHSNSALMLTSHSMDECEALCSRIAVLNRGSLIAIGSSQELKSLYGNNYTMTLSLYEPNQ-----RDMVVQLVQTRLPNSVLKTTSTNKTLNLKWQIPKEKEDCWSAKFEMVQALAKDLGVKDFILAQSSLEETFLRLAGLD 1673          

HSP 2 Score: 208.379 bits (529), Expect = 1.749e-53
Identity = 181/631 (28.68%), Postives = 306/631 (48.49%), Query Frame = 2
Query: 1772 ISVFFDNSNVA--AIV---GGIVYFIFYL-PFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISD-----NFRQREENITIDGFEKEP-------------------DDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFL--------EKSFEIQSETC-HNNKASESGTKLLEFIKKIIPNSKLIDETKT-QWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLD----TLTDGGNLPRPVSVLSFRKKTINTANINGPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGLFSE 3532
            ++ FF+N+N A  AI+   G ++   + L P L      D++S+   YG+ +    +F  A+  I    +       +N+FN +   L+F +G  L+M+ +D ++  + A  V+ +              F+ R    F    D+   +D     N R  E+   +      P                   D     I++ NLVK +  +   A+D L+L+  + Q +  LGHNGAGK+TT S + GI+ PT+G   I   D+  +    R  IG+CPQ+N L+  LTV +H+     LKG  + + K  +  ++ +V L  K    + NLSGGMKRKL + MA +G+S ++ LDEPTAG+DP +R+ +  L+ + ++ NRTI+LTTH+MDEA+ L D + I+S GKL   G++ +LKQ FG GY L +         K   I ++ C H  K +E G    + I+ I+P ++  +     Q    +   +   N F ++   L S L  L++ S+GLS  +LE+VF+ + D   +    RQ  +I+    +    +L   G   +  +  +   + +  +   GP+            SG++ +  Q   +  K+F +++RN   LF++
Sbjct:  354 VASFFNNTNSAIKAILVAWGAMIGISYKLRPEL------DQISSCFLYGLNI--NGAFALAVEAISDYMRRERELNLTNMFNDS--SLHFSLGWALVMMIVDILWMSIGALVVDHIRTSAD---------FSLRTLFDFEAPEDDENQTDGVTAQNTRINEQMNPMASTSLNPPNADSDSLLEGSTEADGARDTARADIIVRNLVKIWSTTGERAVDGLSLRAVRGQCSILLGHNGAGKSTTFSSIAGIIRPTNGRITICGYDVGNEPGETRRHIGMCPQYNPLYDQLTVSEHLKLVYGLKGAREKDFKQDMKRLLSDVKLDFKENEKAVNLSGGMKRKLCVCMALIGDSEVVLLDEPTAGMDPGARQDVQKLVEREKA-NRTILLTTHYMDEAERLGDWVFIMSHGKLVASGTNQYLKQKFGTGYLLTVVLDHNGDKRKMAVILTDVCTHYVKEAERGEMHGQQIEIILPEARKKEFVPLFQALEAIQDRNYRSNVFDNMPNTLKSQLATLEMRSFGLSLNTLEQVFITIGDKVDKAIASRQNSRISHNSRNASEPSLKPAGYDTQSSTKSADSYQKLMDSQARGPEK-----------SGVAKMVAQFISIMRKKFLYSRRNWAQLFTQ 953          

HSP 3 Score: 142.51 bits (358), Expect = 2.188e-33
Identity = 108/328 (32.93%), Postives = 177/328 (53.96%), Query Frame = 2
Query: 2273 GILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRS-INRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQ--FTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVA 3247
             ++I++L K F   +  A++ L L   Q +  G LG NGAGKTTT +ILTG    +SG A I   D+    E+I   IG CPQ + L   LT  + +     + G    + K +L  I++ VG+      + +  SGG KRK+S+ +A +  +++I LDEPTAG+DP +RR +W+L++  R   N  ++LT+H MDE + LC RIA++++G L   GSS  LK  +G+ Y + L      Q +             +++ ++  +PNS ++  T T  T+ L        +  +++ FE + +    L +  + L+ +SLEE FL++A
Sbjct: 1365 ALVIKDLTKTF--GRFTAVNELCLAVDQKECFGLLGVNGAGKTTTFNILTGQSFASSGEAMIGGRDV---TELI--SIGYCPQFDALMLDLTGRESLEILAQMHGFENYKAKAEL--ILECVGMIAHADKLVRFYSGGQKRKISVGVALLAPTQMIILDEPTAGIDPKARREVWELLLWCREHSNSALMLTSHSMDECEALCSRIAVLNRGSLIAIGSSQELKSLYGNNYTMTLSLYEPNQRDM------------VVQLVQTRLPNS-VLKTTSTNKTLNLKWQIPKEKEDCWSAKFEMVQALAKDLGVKDFILAQSSLEETFLRLA 1670          

HSP 4 Score: 142.124 bits (357), Expect = 3.043e-33
Identity = 81/237 (34.18%), Postives = 130/237 (54.85%), Query Frame = 1
Query: 5311 AVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIIN 6021
            AV+ +S     G+C  LLG NGAGK+TTF  + G    T G   I GY + ++  +  +++G CPQ++ L+  LT  E L     ++G +  D   ++   L ++ L    N+    +SGG KRK+   +ALIG  ++V LDEPT GMD GAR+ + +L++    +    ++LT+H M+E E L   + IM  G++   G+ Q+LK KFG  Y + + L  N     D+ ++  I+ 
Sbjct:  549 AVDGLSLRAVRGQCSILLGHNGAGKSTTFSSIAGIIRPTNGRITICGYDVGNEPGETRRHIGMCPQYNPLYDQLTVSEHLKLVYGLKGAREKDFKQDMKRLLSDVKLDFKENEKAVNLSGGMKRKLCVCMALIGDSEVVLLDEPTAGMDPGARQDVQKLVE--REKANRTILLTTHYMDEAERLGDWVFIMSHGKLVASGTNQYLKQKFGTGYLLTVVLDHN----GDKRKMAVILT 779          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Celegans
Match: ced-7 (ABC transporter ced-7 [Source:UniProtKB/Swiss-Prot;Acc:P34358])

HSP 1 Score: 251.521 bits (641), Expect = 1.172e-66
Identity = 191/674 (28.34%), Postives = 324/674 (48.07%), Query Frame = 1
Query: 4237 NSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLL-FLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFL-IFPQYDLGRGMIDLSFSYLRYNISGGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLD------VFKERERIELNHDV--LNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLH-PNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLSDI----FRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKND 6213
            N + Y  +P   ++ +   L  TV+A          +++    Y++S   S +     ++V LA  +I   + + ++FV+FLIEER      QQ+++G++P  ++ ++  +D I YS+  LI +  FLAF++       + LA ++L  FLY  + +P +Y  SF     S A V++  + +++ G   +  F + +    D  LKS    L  IF+ + P Y  G  +I ++   +   I   +E  N   WD  G     +G   V    + V ++ K  +    ++  V+   +  +     D      V +ERER+   H V   N  L +  LTK +                       R  AVN +   V + ECFGLLGVNGAGKTTTF +L G+   + G A+I G  + +       ++G+CPQFDAL   LT  E L    ++ G +  +     +L L+ + +  H +K     SGG KRK+   +AL+   +++ LDEPT G+D  ARR +W L+         A++LTSH+M+ECE LC R+A++  G +  IGS Q LKS +G++Y + + L+ PN+     R+ +  ++   + +S          +  ++    +  D     F + + L  +  VK++ ++Q SL+E F+  A  D
Sbjct: 1073 NMRYYHVLPTLISMINRARLTGTVDAE---------ISSGVFLYSKSTSNSNLLPSQLIDVLLAPMLILIFAMVTSTFVMFLIEERTCQFAHQQFLTGISPITFYSASLIYDGILYSLICLIFLFMFLAFHWM-----YDHLAIVILFWFLYFFSSVPFIYAVSFLFQSPSKANVLLIIWQVVISGAALLAVFLIFMIFNIDEWLKSI---LVNIFMFLLPSYAFGSAIITINTYGM---ILPSEELMN---WDHCGKNAWLMGTFGVCSFALFVLLQFKFVRRFLSQVWTVRRSSHNNVQPMMGDLPVCESVSEERERV---HRVNSQNSALVIKDLTKTFG----------------------RFTAVNELCLAVDQKECFGLLGVNGAGKTTTFNILTGQSFASSGEAMIGGRDVTELI-----SIGYCPQFDALMLDLTGRESLEILAQMHGFE--NYKAKAELILECVGMIAHADKLVRFYSGGQKRKISVGVALLAPTQMIILDEPTAGIDPKARREVWELLLWCREHSNSALMLTSHSMDECEALCSRIAVLNRGSLIAIGSSQELKSLYGNNYTMTLSLYEPNQ-----RDMVVQLVQTRLPNSVLKTTSTNKTLNLKWQIPKEKEDCWSAKFEMVQALAKDLGVKDFILAQSSLEETFLRLAGLD 1686          

HSP 2 Score: 206.068 bits (523), Expect = 9.533e-53
Identity = 183/647 (28.28%), Postives = 307/647 (47.45%), Query Frame = 2
Query: 1772 ISVFFDNSNVA--AIV---GGIVYFIFYL-PFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNND-----------NIEISDNFRQR-----------------------------EENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFL--------EKSFEIQSETC-HNNKASESGTKLLEFIKKIIPNSKLIDETKT-QWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLD----TLTDGGNLPRPVSVLSFRKKTINTANINGPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGLFSE 3532
            ++ FF+N+N A  AI+   G ++   + L P L      D++S+   YG+ +    +F  A+  I    +       +N+FN +   L+F +G  L+M+ +D ++  + A  V+ +              F+ R    F    D           N  I++  R R                             E +   DG     D     I++ NLVK +  +   A+D L+L+  + Q +  LGHNGAGK+TT S + GI+ PT+G   I   D+  +    R  IG+CPQ+N L+  LTV +H+     LKG  + + K  +  ++ +V L  K    + NLSGGMKRKL + MA +G+S ++ LDEPTAG+DP +R+ +  L+ + ++ NRTI+LTTH+MDEA+ L D + I+S GKL   G++ +LKQ FG GY L +         K   I ++ C H  K +E G    + I+ I+P ++  +     Q    +   +   N F ++   L S L  L++ S+GLS  +LE+VF+ + D   +    RQ  +I+    +    +L   G   +  +  +   + +  +   GP+            SG++ +  Q   +  K+F +++RN   LF++
Sbjct:  354 VASFFNNTNSAIKAILVAWGAMIGISYKLRPEL------DQISSCFLYGLNI--NGAFALAVEAISDYMRRERELNLTNMFNDS--SLHFSLGWALVMMIVDILWMSIGALVVDHIRTSAD---------FSLRTLFDFEAPEDDENQTDGVTAQNTRINEQVRNRVRRSDMEIQMNPMASTSLNPPNADSDSLLEGSTEADGAR---DTARADIIVRNLVKIWSTTGERAVDGLSLRAVRGQCSILLGHNGAGKSTTFSSIAGIIRPTNGRITICGYDVGNEPGETRRHIGMCPQYNPLYDQLTVSEHLKLVYGLKGAREKDFKQDMKRLLSDVKLDFKENEKAVNLSGGMKRKLCVCMALIGDSEVVLLDEPTAGMDPGARQDVQKLVEREKA-NRTILLTTHYMDEAERLGDWVFIMSHGKLVASGTNQYLKQKFGTGYLLTVVLDHNGDKRKMAVILTDVCTHYVKEAERGEMHGQQIEIILPEARKKEFVPLFQALEAIQDRNYRSNVFDNMPNTLKSQLATLEMRSFGLSLNTLEQVFITIGDKVDKAIASRQNSRISHNSRNASEPSLKPAGYDTQSSTKSADSYQKLMDSQARGPEK-----------SGVAKMVAQFISIMRKKFLYSRRNWAQLFTQ 966          

HSP 3 Score: 142.51 bits (358), Expect = 1.970e-33
Identity = 108/328 (32.93%), Postives = 177/328 (53.96%), Query Frame = 2
Query: 2273 GILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRS-INRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQ--FTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVA 3247
             ++I++L K F   +  A++ L L   Q +  G LG NGAGKTTT +ILTG    +SG A I   D+    E+I   IG CPQ + L   LT  + +     + G    + K +L  I++ VG+      + +  SGG KRK+S+ +A +  +++I LDEPTAG+DP +RR +W+L++  R   N  ++LT+H MDE + LC RIA++++G L   GSS  LK  +G+ Y + L      Q +             +++ ++  +PNS ++  T T  T+ L        +  +++ FE + +    L +  + L+ +SLEE FL++A
Sbjct: 1378 ALVIKDLTKTF--GRFTAVNELCLAVDQKECFGLLGVNGAGKTTTFNILTGQSFASSGEAMIGGRDV---TELI--SIGYCPQFDALMLDLTGRESLEILAQMHGFENYKAKAEL--ILECVGMIAHADKLVRFYSGGQKRKISVGVALLAPTQMIILDEPTAGIDPKARREVWELLLWCREHSNSALMLTSHSMDECEALCSRIAVLNRGSLIAIGSSQELKSLYGNNYTMTLSLYEPNQRDM------------VVQLVQTRLPNS-VLKTTSTNKTLNLKWQIPKEKEDCWSAKFEMVQALAKDLGVKDFILAQSSLEETFLRLA 1683          

HSP 4 Score: 142.124 bits (357), Expect = 3.109e-33
Identity = 81/237 (34.18%), Postives = 130/237 (54.85%), Query Frame = 1
Query: 5311 AVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIIN 6021
            AV+ +S     G+C  LLG NGAGK+TTF  + G    T G   I GY + ++  +  +++G CPQ++ L+  LT  E L     ++G +  D   ++   L ++ L    N+    +SGG KRK+   +ALIG  ++V LDEPT GMD GAR+ + +L++    +    ++LT+H M+E E L   + IM  G++   G+ Q+LK KFG  Y + + L  N     D+ ++  I+ 
Sbjct:  562 AVDGLSLRAVRGQCSILLGHNGAGKSTTFSSIAGIIRPTNGRITICGYDVGNEPGETRRHIGMCPQYNPLYDQLTVSEHLKLVYGLKGAREKDFKQDMKRLLSDVKLDFKENEKAVNLSGGMKRKLCVCMALIGDSEVVLLDEPTAGMDPGARQDVQKLVE--REKANRTILLTTHYMDEAERLGDWVFIMSHGKLVASGTNQYLKQKFGTGYLLTVVLDHN----GDKRKMAVILT 792          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Fly
Match: ABCA (gene:FBgn0031170 transcript:FBtr0306679)

HSP 1 Score: 385.571 bits (989), Expect = 2.111e-108
Identity = 249/749 (33.24%), Postives = 408/749 (54.47%), Query Frame = 2
Query: 1103 SSIDIDNLSKQSSLGILAGIVFTDDFQYVTPQNA--TFLNYQIRMPASRIDST---KNFKVLDRFWTPI----PRVNTLTNFN----YYTSGFLFLQEIIDQAFIELITDNASVNIGSSMQIMPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTXXXXXXXXXXXXXXXXXGKXXXXXXXXXXXXXXXX-----XXXXXXCQCFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISD-NFRQREENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQI 3292
            + +++D +SK +     AG+ F D +  +T  +      ++ +R PA    +T    N  +  R +  I    PR     +      Y   GFL LQ  +  A++   +    +     M+  P+P Y+ D L+  +S++M  ++++++    T + K I  EKE +LKE M++MG+SN++HW +WF  + ++L +  IL+ I++K+      +                Y+VS IC CFM++ FF  ++ AA V G+++FI Y+P+   IN  D+LS     G  L++  +    I  I   E   +G Q+SN F    +D    +G  +IM+ +  V Y++I  YVE V PG +GVP+PW F FTR +W    +     +I + +  QR+       FE EP+   IG+ + +L K+F       +  L++  ++ +IT  LGHNGAGKTTTIS+LTG+  PTSGTA I  +DIR ++E  R  +G+CPQHN+LF  ++V +HI F+  +KG+    ++ ++   +K + L  K    S  LSGGMKRKLS+  A  G+++++  DEP++G+DP +RR +WDL+ +   + RT++LTTH MDEAD L DRIAI+  G+LKC G+S FLK+ +G GY L       ++ + C  N+ +         + K IP  K   +   + +  L  +++ +  F  +F QL+   D L +  YG+  TS+EEVF+KV  +     + + + +I
Sbjct:  137 TQLELDTVSKNA----FAGVQFDDAWANLTENDPLPNDFHFALRFPAELRTATIAIANTWLTMRLFPTIDLTGPRNEGDDDGGIPPGYLREGFLPLQHSLSMAYLRQKSGEQDLP-NVVMKRYPFPAYIFDPLLEGMSSIMSLIILLSFIYPCTYITKYITAEKEKQLKEVMKIMGLSNWLHWTAWFVKSFIMLTISAILIAILVKINWSEDVAVLTHANFTALVFFLIIYIVSSICFCFMMATFFSRASTAAAVTGLIWFIAYIPYSFTINSYDDLSLSSKLGWSLISNTAMGFGIKLILGFEGTGEGLQWSNFFTPVSVDDTLTLGAVMIMMLVSCVIYMIICLYVEQVMPGSFGVPRPWNFPFTREFWCGEREYTGVEDIPNGHVEQRDPK----AFETEPEGKHIGLQMRHLKKRF--GNKMVVKGLSMNMFEDEITVLLGHNGAGKTTTISMLTGMFPPTSGTAIINGSDIRTNIEGARMSLGICPQHNVLFDEMSVSNHIRFFSRMKGLRGKAVEQEVAKYLKMIELEDKANVASSKLSGGMKRKLSVCCALCGDTKVVLCDEPSSGMDPSARRQLWDLL-QQEKVGRTLLLTTHFMDEADVLGDRIAIMCDGELKCQGTSFFLKKQYGSGYRLIC-----VKRDDCETNEVT-------ALLNKYIPGLKPECDIGAELSYQLPDSASAK--FEEMFGQLEEQSDELHLNGYGVGITSMEEVFMKVGAEKDNTGNIKDQHEI 859          

HSP 2 Score: 338.191 bits (866), Expect = 1.865e-93
Identity = 238/710 (33.52%), Postives = 359/710 (50.56%), Query Frame = 1
Query: 4231 WINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNISGGDENYNA---------------------FEWDITG--NKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLD--VFKERERI-ELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDI-PINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLH------------------------PNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAK 6207
            W+N++   + P   N+  N +      +S  +Q     V N PL YT S L S +     L   LA  + F + F+ + +++FLI+ER + +KL Q+V GV  + +W+S F  D   Y ++ LIV++  + F          +  + +LL L+  AV+P +Y  S F  + +T F  +S  N+  G    I    +    +D    K   D L  IF IFP + L      +S + +  N +  +    A                     F W+  G   +   + +  V + LII+ +E +    L  K++ +  KP    T+  LD  V  ERERI +++ + L         TK  N  +D   K +G+            +AVN +S  V+E ECFGLLGVNGAGKTTTFKM+ G+E I+ G A + G S+  +    +K +G+CPQFDAL   LT  E L  +  +RG+Q S I  ++ DL+ K+     H +K T+  SGGNKRK+ TAIA+IG P +++LDEPT GMD  ARR LW ++  + +  K +++LTSH+MEECE LC RLAIMV+GE K IGS QHLK+KF     +KI++                         P + S  D + ++  +  E  +S   +E   ++  Y   + VK S IF + E  R    V++YSVSQ +L+E+F+ FAK
Sbjct: 1031 WLNNQALHTAPLTVNMVHNAIADKLFGSSVKIQ-----VTNAPLPYTTSTLLSQLSTGNNLGTQLASNLCFCMCFVSSIYILFLIKERESRAKLLQFVGGVKVWTFWLSQFICDFASYIVTALIVVITIVCFQETGLSTFGELGRYYLLLLLFGFAVLPFIYIMSLFFREPATGFARVSIVNIFCGMALFIVVVVMSSELFDT---KDTADILGWIFRIFPHFSLA-----MSLNKVYTNTATRNACAKAGALPPILLCELVPQCCNLKPYFAWEEPGVLPETVYMAVTGVVFFLIIIVLEFRLINELMFKIRQLISKPPPPPTEGQLDDDVANERERILQMSSNELA--------TK--NLVLDRVTKYYGQF-----------MAVNQVSLCVQEVECFGLLGVNGAGKTTTFKMMTGDERISSGAAYVQGLSLESNMNSIYKMIGYCPQFDALLDDLTGREVLRIFCMLRGVQESRIRQLSEDLA-KSFGFMKHIDKQTHAYSGGNKRKLSTAIAVIGSPSVIYLDEPTTGMDPAARRQLWNMVCRIRDSGK-SIVLTSHSMEECEALCTRLAIMVNGEFKCIGSTQHLKNKFSKGLILKIKVRRNLEALRQARLSGGYARNPDEQTVPAQMSQRDIDAVKEFVETEYPNSILQEEYQGILTFYIPLTGVKWSRIFGLMESNRDQLNVEDYSVSQTTLEEIFLEFAK 1704          

HSP 3 Score: 182.57 bits (462), Expect = 1.878e-45
Identity = 170/638 (26.65%), Postives = 291/638 (45.61%), Query Frame = 1
Query: 4387 SFIYAQMFLEVSLAIFVIFGLSFI-PASFVI-FLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQ---SYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMI-DLSFSYLRYNISGGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAI-INVSSEDKR---KLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVA--VILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFD----SSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRNISNGNALI 6252
            ++I+  +   +S  + +I  LSFI P +++  ++  E+    K    + G++ +++W + F    I  +IS  I+I   +  N+    + +   N  A +  L +Y ++ I   +  + F S++STA  V      L+  +  I  +   +  YDD SL S                LG  +I + +  +    I G +      +W      +     L +G  +I++ +       +C+ ++ V    + +    +    +E    E  +  + D+    G  +  +P   F  +  GK I + +    KR   K+ V  +S  + E E   LLG NGAGKTTT  ML G    T G AIING  I  +   A  ++G CPQ + L   ++    + F++R++G++   +   V   LK + L    N  +  +SGG KRK+    AL G  K+V  DEP+ GMD  ARR LW L+Q    + KV   ++LT+H M+E +VL  R+AIM DGE+K  G+   LK ++G  Y    RL   +    + NE+  ++NK I     +K E  +  E  +     +S K  ++F   E+      +  Y V   S++EVF+        T NI + + ++
Sbjct:  258 AYIFDPLLEGMSSIMSLIILLSFIYPCTYITKYITAEKEKQLKEVMKIMGLSNWLHWTAWFVKSFIMLTISA-ILIAILVKINWSEDVAVLTHANFTALVFFLIIYIVSSICFCFMMATFFSRASTAAAVTG----LIWFIAYIP-YSFTINSYDDLSLSS---------------KLGWSLISNTAMGFGIKLILGFEGTGEGLQWSNFFTPVSVDDTLTLGAVMIMMLVSCVIYMIICLYVEQVMPGSFGVPRPWNFPFTREFWCGEREYTGVEDIPN--GHVEQRDPKA-FETEPEGKHIGLQMRHLKKRFGNKMVVKGLSMNMFEDEITVLLGHNGAGKTTTISMLTGMFPPTSGTAIINGSDIRTNIEGARMSLGICPQHNVLFDEMSVSNHIRFFSRMKGLRGKAVEQEVAKYLKMIELEDKANVASSKLSGGMKRKLSVCCALCGDTKVVLCDEPSSGMDPSARRQLWDLLQ----QEKVGRTLLLTTHFMDEADVLGDRIAIMCDGELKCQGTSFFLKKQYGSGY----RLICVKRDDCETNEVTALLNKYI---PGLKPECDIGAELSYQLPDSASAKFEEMFGQLEEQSDELHLNGYGVGITSMEEVFMKVGAEKDNTGNIKDQHEIM 860          

HSP 4 Score: 171.014 bits (432), Expect = 5.477e-42
Identity = 103/324 (31.79%), Postives = 175/324 (54.01%), Query Frame = 2
Query: 2324 ALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQS----------------ETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVA 3247
            A++ ++L   + +  G LG NGAGKTTT  ++TG    +SG A++    +  +M  I   IG CPQ + L   LT  + +  + +L+G+ +S I+    D+ K  G  K +   +   SGG KRKLS A+A +G+  +I+LDEPT G+DP +RR +W+++ + R   ++I+LT+H M+E + LC R+AI+  G+ KC GS+  LK  F  G  L ++    +++                +T     +      + EF++   PNS L +E +   T  +        +++ +F  ++S+ D L +  Y +S T+LEE+FL+ A
Sbjct: 1383 AVNQVSLCVQEVECFGLLGVNGAGKTTTFKMMTGDERISSGAAYVQGLSLESNMNSIYKMIGYCPQFDALLDDLTGREVLRIFCMLRGVQESRIRQLSEDLAKSFGFMKHIDKQTHAYSGGNKRKLSTAIAVIGSPSVIYLDEPTTGMDPAARRQLWNMVCRIRDSGKSIVLTSHSMEECEALCTRLAIMVNGEFKCIGSTQHLKNKFSKGLILKIKVRRNLEALRQARLSGGYARNPDEQTVPAQMSQRDIDAVKEFVETEYPNSILQEEYQGILTFYIPLTGV---KWSRIFGLMESNRDQLNVEDYSVSQTTLEEIFLEFA 1703          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Fly
Match: ABCA (gene:FBgn0031170 transcript:FBtr0332489)

HSP 1 Score: 385.185 bits (988), Expect = 2.245e-108
Identity = 249/749 (33.24%), Postives = 408/749 (54.47%), Query Frame = 2
Query: 1103 SSIDIDNLSKQSSLGILAGIVFTDDFQYVTPQNA--TFLNYQIRMPASRIDST---KNFKVLDRFWTPI----PRVNTLTNFN----YYTSGFLFLQEIIDQAFIELITDNASVNIGSSMQIMPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTXXXXXXXXXXXXXXXXXGKXXXXXXXXXXXXXXXX-----XXXXXXCQCFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISD-NFRQREENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQI 3292
            + +++D +SK +     AG+ F D +  +T  +      ++ +R PA    +T    N  +  R +  I    PR     +      Y   GFL LQ  +  A++   +    +     M+  P+P Y+ D L+  +S++M  ++++++    T + K I  EKE +LKE M++MG+SN++HW +WF  + ++L +  IL+ I++K+      +                Y+VS IC CFM++ FF  ++ AA V G+++FI Y+P+   IN  D+LS     G  L++  +    I  I   E   +G Q+SN F    +D    +G  +IM+ +  V Y++I  YVE V PG +GVP+PW F FTR +W    +     +I + +  QR+       FE EP+   IG+ + +L K+F       +  L++  ++ +IT  LGHNGAGKTTTIS+LTG+  PTSGTA I  +DIR ++E  R  +G+CPQHN+LF  ++V +HI F+  +KG+    ++ ++   +K + L  K    S  LSGGMKRKLS+  A  G+++++  DEP++G+DP +RR +WDL+ +   + RT++LTTH MDEAD L DRIAI+  G+LKC G+S FLK+ +G GY L       ++ + C  N+ +         + K IP  K   +   + +  L  +++ +  F  +F QL+   D L +  YG+  TS+EEVF+KV  +     + + + +I
Sbjct:  115 TQLELDTVSKNA----FAGVQFDDAWANLTENDPLPNDFHFALRFPAELRTATIAIANTWLTMRLFPTIDLTGPRNEGDDDGGIPPGYLREGFLPLQHSLSMAYLRQKSGEQDLP-NVVMKRYPFPAYIFDPLLEGMSSIMSLIILLSFIYPCTYITKYITAEKEKQLKEVMKIMGLSNWLHWTAWFVKSFIMLTISAILIAILVKINWSEDVAVLTHANFTALVFFLIIYIVSSICFCFMMATFFSRASTAAAVTGLIWFIAYIPYSFTINSYDDLSLSSKLGWSLISNTAMGFGIKLILGFEGTGEGLQWSNFFTPVSVDDTLTLGAVMIMMLVSCVIYMIICLYVEQVMPGSFGVPRPWNFPFTREFWCGEREYTGVEDIPNGHVEQRDPK----AFETEPEGKHIGLQMRHLKKRF--GNKMVVKGLSMNMFEDEITVLLGHNGAGKTTTISMLTGMFPPTSGTAIINGSDIRTNIEGARMSLGICPQHNVLFDEMSVSNHIRFFSRMKGLRGKAVEQEVAKYLKMIELEDKANVASSKLSGGMKRKLSVCCALCGDTKVVLCDEPSSGMDPSARRQLWDLL-QQEKVGRTLLLTTHFMDEADVLGDRIAIMCDGELKCQGTSFFLKKQYGSGYRLIC-----VKRDDCETNEVT-------ALLNKYIPGLKPECDIGAELSYQLPDSASAK--FEEMFGQLEEQSDELHLNGYGVGITSMEEVFMKVGAEKDNTGNIKDQHEI 837          

HSP 2 Score: 338.576 bits (867), Expect = 1.457e-93
Identity = 238/710 (33.52%), Postives = 359/710 (50.56%), Query Frame = 1
Query: 4231 WINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNISGGDENYNA---------------------FEWDITG--NKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLD--VFKERERI-ELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDI-PINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLH------------------------PNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAK 6207
            W+N++   + P   N+  N +      +S  +Q     V N PL YT S L S +     L   LA  + F + F+ + +++FLI+ER + +KL Q+V GV  + +W+S F  D   Y ++ LIV++  + F          +  + +LL L+  AV+P +Y  S F  + +T F  +S  N+  G    I    +    +D    K   D L  IF IFP + L      +S + +  N +  +    A                     F W+  G   +   + +  V + LII+ +E +    L  K++ +  KP    T+  LD  V  ERERI +++ + L         TK  N  +D   K +G+            +AVN +S  V+E ECFGLLGVNGAGKTTTFKM+ G+E I+ G A + G S+  +    +K +G+CPQFDAL   LT  E L  +  +RG+Q S I  ++ DL+ K+     H +K T+  SGGNKRK+ TAIA+IG P +++LDEPT GMD  ARR LW ++  + +  K +++LTSH+MEECE LC RLAIMV+GE K IGS QHLK+KF     +KI++                         P + S  D + ++  +  E  +S   +E   ++  Y   + VK S IF + E  R    V++YSVSQ +L+E+F+ FAK
Sbjct: 1009 WLNNQALHTAPLTVNMVHNAIADKLFGSSVKIQ-----VTNAPLPYTTSTLLSQLSTGNNLGTQLASNLCFCMCFVSSIYILFLIKERESRAKLLQFVGGVKVWTFWLSQFICDFASYIVTALIVVITIVCFQETGLSTFGELGRYYLLLLLFGFAVLPFIYIMSLFFREPATGFARVSIVNIFCGMALFIVVVVMSSELFDT---KDTADILGWIFRIFPHFSLA-----MSLNKVYTNTATRNACAKAGALPPILLCELVPQCCNLKPYFAWEEPGVLPETVYMAVTGVVFFLIIIVLEFRLINELMFKIRQLISKPPPPPTEGQLDDDVANERERILQMSSNELA--------TK--NLVLDRVTKYYGQF-----------MAVNQVSLCVQEVECFGLLGVNGAGKTTTFKMMTGDERISSGAAYVQGLSLESNMNSIYKMIGYCPQFDALLDDLTGREVLRIFCMLRGVQESRIRQLSEDLA-KSFGFMKHIDKQTHAYSGGNKRKLSTAIAVIGSPSVIYLDEPTTGMDPAARRQLWNMVCRIRDSGK-SIVLTSHSMEECEALCTRLAIMVNGEFKCIGSTQHLKNKFSKGLILKIKVRRNLEALRQARLSGGYARNPDEQTVPAQMSQRDIDAVKEFVETEYPNSILQEEYQGILTFYIPLTGVKWSRIFGLMESNRDQLNVEDYSVSQTTLEEIFLEFAK 1682          

HSP 3 Score: 182.57 bits (462), Expect = 1.676e-45
Identity = 170/638 (26.65%), Postives = 292/638 (45.77%), Query Frame = 1
Query: 4387 SFIYAQMFLEVSLAIFVIFGLSFI-PASFVI-FLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQ---SYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMI-DLSFSYLRYNISGGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAI-INVSSEDKR---KLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVA--VILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFD----SSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRNISNGNALI 6252
            ++I+  +   +S  + +I  LSFI P +++  ++  E+    K    + G++ +++W + F    I  +IS  I+I   +  N+    + +   N  A +  L +Y ++ I   +  + F S++STA    +A   L+  +  I  +   +  YDD SL S                LG  +I + +  +    I G +      +W      +     L +G  +I++ +       +C+ ++ V    + +    +    +E    E  +  + D+    G  +  +P   F  +  GK I + +    KR   K+ V  +S  + E E   LLG NGAGKTTT  ML G    T G AIING  I  +   A  ++G CPQ + L   ++    + F++R++G++   +   V   LK + L    N  +  +SGG KRK+    AL G  K+V  DEP+ GMD  ARR LW L+Q    + KV   ++LT+H M+E +VL  R+AIM DGE+K  G+   LK ++G  Y    RL   +    + NE+  ++NK I     +K E  +  E  +     +S K  ++F   E+      +  Y V   S++EVF+        T NI + + ++
Sbjct:  236 AYIFDPLLEGMSSIMSLIILLSFIYPCTYITKYITAEKEKQLKEVMKIMGLSNWLHWTAWFVKSFIMLTISA-ILIAILVKINWSEDVAVLTHANFTALVFFLIIYIVSSICFCFMMATFFSRASTA----AAVTGLIWFIAYIP-YSFTINSYDDLSLSS---------------KLGWSLISNTAMGFGIKLILGFEGTGEGLQWSNFFTPVSVDDTLTLGAVMIMMLVSCVIYMIICLYVEQVMPGSFGVPRPWNFPFTREFWCGEREYTGVEDIPN--GHVEQRDPKA-FETEPEGKHIGLQMRHLKKRFGNKMVVKGLSMNMFEDEITVLLGHNGAGKTTTISMLTGMFPPTSGTAIINGSDIRTNIEGARMSLGICPQHNVLFDEMSVSNHIRFFSRMKGLRGKAVEQEVAKYLKMIELEDKANVASSKLSGGMKRKLSVCCALCGDTKVVLCDEPSSGMDPSARRQLWDLLQ----QEKVGRTLLLTTHFMDEADVLGDRIAIMCDGELKCQGTSFFLKKQYGSGY----RLICVKRDDCETNEVTALLNKYI---PGLKPECDIGAELSYQLPDSASAKFEEMFGQLEEQSDELHLNGYGVGITSMEEVFMKVGAEKDNTGNIKDQHEIM 838          

HSP 4 Score: 171.014 bits (432), Expect = 5.281e-42
Identity = 103/324 (31.79%), Postives = 175/324 (54.01%), Query Frame = 2
Query: 2324 ALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQS----------------ETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVA 3247
            A++ ++L   + +  G LG NGAGKTTT  ++TG    +SG A++    +  +M  I   IG CPQ + L   LT  + +  + +L+G+ +S I+    D+ K  G  K +   +   SGG KRKLS A+A +G+  +I+LDEPT G+DP +RR +W+++ + R   ++I+LT+H M+E + LC R+AI+  G+ KC GS+  LK  F  G  L ++    +++                +T     +      + EF++   PNS L +E +   T  +        +++ +F  ++S+ D L +  Y +S T+LEE+FL+ A
Sbjct: 1361 AVNQVSLCVQEVECFGLLGVNGAGKTTTFKMMTGDERISSGAAYVQGLSLESNMNSIYKMIGYCPQFDALLDDLTGREVLRIFCMLRGVQESRIRQLSEDLAKSFGFMKHIDKQTHAYSGGNKRKLSTAIAVIGSPSVIYLDEPTTGMDPAARRQLWNMVCRIRDSGKSIVLTSHSMEECEALCTRLAIMVNGEFKCIGSTQHLKNKFSKGLILKIKVRRNLEALRQARLSGGYARNPDEQTVPAQMSQRDIDAVKEFVETEYPNSILQEEYQGILTFYIPLTGV---KWSRIFGLMESNRDQLNVEDYSVSQTTLEEIFLEFA 1681          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Fly
Match: ABCA (gene:FBgn0031170 transcript:FBtr0332488)

HSP 1 Score: 385.185 bits (988), Expect = 2.685e-108
Identity = 249/749 (33.24%), Postives = 408/749 (54.47%), Query Frame = 2
Query: 1103 SSIDIDNLSKQSSLGILAGIVFTDDFQYVTPQNA--TFLNYQIRMPASRIDST---KNFKVLDRFWTPI----PRVNTLTNFN----YYTSGFLFLQEIIDQAFIELITDNASVNIGSSMQIMPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTXXXXXXXXXXXXXXXXXGKXXXXXXXXXXXXXXXX-----XXXXXXCQCFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISD-NFRQREENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQI 3292
            + +++D +SK +     AG+ F D +  +T  +      ++ +R PA    +T    N  +  R +  I    PR     +      Y   GFL LQ  +  A++   +    +     M+  P+P Y+ D L+  +S++M  ++++++    T + K I  EKE +LKE M++MG+SN++HW +WF  + ++L +  IL+ I++K+      +                Y+VS IC CFM++ FF  ++ AA V G+++FI Y+P+   IN  D+LS     G  L++  +    I  I   E   +G Q+SN F    +D    +G  +IM+ +  V Y++I  YVE V PG +GVP+PW F FTR +W    +     +I + +  QR+       FE EP+   IG+ + +L K+F       +  L++  ++ +IT  LGHNGAGKTTTIS+LTG+  PTSGTA I  +DIR ++E  R  +G+CPQHN+LF  ++V +HI F+  +KG+    ++ ++   +K + L  K    S  LSGGMKRKLS+  A  G+++++  DEP++G+DP +RR +WDL+ +   + RT++LTTH MDEAD L DRIAI+  G+LKC G+S FLK+ +G GY L       ++ + C  N+ +         + K IP  K   +   + +  L  +++ +  F  +F QL+   D L +  YG+  TS+EEVF+KV  +     + + + +I
Sbjct:  115 TQLELDTVSKNA----FAGVQFDDAWANLTENDPLPNDFHFALRFPAELRTATIAIANTWLTMRLFPTIDLTGPRNEGDDDGGIPPGYLREGFLPLQHSLSMAYLRQKSGEQDLP-NVVMKRYPFPAYIFDPLLEGMSSIMSLIILLSFIYPCTYITKYITAEKEKQLKEVMKIMGLSNWLHWTAWFVKSFIMLTISAILIAILVKINWSEDVAVLTHANFTALVFFLIIYIVSSICFCFMMATFFSRASTAAAVTGLIWFIAYIPYSFTINSYDDLSLSSKLGWSLISNTAMGFGIKLILGFEGTGEGLQWSNFFTPVSVDDTLTLGAVMIMMLVSCVIYMIICLYVEQVMPGSFGVPRPWNFPFTREFWCGEREYTGVEDIPNGHVEQRDPK----AFETEPEGKHIGLQMRHLKKRF--GNKMVVKGLSMNMFEDEITVLLGHNGAGKTTTISMLTGMFPPTSGTAIINGSDIRTNIEGARMSLGICPQHNVLFDEMSVSNHIRFFSRMKGLRGKAVEQEVAKYLKMIELEDKANVASSKLSGGMKRKLSVCCALCGDTKVVLCDEPSSGMDPSARRQLWDLL-QQEKVGRTLLLTTHFMDEADVLGDRIAIMCDGELKCQGTSFFLKKQYGSGYRLIC-----VKRDDCETNEVT-------ALLNKYIPGLKPECDIGAELSYQLPDSASAK--FEEMFGQLEEQSDELHLNGYGVGITSMEEVFMKVGAEKDNTGNIKDQHEI 837          

HSP 2 Score: 338.576 bits (867), Expect = 1.372e-93
Identity = 238/710 (33.52%), Postives = 359/710 (50.56%), Query Frame = 1
Query: 4231 WINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNISGGDENYNA---------------------FEWDITG--NKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLD--VFKERERI-ELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDI-PINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLH------------------------PNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAK 6207
            W+N++   + P   N+  N +      +S  +Q     V N PL YT S L S +     L   LA  + F + F+ + +++FLI+ER + +KL Q+V GV  + +W+S F  D   Y ++ LIV++  + F          +  + +LL L+  AV+P +Y  S F  + +T F  +S  N+  G    I    +    +D    K   D L  IF IFP + L      +S + +  N +  +    A                     F W+  G   +   + +  V + LII+ +E +    L  K++ +  KP    T+  LD  V  ERERI +++ + L         TK  N  +D   K +G+            +AVN +S  V+E ECFGLLGVNGAGKTTTFKM+ G+E I+ G A + G S+  +    +K +G+CPQFDAL   LT  E L  +  +RG+Q S I  ++ DL+ K+     H +K T+  SGGNKRK+ TAIA+IG P +++LDEPT GMD  ARR LW ++  + +  K +++LTSH+MEECE LC RLAIMV+GE K IGS QHLK+KF     +KI++                         P + S  D + ++  +  E  +S   +E   ++  Y   + VK S IF + E  R    V++YSVSQ +L+E+F+ FAK
Sbjct: 1009 WLNNQALHTAPLTVNMVHNAIADKLFGSSVKIQ-----VTNAPLPYTTSTLLSQLSTGNNLGTQLASNLCFCMCFVSSIYILFLIKERESRAKLLQFVGGVKVWTFWLSQFICDFASYIVTALIVVITIVCFQETGLSTFGELGRYYLLLLLFGFAVLPFIYIMSLFFREPATGFARVSIVNIFCGMALFIVVVVMSSELFDT---KDTADILGWIFRIFPHFSLA-----MSLNKVYTNTATRNACAKAGALPPILLCELVPQCCNLKPYFAWEEPGVLPETVYMAVTGVVFFLIIIVLEFRLINELMFKIRQLISKPPPPPTEGQLDDDVANERERILQMSSNELA--------TK--NLVLDRVTKYYGQF-----------MAVNQVSLCVQEVECFGLLGVNGAGKTTTFKMMTGDERISSGAAYVQGLSLESNMNSIYKMIGYCPQFDALLDDLTGREVLRIFCMLRGVQESRIRQLSEDLA-KSFGFMKHIDKQTHAYSGGNKRKLSTAIAVIGSPSVIYLDEPTTGMDPAARRQLWNMVCRIRDSGK-SIVLTSHSMEECEALCTRLAIMVNGEFKCIGSTQHLKNKFSKGLILKIKVRRNLEALRQARLSGGYARNPDEQTVPAQMSQRDIDAVKEFVETEYPNSILQEEYQGILTFYIPLTGVKWSRIFGLMESNRDQLNVEDYSVSQTTLEEIFLEFAK 1682          

HSP 3 Score: 182.956 bits (463), Expect = 1.336e-45
Identity = 170/638 (26.65%), Postives = 292/638 (45.77%), Query Frame = 1
Query: 4387 SFIYAQMFLEVSLAIFVIFGLSFI-PASFVI-FLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQ---SYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMI-DLSFSYLRYNISGGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAI-INVSSEDKR---KLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVA--VILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFD----SSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRNISNGNALI 6252
            ++I+  +   +S  + +I  LSFI P +++  ++  E+    K    + G++ +++W + F    I  +IS  I+I   +  N+    + +   N  A +  L +Y ++ I   +  + F S++STA    +A   L+  +  I  +   +  YDD SL S                LG  +I + +  +    I G +      +W      +     L +G  +I++ +       +C+ ++ V    + +    +    +E    E  +  + D+    G  +  +P   F  +  GK I + +    KR   K+ V  +S  + E E   LLG NGAGKTTT  ML G    T G AIING  I  +   A  ++G CPQ + L   ++    + F++R++G++   +   V   LK + L    N  +  +SGG KRK+    AL G  K+V  DEP+ GMD  ARR LW L+Q    + KV   ++LT+H M+E +VL  R+AIM DGE+K  G+   LK ++G  Y    RL   +    + NE+  ++NK I     +K E  +  E  +     +S K  ++F   E+      +  Y V   S++EVF+        T NI + + ++
Sbjct:  236 AYIFDPLLEGMSSIMSLIILLSFIYPCTYITKYITAEKEKQLKEVMKIMGLSNWLHWTAWFVKSFIMLTISA-ILIAILVKINWSEDVAVLTHANFTALVFFLIIYIVSSICFCFMMATFFSRASTA----AAVTGLIWFIAYIP-YSFTINSYDDLSLSS---------------KLGWSLISNTAMGFGIKLILGFEGTGEGLQWSNFFTPVSVDDTLTLGAVMIMMLVSCVIYMIICLYVEQVMPGSFGVPRPWNFPFTREFWCGEREYTGVEDIPN--GHVEQRDPKA-FETEPEGKHIGLQMRHLKKRFGNKMVVKGLSMNMFEDEITVLLGHNGAGKTTTISMLTGMFPPTSGTAIINGSDIRTNIEGARMSLGICPQHNVLFDEMSVSNHIRFFSRMKGLRGKAVEQEVAKYLKMIELEDKANVASSKLSGGMKRKLSVCCALCGDTKVVLCDEPSSGMDPSARRQLWDLLQ----QEKVGRTLLLTTHFMDEADVLGDRIAIMCDGELKCQGTSFFLKKQYGSGY----RLICVKRDDCETNEVTALLNKYI---PGLKPECDIGAELSYQLPDSASAKFEEMFGQLEEQSDELHLNGYGVGITSMEEVFMKVGAEKDNTGNIKDQHEIM 838          

HSP 4 Score: 171.4 bits (433), Expect = 3.864e-42
Identity = 105/339 (30.97%), Postives = 182/339 (53.69%), Query Frame = 2
Query: 2324 ALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQS----------------ETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVAD---DPSQISHKRQE 3283
            A++ ++L   + +  G LG NGAGKTTT  ++TG    +SG A++    +  +M  I   IG CPQ + L   LT  + +  + +L+G+ +S I+    D+ K  G  K +   +   SGG KRKLS A+A +G+  +I+LDEPT G+DP +RR +W+++ + R   ++I+LT+H M+E + LC R+AI+  G+ KC GS+  LK  F  G  L ++    +++                +T     +      + EF++   PNS L +E +   T  +        +++ +F  ++S+ D L +  Y +S T+LEE+FL+ A    + ++ +H+  E
Sbjct: 1361 AVNQVSLCVQEVECFGLLGVNGAGKTTTFKMMTGDERISSGAAYVQGLSLESNMNSIYKMIGYCPQFDALLDDLTGREVLRIFCMLRGVQESRIRQLSEDLAKSFGFMKHIDKQTHAYSGGNKRKLSTAIAVIGSPSVIYLDEPTTGMDPAARRQLWNMVCRIRDSGKSIVLTSHSMEECEALCTRLAIMVNGEFKCIGSTQHLKNKFSKGLILKIKVRRNLEALRQARLSGGYARNPDEQTVPAQMSQRDIDAVKEFVETEYPNSILQEEYQGILTFYIPLTGV---KWSRIFGLMESNRDQLNVEDYSVSQTTLEEIFLEFAKYQREDTRANHRLSE 1696          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Fly
Match: CG6052 (gene:FBgn0036747 transcript:FBtr0075195)

HSP 1 Score: 339.732 bits (870), Expect = 6.041e-94
Identity = 249/731 (34.06%), Postives = 405/731 (55.40%), Query Frame = 2
Query: 1151 LAGIVFTDDFQYVTPQNATF---LNYQIRMPASR-------IDSTKNFKVLDRFWTPIPRVNTLTN-----FNYYTSGFLFLQEIIDQAFIELITDNASVNIGS-SMQIMPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTXXXXXXXXXXXXXXXXXG-----KXXXXXXXXXXXXXXXXXXXXXXCQCFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNA-----INFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENITIDGFEKEPD---DLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSE-IKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADD 3253
            LAG+ F D+ + V   +A +   LNY +R P+         ID+ +  ++   + T   R N L N       Y   GFL +Q  +  +++ L +      I +  +Q  PY  Y  D+L+S L  L+PF++++++    + + K +  EKE +LKE M+++G+ N++HWV+WF  + ++L+L + L+  ++ +       +LTFSS + + L L  YVV+ +C CFM++V F  ++ A+ V  I +F+ Y+P+     + + LS        LL  + F N+     I+ I   E   +G  + N+F+    D +  + + ++ +   S+ +I I  YVE VFPG+YGVP+ W F+  + YW  +  +   + I  +F+       + G  K        E+GI + NL K + K K  A+  ++LK ++++IT  LGHNGAGKTTTI+++TGI+ PTSGTA +   DIR  +   R  +G+CPQ+NILF  ++V DHI F+  LKG+  ++ +++++   +  + L  K    +KNLSGGMKRKLS+  A  GN++++  DEP++G+D   RR +WDL+   +   RTI+LTTH+MDEAD L DRIAI+S+GKL+C G+S +LK+ FG GY L            C      + G  + + I+K +P  K      T+ T  L    + +  F  L + LD     L++  YGLS  +LE+VF+ V  D
Sbjct:  125 LAGVQFEDN-ENVNTNDAGYPLNLNYSLRFPSELRTMQGPIIDTWRTSRLFLSYDTSGSR-NRLDNDGGVPVGYIREGFLPIQHALTMSWLALASGVTDTGIPAIHLQRFPYRAYTYDQLLSGLRQLLPFVILLSFIYPASTVTKYVTSEKELQLKEIMKLIGVHNWLHWVAWFVKSYIMLMLVVFLIMSLIMVKFYASVAVLTFSSWVPVLLFLHTYVVTSVCLCFMLAVLFSKASTASAVAAIFWFLTYIPYSFGYYYYERLSLMS----KLLISLIFSNSALGFGIHVIVMWEGTGEGITWRNMFHPVSTDDSLTLFYIIMTMSFGSIMFISICLYVEQVFPGEYGVPRRWNFMCHKNYWRQYVPS---LNIVPSFQT-----ILHGSAKAKSCRRAREVGIQLFNLQKNYGKLK--AVKGISLKMHRNEITVLLGHNGAGKTTTINMITGIVKPTSGTAIVNGYDIRTHLAKARESLGICPQNNILFKEMSVRDHIIFFSKLKGIRGTKAVENEVGKYMTMLKLQDKSYVAAKNLSGGMKRKLSLCCALCGNAKVVLCDEPSSGIDAAGRRSLWDLLQSEKD-GRTILLTTHYMDEADVLGDRIAILSEGKLQCQGTSFYLKKRFGTGYLL-----------VCIMQSGCDVGA-VTQLIRKYVPPIKPERVLGTELTYRLPTEYSKK--FAELLQDLDEKCAQLQLVGYGLSGATLEDVFMAVNTD 824          

HSP 2 Score: 311.997 bits (798), Expect = 3.142e-85
Identity = 233/708 (32.91%), Postives = 349/708 (49.29%), Query Frame = 1
Query: 4228 IWINSKGYISMPAYANIFSNLLLRSTVNASKAL-QNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSY-LRYNISGGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKT------LCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDI-PINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPN----------------------------------RNSLSDRN-EIETIINKEIWSSARMKEENAVIIEYRFDSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFA-KNDS 6216
            +W+N+K   + P   N+  N L      A K L Q+    V N PL Y+       +     L   ++I +   + FI A + I +I ER T +KL Q++SGV+   YW S+  WD + + +S L  IL   AF    YI   ++  +  +L ++    I   Y  S   S ++T F  IS  N L+G  T +   ++ L  ++   LK   + L   F + P Y L      +   Y +R   S G       +       IC     + GW    V +E  +         L I + D K+    +I ++  + F +R+R+E    + ND   V    ++    I+   K     +  +S   + KLAV  ISF V   ECFGLLG+NGAGKT+TFKML G+E IT G A I+G +I   T K ++ +G+CPQFDAL   LT  E L  Y  +RG+Q   + PI   L++ +     H +K T   SGGN+RK+ TAI+++G P +++LDEPT GMD  ARR LW++I  +    K +++LTSH+M+ECE LC RLAIMVDGE K +GSVQ LK++F     +K+++                                      +S +DR  ++   I+KEI   A +KEE   +I Y    S  LS IF++ E       +++Y + Q  L+E+F++FA K DS
Sbjct:  994 VWLNNKPLHTAPLTLNLLHNAL------AIKLLGQDASTYVTNEPLPYSDDTRTLRLNKGQVLGAEISINLSLTMCFITAFYAIPIIRERETRAKLLQFLSGVDVCAYWTSHIVWDYLVFVLSALSSILTIAAFKEIGYITPLDLSRYFYMLLIFGFPGIMLSYAASGCFSDAATGFTRISIINTLMG--TGLFLMFMTL-NFEAFQLKDVAEKLAWYFRLSPHYSLASSTHSIHIGYNIRRGCSIGGIRKLPKQLRCRNVPICCDIPGYYGWRKPGVLVEITYMIMLGSTLFLLIVMHDAKV--CNLIAEKLGNCFSKRKRVEGGTSIEND--SVVAEQRVVREMINSGRKDVPLLVYKISKRYRSKLAVKAISFHVPHAECFGLLGINGAGKTSTFKMLAGDEKITSGEAYIDGTNI--STHKVYRKIGYCPQFDALFEDLTGRETLNIYCLLRGVQRRHVTPICWGLAI-SFGFAKHMDKQTKHYSGGNRRKLSTAISVLGNPSVLYLDEPTSGMDPAARRQLWQIIGLIRTAGK-SIVLTSHSMDECEALCSRLAIMVDGEFKCLGSVQSLKNQFSKGLILKVKVKHKKKTFQRVVEDSSSSNDKKSISETDLKFLQMASVMESSQADRILKVNRFISKEI-PDAELKEEYNGLITYYIPHSKTLSKIFQLLETNSHKLNIEDYLIMQTRLEEIFLDFASKRDS 1683          

HSP 3 Score: 163.31 bits (412), Expect = 1.308e-39
Identity = 118/366 (32.24%), Postives = 188/366 (51.37%), Query Frame = 2
Query: 2267 EIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLF---------LEKSFEIQSETCHNNKASESGTKLLE------------------FIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVAD--DPSQISHKR 3277
            ++ +L+  + K++ +SK  A+  ++     ++  G LG NGAGKT+T  +L G    TSG A+I   +I      +  KIG CPQ + LF  LT  + +  Y LL+G+ +  +      +    G +K +   +K+ SGG +RKLS A++ +GN  +++LDEPT+G+DP +RR +W +I   R+  ++I+LT+H MDE + LC R+AI+  G+ KC GS   LK  F  G  L           ++  E  S +      SE+  K L+                  FI K IP+++L +E     T  + H+ T     + +F+ L+++   L I  Y +  T LEE+FL  A   D S I  KR
Sbjct: 1333 DVPLLVYKISKRY-RSKL-AVKAISFHVPHAECFGLLGINGAGKTSTFKMLAGDEKITSGEAYIDGTNI--STHKVYRKIGYCPQFDALFEDLTGRETLNIYCLLRGVQRRHVTPICWGLAISFGFAKHMDKQTKHYSGGNRRKLSTAISVLGNPSVLYLDEPTSGMDPAARRQLWQIIGLIRTAGKSIVLTSHSMDECEALCSRLAIMVDGEFKCLGSVQSLKNQFSKGLILKVKVKHKKKTFQRVVEDSSSSNDKKSISETDLKFLQMASVMESSQADRILKVNRFISKEIPDAELKEEYNGLITYYIPHSKT----LSKIFQLLETNSHKLNIEDYLIMQTRLEEIFLDFASKRDSSDIFTKR 1690          

HSP 4 Score: 156.377 bits (394), Expect = 1.507e-37
Identity = 160/626 (25.56%), Postives = 286/626 (45.69%), Query Frame = 1
Query: 4387 SFIYAQMFLEVSLAIFVIFGLSFI-PASFVI-FLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAF----IVLLFLYSLAV--IPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNISGGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKE--RERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPIN-VDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIE--YRFDS--SVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSV 6219
            ++ Y Q+   +   +  +  LSFI PAS V  ++  E+    K    + GV+ +++W++ F    +K  I +++V+   ++     +  S  +L F     VLLFL++  V  +   +  +   SK+STA  V + +  L     T   +    Y Y+  SL S       I LIF    LG G+         + I   +       W    + + +   L + + ++ +   S    ++C+ ++ V    Y +    +    K   R+ +   + V +    ++G  K  +     R +  G  + N+     +  AV  IS  +   E   LLG NGAGKTTT  M+ G    T G AI+NGY I     KA +++G CPQ + L   ++  + + F+++++GI+ +    N V   +  L L          +SGG KRK+    AL G  K+V  DEP+ G+DA  RR LW L+Q  + +    ++LT+H M+E +VL  R+AI+ +G+++  G+  +LK +FG  Y +   +     S  D   +  +I K +     +K E  +  E  YR  +  S K +++ +  ++      +  Y +S  +L++VF+    +  V
Sbjct:  236 AYTYDQLLSGLRQLLPFVILLSFIYPASTVTKYVTSEKELQLKEIMKLIGVHNWLHWVAWF----VKSYIMLMLVVFLIMSLIMVKFYASVAVLTFSSWVPVLLFLHTYVVTSVCLCFMLAVLFSKASTASAVAAIFWFL-----TYIPYSFGYYYYERLSLMSK----LLISLIFSNSALGFGI---------HVIVMWEGTGEGITWRNMFHPVSTDDSLTLFYIIMTMSFGSIMFISICLYVEQVFPGEYGVPRRWNFMCHKNYWRQYVPSLNIVPSFQTILHGSAKAKSCR---RAREVGIQLFNLQKNYGKLKAVKGISLKMHRNEITVLLGHNGAGKTTTINMITGIVKPTSGTAIVNGYDIRTHLAKARESLGICPQNNILFKEMSVRDHIIFFSKLKGIRGTKAVENEVGKYMTMLKLQDKSYVAAKNLSGGMKRKLSLCCALCGNAKVVLCDEPSSGIDAAGRRSLWDLLQ--SEKDGRTILLTTHYMDEADVLGDRIAILSEGKLQCQGTSFYLKKRFGTGYLLVCIMQ----SGCDVGAVTQLIRKYV---PPIKPERVLGTELTYRLPTEYSKKFAELLQDLDEKCAQLQLVGYGLSGATLEDVFMAVNTDKRV 827          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Fly
Match: CG34120 (gene:FBgn0083956 transcript:FBtr0343018)

HSP 1 Score: 254.218 bits (648), Expect = 2.933e-67
Identity = 215/780 (27.56%), Postives = 361/780 (46.28%), Query Frame = 1
Query: 4072 SCQVIGESQIWFDFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYL------RYNISGGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSED------KRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENA----VIIEYRFDSSVK----LSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRNISNGNALIQKPNF-NND--------------GYLNEGFEKT 6306
            SC  +GE +++   +QS +   ++     + ++  Y        G+  + + +W N+KGY SM A+ N  ++ LLR+T+N S++     I   N P K   ++L +    +   + S+   ++     + AS  ++L+ ERV G KLQQ + GV+   YW+    WD +   + +++ ++  L F    ++  + ++  I L   +S A +P ++      S SS A V I   NL+V  +T      L +   D  +      AL + FLIFP + LG G ++L  +Y+      RY+I   D   +    D+ G    +L ++ V   +I V +E    + L  +++ +            LD    RE  +L        L++  +  I+   +D      G+A   V +E+      +   AV N++F V+ GECFGLLG NGAGK+T FK+L G+    +G                   + +CPQ + L  LLT  E + FY R+RGI+  D+   +D  L    L P+ +     +SGGN+RK+  A+   G    V +DEPT  MD   R  ++  I+ L    + AV+LTSH++ E E LC R+A++  G++    S Q LKS+ G  Y V     P + ++  R+     +N+ +   AR  +  A     ++  R   S+     LS++F +  D+  N  V  +S+S+   + VF      DS   N SNG    Q+     ND              GY++ G+E+T
Sbjct: 1283 SCDHLGECRVFNTSQQSYDWVLNSWGEYSERRYGGY--------GLNGSGATVWYNNKGYHSMMAWLNDLNSELLRTTMNDSES----SILTLNEPWKLGFAELSTSSILRQAGDGSMVFILLIAFGLVVASGSVYLVNERVNGEKLQQRLCGVSAVTYWLVALVWDYLVMVLGLIVCLVVILMFGMPVFVDRQQLVGIIGLSLAFSFACVPSVHVAEKIFSDSSIAIVSIFCANLIVPLVTMGIILILGVVG-DGPAWDDWRHALNQAFLIFPIHALGDGFLELCKNYMVALVFRRYDI---DSYKHPLASDLLGRHFTALLLVGVAALIINVLIEWHLLRRLWQRVERL------------LDCTYRRELDKLGQ------LKLVNIQSIFKSCVDT-----GEA---VRAENLWLAYRRGHYAVRNVNFSVQRGECFGLLGKNGAGKSTIFKLLTGQLQPDVGQIYFE-----------QPGISYCPQSNPLDPLLTTTECIRFYGRLRGIR--DLDQFLDRVLDTYELRPYKDVQVRNLSGGNRRKLTVAVTCCGCTPTVLMDEPTSDMDPVTRDMVYATIEQLLLARR-AVVLTSHSVSEIEHLCQRVAVLRAGQVIASDSPQRLKSEHGGYYAVTCFCGPAQQAILSRS-----LNQRL-PGARDLQHYAHSLRFLVRVRSPGSLGDAPLLSELFAILCDVCVN--VARFSLSRCRFETVFERIL--DSSESNGSNGVHKDQQQQVAKNDLPSKSPAVGGTLETGYIHCGYEET 1996          

HSP 2 Score: 130.954 bits (328), Expect = 8.353e-30
Identity = 117/438 (26.71%), Postives = 198/438 (45.21%), Query Frame = 2
Query: 1763 CFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLK-----GMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKL----------KCCGSSLFLKQNFGD--GYYLFLEKSFEI--QSETCHNNKA 3019
            C+M + FF+++N+ A+   +++FI   PF++ + F  +LS    + V L    +F      +  +E   +G    +L     I +      C +            A  +  +    Y V    Y    +RY     K  DN       R +     +DG        ++G  + N V K   SK  A+ NL+L F ++Q++  LG NGAGK+T I +LTG +  +SG   +              ++G+C Q NIL   LT  +H+  Y  +K          EI+ ++   ++ +   K     S  LSGG +R+L +A+AF+ +  ++ LDEP  GVD  +R+ IW LI + R   R +I  TH MDEA YL D + I+  G++          + C S+  ++    D  G    ++K+ ++  Q++  H+  A
Sbjct:  726 CYMCTNFFNSANIGAVASALLFFISLCPFIIVLMFDAKLSVFESFLVDLSFTTAFAKGWGELIRMELQQEGLTVRHL-----IQVGPARSECAM------------ALLMFLLDLLLYAVIGLAY----QRY-----KKTDNYSFVKVSRSQ-----LDG--------KLGASLVN-VSKLYGSKC-AVSNLSLDFARNQVSCLLGRNGAGKSTLIKLLTGQIRQSSGKVLLAGEH----------QVGVCWQDNILIPTLTAREHLQLYAQIKIPPGGSGGVEEIRSEVAQTLQSLNFGKHESYPSWQLSGGYRRRLCVAIAFIASPSVVILDEPCNGVDAKARKDIWQLIERLRQ-GRAVIFATHFMDEAKYLSDSLVIMRNGRIIAQHSRDSLQRLCTSNYSIRLRCADATGVTFVIQKAQQLLPQTQVTHSGAA 1111          

HSP 3 Score: 125.176 bits (313), Expect = 5.636e-28
Identity = 82/257 (31.91%), Postives = 129/257 (50.19%), Query Frame = 1
Query: 5212 YGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPS------DIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIR 5964
            Y   K+    +D +    G +++NVS     K AV+N+S      +   LLG NGAGK+T  K+L G+   + G  ++ G             +G C Q + L   LT  E L  Y +I+ I P       +I   V  +L++L+   H + P++ +SGG +R++  AIA I  P +V LDEP  G+DA AR+ +W+LI+ L      AVI  +H M+E + L   L IM +G +    S   L+     +Y +++R
Sbjct:  842 YSFVKVSRSQLDGK---LGASLVNVSKLYGSKCAVSNLSLDFARNQVSCLLGRNGAGKSTLIKLLTGQIRQSSGKVLLAG----------EHQVGVCWQDNILIPTLTAREHLQLYAQIK-IPPGGSGGVEEIRSEVAQTLQSLNFGKHESYPSWQLSGGYRRRLCVAIAFIASPSVVILDEPCNGVDAKARKDIWQLIERLRQGR--AVIFATHFMDEAKYLSDSLVIMRNGRIIAQHSRDSLQRLCTSNYSIRLR 1082          

HSP 4 Score: 110.153 bits (274), Expect = 2.010e-23
Identity = 95/345 (27.54%), Postives = 158/345 (45.80%), Query Frame = 2
Query: 2324 ALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLD--FLKIASYGLSDTSLEEVFLKVAD----DPSQISHKRQEKQITSEMLDTLTD--GGNL 3334
            A+ N+N    + +  G LG NGAGK+T   +LTG L P  G  +     I Y           CPQ N L   LT  + I FYG L+G+   ++   L  ++    L        +NLSGG +RKL++A+   G +  + +DEPT+ +DP +R  ++  I +     R ++LT+H + E ++LC R+A++  G++    S   LK   G GYY          + TC    A ++   L   + + +P ++ +         ++   S        L  +L + L    + +A + LS    E VF ++ D    + S   HK Q++Q+    L + +   GG L
Sbjct: 1666 AVRNVNFSVQRGECFGLLGKNGAGKSTIFKLLTGQLQPDVGQIYFEQPGISY-----------CPQSNPLDPLLTTTECIRFYGRLRGI--RDLDQFLDRVLDTYELRPYKDVQVRNLSGGNRRKLTVAVTCCGCTPTVLMDEPTSDMDPVTRDMVYATIEQLLLARRAVVLTSHSVSEIEHLCQRVAVLRAGQVIASDSPQRLKSEHG-GYY----------AVTCFCGPAQQA--ILSRSLNQRLPGARDLQHYAHSLRFLVRVRSPGSLGDAPLLSELFAILCDVCVNVARFSLSRCRFETVFERILDSSESNGSNGVHKDQQQQVAKNDLPSKSPAVGGTL 1984          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Zebrafish
Match: abca1b (ATP-binding cassette, sub-family A (ABC1), member 1B [Source:ZFIN;Acc:ZDB-GENE-030131-9826])

HSP 1 Score: 591.652 bits (1524), Expect = 0.000e+0
Identity = 381/1028 (37.06%), Postives = 572/1028 (55.64%), Query Frame = 2
Query:  677 SIPTCQLAFMNYFTKSNGLSVLYPIIGPLVFGKIYYTPNSAFTQEIIRRANSTFRILDNLRLASVEWRLTFSN-W-LINNSTNMGLLNDARNYCANSRT---LMCQIINNSLSIETIQSTIASLSA--------------------MFVLIENSLNCTQLNKFTPMPSSIDI--DNLSKQSSLGILAGIVFTDDFQYVTPQNATFL----NYQIRMPASRIDSTKNFKVLDRFWTPIPRVNTLTNFNYYTSGFLFLQEIIDQAFIELITDNASVNIGSSMQIMPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTXXXXXXXXXXXXXXXXXGKXXXXXXXXXXXXXXXXXXXXXXCQCFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEK-----------------SFEIQSETCH---------NNKASESGTKLLE------FIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDP---------SQISHKRQEKQI----TSEMLDTLTDGGNLPRPVSVLSFRKKTINTANINGPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGLFSE 3532
            + P C  + M     S    +++  + PL+ GKI YTP+S  TQ+II   N TF+ L  LR     W       W  + NS  M L+   R    N+ T      Q+     S+E + S ++  S                       + I   + C  L+K  P+ +   +  +++S   +    AGIVF D      P N++ L    NY+IRM    ++ T   K+ D +W P PR +   +  Y   GF +LQ++++ + I  +T +     G  +Q MPYPCY++D  +  +S  MP  + +AW  +V  +IK +VYEKE RLKE MR+MG+ N + W SWF S+++ L++   L+ ++LK+G +L +S P ++FL L  + V  I QCF+IS  F  +N+AA  GGI+YF  YLP+++ + +QD +         LL+ V+F     +    E+   G Q++NLF+S + + ++ +  CLI+++ D+  Y ++ WY+E VFPG+YG+P+PWYF FT+ YW  F +N+ N   +     ++ N      E+EP  L++G+ IENLVK +   K  A+D L L F++ QIT FLGHNGAGKTTT+SILTG+  PTSGTA+I+  DIR ++  IR  +G+CPQHN+LF+ LTVE+HI+FY  LKG+++ E+K ++  I+ + GL  K K  +  LSGGM+RKLS+A+AFVG S+++ LDEPTAGVDP++RRGIWDL++KYR+  RTI+L+THHMDEAD L DRIAIIS GKL C GSSLFLK   G GYYL L K                 SF  + +            +++ SE+ T +++       I K +P ++++++   + T VL + S     F  LF  LD  L  L I+SYG+SDT+LEE+FLKVA+D            +  +RQ +          L  LT+  +     S      K  +  + +  K S++       + G SL  QQ   L  KR  + +R+ KG F++
Sbjct:  355 TTPYCN-SMMRNMEASPISRMIWRALKPLLMGKILYTPHSPATQKIIHEVNKTFQELGILRDLGGMWEEARPKVWNFMENSNEMDLM---RTLLLNNLTANFFSAQLAGTQWSVEDVISFLSKHSEDTRPQGTAFTWRDVFNETDQAIMSISRFMECVNLDKLEPVSTEEKLVNESMSLLDNRKFWAGIVFLD-----IPSNSSELPPNVNYKIRMDIDNVERTN--KIKDGYWDPGPRADPFEDLRYIWGGFSYLQDVVEHSIIRAVTGSKE-KTGVYIQQMPYPCYVDDIFLRIMSRSMPLFMTLAWMYSVAIIIKGVVYEKEARLKETMRIMGLDNGILWFSWFISSLIPLLISAGLLVLLLKMGNLLPYSDPGVVFLFLGSFAVVTIMQCFLISTAFARANLAAACGGIIYFTLYLPYVLCVAWQDYVGFAAKVIASLLSPVAFGFGCEYFALFEEQGVGIQWNNLFSSPVEEDDYNLTTCLILMYFDAFLYGVMTWYIETVFPGQYGIPRPWYFPFTKSYW--FGENSTN---NTAIHGKKSNAGAVCIEEEPTHLKLGVYIENLVKVYRHGKKLAVDGLTLGFHEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYIMGKDIRSELSSIRQSLGVCPQHNVLFSMLTVEEHIWFYARLKGLSEEEVKAEMEQILSDTGLPHKRKSRTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYARRGIWDLLLKYRA-GRTILLSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKTQLGTGYYLTLVKKNTEPSLSSCRNSSSTVSFVKKDDNASESSSDAGLGSDQESEAATAIVDVTIISRLILKHVPAARMVEDQGHEITYVLPYESAKNGAFVELFHDLDDRLADLGISSYGVSDTTLEEIFLKVAEDSGVDTEMLSDGTLPVRRQRRHAFGADHQSCLKPLTEDDSFDCNESEGDPESKETDYLSGSDGKGSYQ-------VKGWSLKRQQFVALLWKRLLYARRSRKGFFAQ 1357          

HSP 2 Score: 514.998 bits (1325), Expect = 0.000e+0
Identity = 320/907 (35.28%), Postives = 498/907 (54.91%), Query Frame = 1
Query: 3604 PSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMNTSLYQLENFKCLYPYNTNKWS----EKSPIEISLV--------TPECDCSTTGNQI----CSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMK-----------QYGGLQFILPSFFGQSCQVIGESQIWFD----FRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNIS---GGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESK---HKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLH-PNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSV-KLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAK 6207
            PS+ ++PW+   +        F+ ++   D  + KL      D G  G RCM      + +  C       +WS     +S IEI           +P C+CS  G +     C +   G P    +I + ++ L +L+  NISDYL+K +   I K           +YGG      S   +S QV+  ++   D     R+     +D+ S  +  +FL     F N    K N+ +IW N+KG+ S+ A+ N+ +N +LR+ +   K    +GI   N+PL  T+  L         ++V ++I VIF +SF+PASFV+FLI+ERV  +K  Q++SGV PY+YW++NF WD   Y +   +VIL F+ F  ++Y+ + N+    +LL LY  ++ P MYP SF     STA+VV+++ N+L+G   +I+TF ++L  + +  +   ND LK + LIFP + LGRG+ID+  +    +     G +   +  EWD+ G  + ++ +  V + +I V ++ +     K+LC KL          I +ED DV +ER+RI ++     D+L++  LTK+Y                    + K+K AV+ +  G+  GECFGLLGVNGAGKT+TFKML G+  +T G A I G SI+ +  + H+NMG+CPQFDA++ LLT  E L FY  +RG+  +++    +  ++ L L  + +K     SGGN RK+ TAI+LIG P +VFLDEPT GMD  ARR LW  I ++  E + +V+LTSH+MEECE LC R+AIMV+G  + +GSVQHLK++FG  Y + +R+  P+     D   +   I  E+  S  +KE++  +++Y+  SS+  L+ IF +    +    +++YSVSQ +LD+VF+NFAK
Sbjct: 1382 PSLALNPWMYEEQF------MFFSEDAPYDVSTHKLLRALFDDPG-FGTRCMKGE--SIPDAPCTM--GDEEWSTPEVPESIIEILTTRNWTMNDPSPACECSCNGKKKMLPECPAGAGGLPPPQIKI-SETETLQNLTGRNISDYLVKTYAQIIGKSLKNKIWVNEFRYGGF-----SLGARSTQVLPPAEEIDDAISRVREIFQLGKDSGSAAD--RFLKSLSAFINGLDTKNNV-KIWFNNKGWHSIGAFLNVMNNGILRANLPPGKDPSEFGITAYNHPLNLTKEQLSQVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVNKAKHMQFISGVQPYLYWLANFLWDMCNYVVPATLVILIFVCFQQKAYVSATNLPVLALLLLLYGWSITPLMYPASFLFKIPSTAYVVLTSVNILIGINGSISTFVMEL--FGNHEIGGINDILKNVLLIFPHFCLGRGLIDMVKNQAMADALERFGENRFRSPLEWDMVGKNLFAMAVEGVVFFIITVLIQYRFFFEPKSLCPKLSP--------IGEEDEDVARERQRI-MSGAGQGDILELRQLTKVY--------------------KRKQKPAVDRLCVGIPPGECFGLLGVNGAGKTSTFKMLTGDSVVTKGEAFIAGKSILREIDEVHQNMGYCPQFDAINDLLTGREHLEFYAILRGVPENEVCAVAEWGIRKLGLVKYVDKNAGSYSGGNMRKLSTAISLIGAPPVVFLDEPTTGMDPKARRALWNCIHSVIKEGR-SVVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGYTIILRVAGPD----PDLQPVMKFIESELPGST-LKEKHRNMLQYQLPSSLTSLAHIFSILAKNKEFLRIEDYSVSQTTLDQVFVNFAK 2231          

HSP 3 Score: 181.03 bits (458), Expect = 8.382e-45
Identity = 112/352 (31.82%), Postives = 188/352 (53.41%), Query Frame = 2
Query: 2192 EISDNFRQREENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVA 3247
            E  D  R+R+  ++  G   + D LE+      L K + + + PA+D L +     +  G LG NGAGKT+T  +LTG    T G AFI    I  +++ +   +G CPQ + +   LT  +H+ FY +L+G+ ++E+       ++++GL K +   + + SGG  RKLS A++ +G   ++FLDEPT G+DP +RR +W+ I       R+++LT+H M+E + LC R+AI+  G+ +C GS   LK  FGDGY + L  +                   +++FI+  +P S L ++ +      L  + T+      +F  L  + +FL+I  Y +S T+L++VF+  A
Sbjct: 1900 EDEDVARERQRIMSGAG---QGDILEL----RQLTKVYKRKQKPAVDRLCVGIPPGECFGLLGVNGAGKTSTFKMLTGDSVVTKGEAFIAGKSILREIDEVHQNMGYCPQFDAINDLLTGREHLEFYAILRGVPENEVCAVAEWGIRKLGLVKYVDKNAGSYSGGNMRKLSTAISLIGAPPVVFLDEPTTGMDPKARRALWNCIHSVIKEGRSVVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGYTIILRVA-----------GPDPDLQPVMKFIESELPGSTLKEKHRNMLQYQLPSSLTS---LAHIFSILAKNKEFLRIEDYSVSQTTLDQVFVNFA 2230          

HSP 4 Score: 167.548 bits (423), Expect = 9.440e-41
Identity = 112/364 (30.77%), Postives = 182/364 (50.00%), Query Frame = 1
Query: 5302 RKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKP-TYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYY---VKIRLHP-------------------------NRNSLSDRNEIE--------TIINKEIWS---SARMKEENA----VIIEYRFDSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSV-TRNISNGNALIQK 6258
            +KLAV+ ++ G  EG+    LG NGAGKTTT  +L G    T G A I G  I  +     +++G CPQ + L S+LT EE ++FY R++G+   ++   ++  L +  L PH  K  T  +SGG +RK+  A+A +G  K+V LDEPT G+D  ARR +W L+  L       ++L++H+M+E ++L  R+AI+  G++  +GS   LK++ G  YY   VK    P                         +   L    E E        TII++ I     +ARM E+       ++ Y    +    ++F   +D   +  +  Y VS  +L+E+F+  A++  V T  +S+G   +++
Sbjct:  915 KKLAVDGLTLGFHEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYIMGKDIRSELSSIRQSLGVCPQHNVLFSMLTVEEHIWFYARLKGLSEEEVKAEMEQILSDTGL-PHKRKSRTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYARRGIWDLL--LKYRAGRTILLSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKTQLGTGYYLTLVKKNTEPSLSSCRNSSSTVSFVKKDDNASESSSDAGLGSDQESEAATAIVDVTIISRLILKHVPAARMVEDQGHEITYVLPYESAKNGAFVELFHDLDDRLADLGISSYGVSDTTLEEIFLKVAEDSGVDTEMLSDGTLPVRR 1275          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Zebrafish
Match: abca1b (ATP-binding cassette, sub-family A (ABC1), member 1B [Source:ZFIN;Acc:ZDB-GENE-030131-9826])

HSP 1 Score: 585.104 bits (1507), Expect = 0.000e+0
Identity = 381/1040 (36.63%), Postives = 571/1040 (54.90%), Query Frame = 2
Query:  677 SIPTCQLAFMNYFTKSNGLSVLYPIIGPLVFGKIYYTPNSAFTQEIIRRANSTFRILDNLRLASVEWRLTFSN-W-LINNSTNMGLLNDARNYCANSRT---LMCQIINNSLSIETIQSTIASLSA--------------------MFVLIENSLNCTQLNKFTPMPSSIDI--DNLSKQSSLGILAGIVFTDDFQYVTPQNATFL----NYQIRMPASRIDSTKNFKVLDRFWTPIPRVNTLTNFNYYTSGFLFLQEIIDQAFIELITDNASVNIGSSMQIMPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTXXXXXXXXXXXXXXXXXGKXXXXXXXXXXXXXXXXXXXXXXCQCFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEK-----------------SFEIQSETCHNNKASESG---------------------------TKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDP---------SQISHKRQEKQI----TSEMLDTLTDGGNLPRPVSVLSFRKKTINTANINGPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGLFSE 3532
            + P C  + M     S    +++  + PL+ GKI YTP+S  TQ+II   N TF+ L  LR     W       W  + NS  M L+   R    N+ T      Q+     S+E + S ++  S                       + I   + C  L+K  P+ +   +  +++S   +    AGIVF D      P N++ L    NY+IRM    ++ T   K+ D +W P PR +   +  Y   GF +LQ++++ + I  +T +     G  +Q MPYPCY++D  +  +S  MP  + +AW  +V  +IK +VYEKE RLKE MR+MG+ N + W SWF S+++ L++   L+ ++LK+G +L +S P ++FL L  + V  I QCF+IS  F  +N+AA  GGI+YF  YLP+++ + +QD +         LL+ V+F     +    E+   G Q++NLF+S + + ++ +  CLI+++ D+  Y ++ WY+E VFPG+YG+P+PWYF FT+ YW  F +N+ N   +     ++ N      E+EP  L++G+ IENLVK +   K  A+D L L F++ QIT FLGHNGAGKTTT+SILTG+  PTSGTA+I+  DIR ++  IR  +G+CPQHN+LF+ LTVE+HI+FY  LKG+++ E+K ++  I+ + GL  K K  +  LSGGM+RKLS+A+AFVG S+++ LDEPTAGVDP++RRGIWDL++KYR+  RTI+L+THHMDEAD L DRIAIIS GKL C GSSLFLK   G GYYL L K                 SF ++ +   +  +S++G                           T +   I K +P ++++++   + T VL + S     F  LF  LD  L  L I+SYG+SDT+LEE+FLKVA+D            +  +RQ +          L  LT+  +     S      K  +  + +  K S++       + G SL  QQ   L  KR  + +R+ KG F++
Sbjct:  355 TTPYCN-SMMRNMEASPISRMIWRALKPLLMGKILYTPHSPATQKIIHEVNKTFQELGILRDLGGMWEEARPKVWNFMENSNEMDLM---RTLLLNNLTANFFSAQLAGTQWSVEDVISFLSKHSEDTRPQGTAFTWRDVFNETDQAIMSISRFMECVNLDKLEPVSTEEKLVNESMSLLDNRKFWAGIVFLD-----IPSNSSELPPNVNYKIRMDIDNVERTN--KIKDGYWDPGPRADPFEDLRYIWGGFSYLQDVVEHSIIRAVTGSKE-KTGVYIQQMPYPCYVDDIFLRIMSRSMPLFMTLAWMYSVAIIIKGVVYEKEARLKETMRIMGLDNGILWFSWFISSLIPLLISAGLLVLLLKMGNLLPYSDPGVVFLFLGSFAVVTIMQCFLISTAFARANLAAACGGIIYFTLYLPYVLCVAWQDYVGFAAKVIASLLSPVAFGFGCEYFALFEEQGVGIQWNNLFSSPVEEDDYNLTTCLILMYFDAFLYGVMTWYIETVFPGQYGIPRPWYFPFTKSYW--FGENSTN---NTAIHGKKSNAGAVCIEEEPTHLKLGVYIENLVKVYRHGKKLAVDGLTLGFHEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYIMGKDIRSELSSIRQSLGVCPQHNVLFSMLTVEEHIWFYARLKGLSEEEVKAEMEQILSDTGLPHKRKSRTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYARRGIWDLLLKYRA-GRTILLSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKTQLGTGYYLTLVKKNTEPSLSSCRNSSSTVSF-VKKDDNASESSSDAGLGSDQESEAATAIGTSWPESPVVPVDVTIISRLILKHVPAARMVEDQGHEITYVLPYESAKNGAFVELFHDLDDRLADLGISSYGVSDTTLEEIFLKVAEDSGVDTEMLSDGTLPVRRQRRHAFGADHQSCLKPLTEDDSFDCNESEGDPESKETDYLSGSDGKGSYQ-------VKGWSLKRQQFVALLWKRLLYARRSRKGFFAQ 1368          

HSP 2 Score: 514.998 bits (1325), Expect = 0.000e+0
Identity = 320/907 (35.28%), Postives = 498/907 (54.91%), Query Frame = 1
Query: 3604 PSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMNTSLYQLENFKCLYPYNTNKWS----EKSPIEISLV--------TPECDCSTTGNQI----CSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMK-----------QYGGLQFILPSFFGQSCQVIGESQIWFD----FRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNIS---GGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESK---HKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLH-PNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSV-KLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAK 6207
            PS+ ++PW+   +        F+ ++   D  + KL      D G  G RCM      + +  C       +WS     +S IEI           +P C+CS  G +     C +   G P    +I + ++ L +L+  NISDYL+K +   I K           +YGG      S   +S QV+  ++   D     R+     +D+ S  +  +FL     F N    K N+ +IW N+KG+ S+ A+ N+ +N +LR+ +   K    +GI   N+PL  T+  L         ++V ++I VIF +SF+PASFV+FLI+ERV  +K  Q++SGV PY+YW++NF WD   Y +   +VIL F+ F  ++Y+ + N+    +LL LY  ++ P MYP SF     STA+VV+++ N+L+G   +I+TF ++L  + +  +   ND LK + LIFP + LGRG+ID+  +    +     G +   +  EWD+ G  + ++ +  V + +I V ++ +     K+LC KL          I +ED DV +ER+RI ++     D+L++  LTK+Y                    + K+K AV+ +  G+  GECFGLLGVNGAGKT+TFKML G+  +T G A I G SI+ +  + H+NMG+CPQFDA++ LLT  E L FY  +RG+  +++    +  ++ L L  + +K     SGGN RK+ TAI+LIG P +VFLDEPT GMD  ARR LW  I ++  E + +V+LTSH+MEECE LC R+AIMV+G  + +GSVQHLK++FG  Y + +R+  P+     D   +   I  E+  S  +KE++  +++Y+  SS+  L+ IF +    +    +++YSVSQ +LD+VF+NFAK
Sbjct: 1393 PSLALNPWMYEEQF------MFFSEDAPYDVSTHKLLRALFDDPG-FGTRCMKGE--SIPDAPCTM--GDEEWSTPEVPESIIEILTTRNWTMNDPSPACECSCNGKKKMLPECPAGAGGLPPPQIKI-SETETLQNLTGRNISDYLVKTYAQIIGKSLKNKIWVNEFRYGGF-----SLGARSTQVLPPAEEIDDAISRVREIFQLGKDSGSAAD--RFLKSLSAFINGLDTKNNV-KIWFNNKGWHSIGAFLNVMNNGILRANLPPGKDPSEFGITAYNHPLNLTKEQLSQVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVNKAKHMQFISGVQPYLYWLANFLWDMCNYVVPATLVILIFVCFQQKAYVSATNLPVLALLLLLYGWSITPLMYPASFLFKIPSTAYVVLTSVNILIGINGSISTFVMEL--FGNHEIGGINDILKNVLLIFPHFCLGRGLIDMVKNQAMADALERFGENRFRSPLEWDMVGKNLFAMAVEGVVFFIITVLIQYRFFFEPKSLCPKLSP--------IGEEDEDVARERQRI-MSGAGQGDILELRQLTKVY--------------------KRKQKPAVDRLCVGIPPGECFGLLGVNGAGKTSTFKMLTGDSVVTKGEAFIAGKSILREIDEVHQNMGYCPQFDAINDLLTGREHLEFYAILRGVPENEVCAVAEWGIRKLGLVKYVDKNAGSYSGGNMRKLSTAISLIGAPPVVFLDEPTTGMDPKARRALWNCIHSVIKEGR-SVVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGYTIILRVAGPD----PDLQPVMKFIESELPGST-LKEKHRNMLQYQLPSSLTSLAHIFSILAKNKEFLRIEDYSVSQTTLDQVFVNFAK 2242          

HSP 3 Score: 180.644 bits (457), Expect = 9.618e-45
Identity = 112/352 (31.82%), Postives = 188/352 (53.41%), Query Frame = 2
Query: 2192 EISDNFRQREENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVA 3247
            E  D  R+R+  ++  G   + D LE+      L K + + + PA+D L +     +  G LG NGAGKT+T  +LTG    T G AFI    I  +++ +   +G CPQ + +   LT  +H+ FY +L+G+ ++E+       ++++GL K +   + + SGG  RKLS A++ +G   ++FLDEPT G+DP +RR +W+ I       R+++LT+H M+E + LC R+AI+  G+ +C GS   LK  FGDGY + L  +                   +++FI+  +P S L ++ +      L  + T+      +F  L  + +FL+I  Y +S T+L++VF+  A
Sbjct: 1911 EDEDVARERQRIMSGAG---QGDILEL----RQLTKVYKRKQKPAVDRLCVGIPPGECFGLLGVNGAGKTSTFKMLTGDSVVTKGEAFIAGKSILREIDEVHQNMGYCPQFDAINDLLTGREHLEFYAILRGVPENEVCAVAEWGIRKLGLVKYVDKNAGSYSGGNMRKLSTAISLIGAPPVVFLDEPTTGMDPKARRALWNCIHSVIKEGRSVVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGYTIILRVA-----------GPDPDLQPVMKFIESELPGSTLKEKHRNMLQYQLPSSLTS---LAHIFSILAKNKEFLRIEDYSVSQTTLDQVFVNFA 2241          

HSP 4 Score: 163.31 bits (412), Expect = 2.014e-39
Identity = 112/375 (29.87%), Postives = 182/375 (48.53%), Query Frame = 1
Query: 5302 RKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKP-TYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYY---VKIRLHP-------------------------NRNSLSDRNEIE-------------------TIINKEIWS---SARMKEENA----VIIEYRFDSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSV-TRNISNGNALIQK 6258
            +KLAV+ ++ G  EG+    LG NGAGKTTT  +L G    T G A I G  I  +     +++G CPQ + L S+LT EE ++FY R++G+   ++   ++  L +  L PH  K  T  +SGG +RK+  A+A +G  K+V LDEPT G+D  ARR +W L+  L       ++L++H+M+E ++L  R+AI+  G++  +GS   LK++ G  YY   VK    P                         +   L    E E                   TII++ I     +ARM E+       ++ Y    +    ++F   +D   +  +  Y VS  +L+E+F+  A++  V T  +S+G   +++
Sbjct:  915 KKLAVDGLTLGFHEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYIMGKDIRSELSSIRQSLGVCPQHNVLFSMLTVEEHIWFYARLKGLSEEEVKAEMEQILSDTGL-PHKRKSRTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYARRGIWDLL--LKYRAGRTILLSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKTQLGTGYYLTLVKKNTEPSLSSCRNSSSTVSFVKKDDNASESSSDAGLGSDQESEAATAIGTSWPESPVVPVDVTIISRLILKHVPAARMVEDQGHEITYVLPYESAKNGAFVELFHDLDDRLADLGISSYGVSDTTLEEIFLKVAEDSGVDTEMLSDGTLPVRR 1286          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Zebrafish
Match: abca4a (ATP-binding cassette, sub-family A (ABC1), member 4a [Source:ZFIN;Acc:ZDB-GENE-050517-3])

HSP 1 Score: 532.717 bits (1371), Expect = 0.000e+0
Identity = 339/917 (36.97%), Postives = 495/917 (53.98%), Query Frame = 1
Query: 3604 PSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMNTSLYQLENFKC----------------LYPYNTNKWSEKSPIEISLVTPECDCSTTGNQICSSPL----SGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIM-----------KQYGGLQFILPSFFGQSCQVIGESQIWFDFRQSINSSRD-----NNSNPEQVKF-LNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFS------YLRYNISGGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNR-NSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLSDIFRVFEDLRTNEM--VKEYSVSQMSLDEVFINFAKNDS 6216
            PS+T+SPW+   +       TF+  E           E   +  G  G RCM      LE + C                +   + ++W++ SP      +P C CST  N++   P+    +GG     RI ++ D L DL+  NISDYL+K +   I            ++YGG+        G    V+       D +   N++       N +     K  L+ F  F      + N+ ++W N+KG+ +M A+ N+ +N +LR+ +     L  YGI   N+PL  T+  L         ++  +AI VIF +SF+PA FV++LI+ERVT +K  Q+VSGV+P VYW +NFFWD I YS+S  +V+  F+AF+ + Y    N+ A I LL LY  +V P MYP S+  +  STA+V +S  NL +G  ++  TF LDL+   +A L   N  LKK  L+FP + LGRG+ID++ +      Y R+   G D + + F WD  G  +  + +   G+   I+ +  +++  L   + D K  P   ITDED+DV KERERI       ND+LQ+  L+K Y  +  FR                   AV+ I  GV  GECFGLLGVNGAGKTTTFKML G+ ++T G A + GYSI+ + L  H+NMG+CPQFDA+  LLT  E L+ Y R+RG+  S+I    +  ++ L L+ +        SGGNKRK+ TAIA+IG P ++ LDEPT GMD  +RRFLW  I ++    + AV+LTSH+MEECE LC RLAIMV+G  K +G++QHLK KFG  Y V +++   +  ++ D N  E  + +  +     +E++   ++Y   SS  L+ IF+V   L   EM  +++YSVSQ +LD+VF+NFAK+ S
Sbjct: 1396 PSLTLSPWMYGRQF------TFFSNEQMQSPDMRYFGEVLLNRPG-FGTRCMVDE--PLEEYPCNNITTEWEMPLVNPMLIEMLSNSEWTDISP------SPSCQCSTP-NKLTMLPVCPEGAGGLPPPQRIQSTGDMLMDLTGRNISDYLVKTYPNLIRTSLKSKYWVNEQRYGGIS------VGGRLPVLN-----LDPKSIQNAAAQIGRLLNVTGGRYSKLALDEFATFLRYMETENNV-KVWFNNKGWHAMVAFMNVANNAILRANLPPGVDLNEYGITAINHPLNLTKEQLSEVTVLTTSVDAVVAINVIFAMSFVPAGFVLYLIQERVTQAKHLQFVSGVSPLVYWTANFFWDMINYSVSAAMVVGIFIAFDKKCYTSPGNLQALIALLMLYGWSVTPMMYPMSYIFNVPSTAYVSLSCINLFIGINSSAITFILDLFDSTEA-LYKCNQVLKKALLVFPHFCLGRGLIDMAMNQAVMDVYARF---GEDFSLDPFSWDFVGENLTFMAV--EGFVYFILNILIQYRFFLDHWMSDFKKPP---ITDEDVDVAKERERI-YKGGSSNDILQIKDLSKTYTGT--FRP------------------AVDRICVGVSPGECFGLLGVNGAGKTTTFKMLTGDIDVTSGEADVAGYSILTNILDVHQNMGYCPQFDAIDDLLTGREHLHLYARLRGVPESEISRVAEWGIQKLGLSEYAGCTAGTYSGGNKRKLSTAIAMIGCPALLLLDEPTTGMDPHSRRFLWNSIMSVIQGGR-AVVLTSHSMEECEALCTRLAIMVNGTFKCLGTIQHLKYKFGDGYVVTMKIRAAKVGAVPDLNPAEAFM-ESTFPGCIQREKHYNTLQYEIASS-SLAKIFQVV--LANKEMLNIEDYSVSQTTLDQVFVNFAKHQS 2249          

HSP 2 Score: 529.635 bits (1363), Expect = 0.000e+0
Identity = 365/1023 (35.68%), Postives = 553/1023 (54.06%), Query Frame = 2
Query:  737 VLYPIIGPLVFGKIYYTPNSAFTQEIIRRANSTFRILDNLRLASVEWRLTFSN-WL--------------INNSTNMGLLNDARNYCANSRTLMCQIINNSLSIETIQS-------TIASLSAMFV-LIENSLNCTQLNKFTPMPSSIDIDNLSKQSSLGIL------AGIVFTDDFQYVTPQNATFLNYQIRMPASRIDSTKNFKVLDRFWTPIPRVNTLTNFNYYTSGFLFLQEIIDQAFIELITDNASVNIGSSMQIMPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTXXXXXXXXXXXXXXXXXGKXXXXXXXXXXXXXXXXXXXXXXCQCFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFP--GKYGVPKPWYFLF-------TRRYWIP--------FSKNNDNIEI--SDNFRQR--EENI----TIDG-----FEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFL-----EKSFEIQSET--------------CHNNKASESGT-------------KLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANINGPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGLFSE 3532
            +++  + P + GKI Y P+S   ++II+ AN+TF  L+ LR     W       W               I N T M  +N      A +   +   + +    +  Q         I +L+   + LI     C  L+KF    SSI  ++     +L +L      AG+VF D + + T +    +  +IRM    ++ T   K+ DR+W P PR + + +  Y   GF +LQ++I+   I+  T      +G  +Q MPYPCY++D  +  L+   P  +V+AW  +V+  +KSIV EKE RLKE ++ MG++N V W +WF  T  ++     L+T+I+  GK+L +S+PII+FL L  +  + I QCF++SVFF+ +N+AA   GI+YF  YLP +V   +QD ++ +M     L++QV+F     ++   E+   G Q+ N+  S +    F   + +IM+ +D+V Y ++AWY+++VFP  GK  V KP +           + +  P          K+ D  E    +  ++R  EE I    + D      FE EP  L  G+ +ENL K F  S  PA+D L+L FY+ QIT FLGHNGAGKTTT+S+LTG+  PTSGTA+I   DIR DM+ IR  +G+CPQHNI+F ++TV +HI FY LLKG    E + ++ ++++++GL  K    ++NLSGGM+RKLS+AMAFVG ++++FLDEPT+GVDP+SRR IWDL++KYR   RT+IL+THHMDEAD L DR+AIISQG+L CCGS LFLK   G G+YL L     E+   ++ E               C   KAS++                +   +   +P ++LI+    + T +L   +     + SLF +L+ +L  + ++S+G+SDTSLEEVFLKV  D  + +H           ++T +D           S      N+AN+    +S E   +   + G  L+ +Q   L IKRFHHT R+ K   ++
Sbjct:  385 IVWRSVKPFLMGKILYAPDSPAARQIIKNANTTFEELERLRNMGRAWEEVGPQIWSFFQDSVQINMLRDSIRNPTVMDHINKGLRNAAFTGQHILNFLYSGPEEDREQDMPNFDWRNIFNLTDQVIRLINRYGECLVLDKF----SSISDEDQLTHRALNLLEEGKFWAGLVFVDMYSWTT-KVPPHVKVKIRMDIDVVERTN--KIKDRYWDPGPRADPMDDLRYIWGGFAYLQDMIEHGIIKTHT-GKEWPLGVYLQQMPYPCYVDDLFMLTLNRCFPIFMVLAWVYSVSMTVKSIVLEKEMRLKETLKAMGVTNRVLWCTWFIDTFFMMASSTALLTLIIMGGKVLNYSNPIILFLFLLTFTTATIMQCFLMSVFFNKANLAAACSGIIYFTLYLPHVVCFAWQDRITKDMKIMASLMSQVAFGFGTEYLSRYEEQGLGLQWDNIQTSLLEGDEFSFLNSIIMMAVDTVLYGVLAWYLDSVFPVPGKPTVEKPAFDNLVNNTDDQAKNHTAPEKPPEPPGSCKHGDIREKLEREKLQKRIVEEEINRSMSTDSSGKVFFEPEPSGLVAGVCVENLYKVFSGSSRPAVDGLSLTFYEGQITAFLGHNGAGKTTTMSVLTGMFPPTSGTAYIYGKDIRTDMDAIRKSLGMCPQHNIIFHHMTVAEHILFYSLLKGRPLPEAQLEVENMLEDLGLPHKRNEEAQNLSGGMQRKLSVAMAFVGGAKVVFLDEPTSGVDPYSRRSIWDLLLKYR---RTLILSTHHMDEADLLSDRVAIISQGRLYCCGSPLFLKNCLGAGFYLTLVRRIKEQPAPVRKEGQCDCTDDCSCKCSLCTKFKASDTEKPRVSERQMEGNIESITALVHHHVPEARLIEVIGQELTFLLPSRAFKHRSYASLFRELEETLADMGLSSFGVSDTSLEEVFLKVTAD-GEAAH-----------INTASDTDR--------SHANGQSNSANV----ISKEGRGS-QQVKGFFLVVKQFFALLIKRFHHTTRSGKDFLAQ 1371          

HSP 3 Score: 164.081 bits (414), Expect = 1.183e-39
Identity = 108/342 (31.58%), Postives = 180/342 (52.63%), Query Frame = 2
Query: 2282 IENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTS-----LFEQLDSSLDFLKIASYGLSDTSLEEVFLKVA-----DDPSQISHKR 3277
            I++L K +  +  PA+D + +     +  G LG NGAGKTTT  +LTG +  TSG A +    I  ++  +   +G CPQ + +   LT  +H++ Y  L+G+ +SEI       ++++GLS+   C +   SGG KRKLS A+A +G   ++ LDEPT G+DP SRR +W+ I+      R ++LT+H M+E + LC R+AI+  G  KC G+   LK  FGDGY + ++             +A++ G      +  + P    ++ T         H +T + +  S     +F+ + ++ + L I  Y +S T+L++VF+  A     +D + + H R
Sbjct: 1936 IKDLSKTYTGTFRPAVDRICVGVSPGECFGLLGVNGAGKTTTFKMLTGDIDVTSGEADVAGYSILTNILDVHQNMGYCPQFDAIDDLLTGREHLHLYARLRGVPESEISRVAEWGIQKLGLSEYAGCTAGTYSGGNKRKLSTAIAMIGCPALLLLDEPTTGMDPHSRRFLWNSIMSVIQGGRAVVLTSHSMEECEALCTRLAIMVNGTFKCLGTIQHLKYKFGDGYVVTMKI------------RAAKVGA-----VPDLNPAEAFMESTFPGCIQREKHYNTLQYEIASSSLAKIFQVVLANKEMLNIEDYSVSQTTLDQVFVNFAKHQSGEDDAVVLHPR 2260          

HSP 4 Score: 140.969 bits (354), Expect = 1.173e-32
Identity = 77/219 (35.16%), Postives = 124/219 (56.62%), Query Frame = 1
Query: 5305 KLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKI 5961
            + AV+ +S    EG+    LG NGAGKTTT  +L G    T G A I G  I  D     K++G CPQ + +   +T  E + FY+ ++G    +  + V+  L++L L    N+    +SGG +RK+  A+A +G  K+VFLDEPT G+D  +RR +W L+     +++  +IL++H+M+E ++L  R+AI+  G +   GS   LK+  G  +Y+ +
Sbjct:  963 RPAVDGLSLTFYEGQITAFLGHNGAGKTTTMSVLTGMFPPTSGTAYIYGKDIRTDMDAIRKSLGMCPQHNIIFHHMTVAEHILFYSLLKGRPLPEAQLEVENMLEDLGLPHKRNEEAQNLSGGMQRKLSVAMAFVGGAKVVFLDEPTSGVDPYSRRSIWDLLL----KYRRTLILSTHHMDEADLLSDRVAIISQGRLYCCGSPLFLKNCLGAGFYLTL 1177          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Zebrafish
Match: abca4b (ATP-binding cassette, sub-family A (ABC1), member 4b [Source:ZFIN;Acc:ZDB-GENE-050517-4])

HSP 1 Score: 518.464 bits (1334), Expect = 0.000e+0
Identity = 330/921 (35.83%), Postives = 500/921 (54.29%), Query Frame = 1
Query: 3604 PSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMNTSLYQLEN-FKCL-----------YPYNTN-----KWSEKSPIEISLVTPECDCST----TGNQICSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIM-----------KQYGGLQFILPSFFGQSCQV--IGESQIWFDFRQ-----SINSSRDNNSNPEQVK-FLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFS------YLRYNISGGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLS-DRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLSDIFRVFEDLRTNEM---VKEYSVSQMSLDEVFINFAKNDS 6216
            P +T++PW+  P+       TF   E  S        +    D G  G RCM      LEN F CL            P  +N     +W  ++P      +P C+CST    T   +C +  +GG     R   + D L D+++ NISDYL+K +   I            ++YGG+        G    +  +   +I   F Q     +I   R + S  ++++ FL+Y +  +N         ++W N+KG+ +M ++ N+ +N +LR+ +       +YGI   N+PL  T+  L         ++  +AI VIF +SFIPASFV++LI+ERVT +K  Q+VSGV+P VYW +NFFWD + YS+S  +V+  F+ F+ + Y    N+ A I LL LY  +V P MYP S+  +  STA+V +S  NL +G  ++  TF L+L++ ++ SL   N+ LKK+ L+FP + LGRG+ID++ +      Y R+   G + + + F W+  G  +  + +   G+   I  +  ++K  L   + D  +    + TDED DV +ERERI    +  ND+L +  L+K Y                      +++ AV+ I  GV  GECFGLLGVNGAGKTTTFKML G+ ++T G   + GYSI+ + L  H+NMG+CPQFDA+  LLT  E LY Y R+RGI  S+I    +  ++ L L+ +        SGGNKRK+ TAIA+IG P +V LDEPT GMD  +RRFLW  I ++  + + AV+LTSH+MEECE LC RLAIMV+G  K +G++QHLK KFG  Y V +++   +  LS D    E+ ++   +     +E++   ++Y     +  + + RVF+ + TN+    +++YSVSQ +LD+VF+NFAK  S
Sbjct: 1441 PCLTLTPWMYGPQF------TFISNEQPSHPKMKHFIQTLLKDPGM-GTRCMANQ--PLENIFTCLNSSSDWEVPPVSPEVSNILSSPEWDSRNP------SPSCECSTDLKLTMLPMCPAG-AGGLPPRQRKEPTGDILLDMTNRNISDYLVKTYTKLIKTSLKSKYWVNEQRYGGISV------GGRLPILDVDPEEIQNIFSQLGRMMNIRGGRYSKSAMDELETFLHYMESEYNV--------KVWYNNKGWHAMASFLNVANNAILRAYLPPHANPSDYGITAINHPLNLTKEQLSEVTVLTTSVDAVVAICVIFAMSFIPASFVLYLIQERVTKAKHLQFVSGVSPLVYWFANFFWDMLNYSVSTAMVVAIFVGFDKKCYTSPTNLPALIALLCLYGWSVTPMMYPLSYMFNVPSTAYVSLSCINLFIGINSSAITFILELFE-NNRSLLMFNEVLKKVLLVFPHFCLGRGLIDMAMNQAVTDVYARF---GEEFSMDPFRWNFVGKNLFCMAV--EGFVYFIFNLLIQYKFFLHHWISDYGMS---LGTDEDDDVAQERERIYKGGNK-NDILLIRDLSKTY--------------------RRRKRPAVDKICVGVPAGECFGLLGVNGAGKTTTFKMLTGDTDVTSGELSVAGYSILSNILDVHQNMGYCPQFDAIDELLTGREHLYLYARLRGIPESEISRVAEWGIQKLGLSEYAGNCAGTYSGGNKRKLSTAIAMIGCPPLVLLDEPTTGMDPHSRRFLWTAILSIIRDGR-AVVLTSHSMEECEALCTRLAIMVNGTFKCLGTIQHLKYKFGGGYVVTMKIKAAKPGLSPDLVPAESFMDSS-FPGCIQREKHYNTLQYE----IAAASLARVFQLVLTNKERLNIEDYSVSQTTLDQVFVNFAKQQS 2295          

HSP 2 Score: 351.288 bits (900), Expect = 0.000e+0
Identity = 201/461 (43.60%), Postives = 282/461 (61.17%), Query Frame = 2
Query: 2243 FEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSE-------------TCHNNKASESGTKLLE--------------FIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANINGPKVSFEFENNLVLLS----GLSLIFQQISGLFIKRFHHTKRNIKGLFSE 3532
            FE EP+ L IG+ +++LVK + +   PA+D LN+ FY+SQIT FLGHNGAGKTTT+SILTG+  PTSGTA+I   DIR +M+ IR  +G+CPQHNILF +LTVE+HI FY L+KG    E + ++ ++++++GL  K    ++NLSGGM+RKLS+AMAFVG SR++ LDEPT+GVDP+SRR IWDL++KYR+  RT+IL+THHMDEAD L DR+AIIS+GKL C GS LFLK  FG G+YL L +  + Q +             TC      +  ++ L+               I   +P +KLI+    + T +L +       + SLF +L+ +L  + ++S+G+SDTSLEE+FLKV  D    +     +Q    ML    +G           F K T    + NG   S E +++    S    G SL+ +Q   L +KRFHH  R+ K   ++
Sbjct:  969 FEPEPESLLIGVSVQDLVKMYNRYSRPAVDCLNMNFYESQITSFLGHNGAGKTTTLSILTGLFPPTSGTAYIYGRDIRTEMDAIRQSLGMCPQHNILFKHLTVEEHILFYSLMKGREHKEAEQEVENMLEDLGLPHKRDEEAQNLSGGMQRKLSVAMAFVGGSRVVILDEPTSGVDPYSRRSIWDLLLKYRT-GRTVILSTHHMDEADLLSDRVAIISKGKLHCSGSPLFLKNCFGVGFYLTLVRRMKDQRKKENECDCASECSCTCSTCTRYKEESQALQPERVLDGNVESITTLIHHHVPEAKLIEMIGQEMTYLLPNKGFKYRAYASLFRELEETLGDMGLSSFGISDTSLEEIFLKVTADGEAANSSVTPEQW---MLQQRKNGNG---------FMKDTGLAEDANGVGASLESDSSEGRASRQVKGFSLVLKQFHALLVKRFHHATRSHKDFLAQ 1416          

HSP 3 Score: 245.743 bits (626), Expect = 1.811e-64
Identity = 174/567 (30.69%), Postives = 297/567 (52.38%), Query Frame = 2
Query:  656 SLINSTKSIPTCQLAFMNYFTKSNGLSVLYPIIGPLVFGKIYYTPNSAFTQEIIRRANSTFRILDNLRLASVEWR-LTFSNW-LINNSTNMGLLNDA--------------RNYCANSRTLMCQIINNSLSIETIQSTIASLSAMFVLIENSL-------NCTQLNKFTPMPSSIDIDNLSKQSSLGIL------AGIVFTDDFQYVTPQNATFLNYQIRMPASRIDSTKNFKVLDRFWTPIPRVNTLTNFNYYTSGFLFLQEIIDQAFIELITDNASVNIGSSMQIMPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTXXXXXXXXXXXXXXXXXGKXXXXXXXXXXXXXXXXXXXXXXCQCFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWI---PFSKNNDNIEIS--DNFRQREENITIDGFEKE 2254
            S I    + P C  A M     +    +++  + PLV GKI YTP+S   ++II+ AN+TF  L+ L+     W  L    W    NS  M ++ D               R    +++ ++  + N       +  T    S +F L + ++        C  L+KF      +D +NL    +L +L      AG+VF D + + T +    + ++IRM    ++ T   K+ DR+W P PR + + +  Y   GF +LQ++I+   ++L T +    +G  +Q MPYPCY++D  +  L+   P  +V+AW  +V+ ++KSIV EKE RLKE ++ MG+SN V W +WF  + +++     L+T I+  GK+L +S+PII+FL L  + V+ I QCF++SVFF+ +N+AA   GI+YF  YLP +    +QD ++ +M   V LL+ V+F     ++   E+   G Q+ N+  S +    +     + M+ +D+V Y ++AWY++ VFPG+YG+ +P+YF     YW+   P S+ ++ +     +N  +++E++   G   E
Sbjct:  359 SYIYDKTATPFCN-ALMQNLESNPITKIVWNSVKPLVMGKILYTPDSPAVRKIIKSANTTFEELERLQKIGKVWEELGPQLWDFFQNSIQMNMIRDTLRNPTVMDFLDRRLRETEFSTKDILNFLHNGPEGERFMNMTSFDWSDVFRLADQAIRMFNRYSECISLDKFV---GHMD-ENLMTHQALHLLGENKFWAGLVFMDMYPW-TIELPRHVKFKIRMDIDAVERTN--KIKDRYWDPGPRADPVEDHRYIWGGFAYLQDLIEHGILKLHTGH-DWPLGVYLQQMPYPCYVDDMFMLTLNRCFPIFMVLAWIYSVSMVVKSIVLEKEMRLKETLKAMGVSNGVIWYTWFIDSFIMMTASTALLTGIVMAGKVLNYSNPIILFLFLLTFTVATIMQCFLMSVFFNKANLAAACSGIIYFTLYLPHIFCFAWQDRITKDMKLAVSLLSPVAFGFGTEYLSRYEEQGLGLQWDNIGTSPLEGDEYSFFTSIRMMLLDAVLYGVLAWYLDNVFPGQYGIGRPFYFPLQSSYWLKPSPPSETSNAVPEKPLENHVEKQEDVEYGGLSPE 916          

HSP 4 Score: 165.622 bits (418), Expect = 4.461e-40
Identity = 119/391 (30.43%), Postives = 194/391 (49.62%), Query Frame = 2
Query: 2138 FLFTRRYWIPFSKNNDNIEISDNFRQREENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTS-----LFEQLDSSLDFLKIASYGLSDTSLEEVFLKVA-----DDPSQISHKRQ 3280
            + F   +WI     +   +  D+  Q  E I   G     +D+   +LI +L K + + K PA+D + +     +  G LG NGAGKTTT  +LTG    TSG   +    I  ++  +   +G CPQ + +   LT  +H+Y Y  L+G+ +SEI       ++++GLS+     +   SGG KRKLS A+A +G   ++ LDEPT G+DP SRR +W  I+      R ++LT+H M+E + LC R+AI+  G  KC G+   LK  FG GY + ++             KA++ G         ++P    +D +         H +T + +  +     +F+ + ++ + L I  Y +S T+L++VF+  A     +D +  SH RQ
Sbjct: 1940 YKFFLHHWISDYGMSLGTDEDDDVAQERERIYKGG---NKNDI---LLIRDLSKTYRRRKRPAVDKICVGVPAGECFGLLGVNGAGKTTTFKMLTGDTDVTSGELSVAGYSILSNILDVHQNMGYCPQFDAIDELLTGREHLYLYARLRGIPESEISRVAEWGIQKLGLSEYAGNCAGTYSGGNKRKLSTAIAMIGCPPLVLLDEPTTGMDPHSRRFLWTAILSIIRDGRAVVLTSHSMEECEALCTRLAIMVNGTFKCLGTIQHLKYKFGGGYVVTMKI------------KAAKPGLS-----PDLVPAESFMDSSFPGCIQREKHYNTLQYEIAAASLARVFQLVLTNKERLNIEDYSVSQTTLDQVFVNFAKQQSGEDDTAPSHLRQ 2307          

HSP 5 Score: 138.272 bits (347), Expect = 7.730e-32
Identity = 106/391 (27.11%), Postives = 179/391 (45.78%), Query Frame = 1
Query: 5275 IINVSSEDKRKL-------AVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVK-IRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYR-FDSSVK------------------------------------LSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINF-----AKNDSVT------RNISNGNALIQKPNFNNDG 6279
            +I VS +D  K+       AV+ ++    E +    LG NGAGKTTT  +L G    T G A I G  I  +     +++G CPQ + L   LT EE + FY+ ++G +  +    V+  L++L L    ++    +SGG +RK+  A+A +G  ++V LDEPT G+D  +RR +W L+  L       VIL++H+M+E ++L  R+AI+  G++   GS   LK+ FG  +Y+  +R   ++    +  +  +  +    +  R KEE+  +   R  D +V+                                     + +FR  E+   +  +  + +S  SL+E+F+       A N SVT      +   NGN  ++      D 
Sbjct:  977 LIGVSVQDLVKMYNRYSRPAVDCLNMNFYESQITSFLGHNGAGKTTTLSILTGLFPPTSGTAYIYGRDIRTEMDAIRQSLGMCPQHNILFKHLTVEEHILFYSLMKGREHKEAEQEVENMLEDLGLPHKRDEEAQNLSGGMQRKLSVAMAFVGGSRVVILDEPTSGVDPYSRRSIWDLL--LKYRTGRTVILSTHHMDEADLLSDRVAIISKGKLHCSGSPLFLKNCFGVGFYLTLVRRMKDQRKKENECDCASECSCTCSTCTRYKEESQALQPERVLDGNVESITTLIHHHVPEAKLIEMIGQEMTYLLPNKGFKYRAYASLFRELEETLGDMGLSSFGISDTSLEEIFLKVTADGEAANSSVTPEQWMLQQRKNGNGFMKDTGLAEDA 1365          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Zebrafish
Match: abca4b (ATP-binding cassette, sub-family A (ABC1), member 4b [Source:ZFIN;Acc:ZDB-GENE-050517-4])

HSP 1 Score: 518.079 bits (1333), Expect = 0.000e+0
Identity = 325/903 (35.99%), Postives = 488/903 (54.04%), Query Frame = 1
Query: 3604 PSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMNTSLYQLEN-FKCL-----------YPYNTN-----KWSEKSPIEISLVTPECDCST----TGNQICSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMKQYGGLQFILPSFFGQSCQVIGESQIWFDFRQSINSSRDNNSNPEQVK-FLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFS------YLRYNISGGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLS-DRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLSDIFRVFEDLRTNEM---VKEYSVSQMSLDEVFINFAKNDS 6216
            P +T++PW+  P+       TF   E  S        +    D G  G RCM      LEN F CL            P  +N     +W  ++P      +P C+CST    T   +C +  +GG     R   + D L D+++ NISDYL+K +   I        ++    +G    V G   I              + +PE+++   +      N  G    L  +W N+KG+ +M ++ N+ +N +LR+ +       +YGI   N+PL  T+  L         ++  +AI VIF +SFIPASFV++LI+ERVT +K  Q+VSGV+P VYW +NFFWD + YS+S  +V+  F+ F+ + Y    N+ A I LL LY  +V P MYP S+  +  STA+V +S  NL +G  ++  TF L+L++ ++ SL   N+ LKK+ L+FP + LGRG+ID++ +      Y R+   G + + + F W+  G  +  + +   G+   I  +  ++K  L   + D  +    + TDED DV +ERERI    +  ND+L +  L+K Y                      +++ AV+ I  GV  GECFGLLGVNGAGKTTTFKML G+ ++T G   + GYSI+ + L  H+NMG+CPQFDA+  LLT  E LY Y R+RGI  S+I    +  ++ L L+ +        SGGNKRK+ TAIA+IG P +V LDEPT GMD  +RRFLW  I ++  + + AV+LTSH+MEECE LC RLAIMV+G  K +G++QHLK KFG  Y V +++   +  LS D    E+ ++   +     +E++   ++Y     +  + + RVF+ + TN+    +++YSVSQ +LD+VF+NFAK  S
Sbjct: 1344 PCLTLTPWMYGPQF------TFISNEQPSHPKMKHFIQTLLKDPGM-GTRCMANQ--PLENIFTCLNSSSDWEVPPVSPEVSNILSSPEWDSRNP------SPSCECSTDLKLTMLPMCPAG-AGGLPPRQRKEPTGDILLDMTNRNISDYLVKTYTKLIKTSLKSKYWVNEQRYG-GISVGGRLPIL-------------DVDPEEIQNIFSQLGRMMNIRGAFNVLLYVWYNNKGWHAMASFLNVANNAILRAYLPPHANPSDYGITAINHPLNLTKEQLSEVTVLTTSVDAVVAICVIFAMSFIPASFVLYLIQERVTKAKHLQFVSGVSPLVYWFANFFWDMLNYSVSTAMVVAIFVGFDKKCYTSPTNLPALIALLCLYGWSVTPMMYPLSYMFNVPSTAYVSLSCINLFIGINSSAITFILELFE-NNRSLLMFNEVLKKVLLVFPHFCLGRGLIDMAMNQAVTDVYARF---GEEFSMDPFRWNFVGKNLFCMAV--EGFVYFIFNLLIQYKFFLHHWISDYGMS---LGTDEDDDVAQERERIYKGGNK-NDILLIRDLSKTY--------------------RRRKRPAVDKICVGVPAGECFGLLGVNGAGKTTTFKMLTGDTDVTSGELSVAGYSILSNILDVHQNMGYCPQFDAIDELLTGREHLYLYARLRGIPESEISRVAEWGIQKLGLSEYAGNCAGTYSGGNKRKLSTAIAMIGCPPLVLLDEPTTGMDPHSRRFLWTAILSIIRDGR-AVVLTSHSMEECEALCTRLAIMVNGTFKCLGTIQHLKYKFGGGYVVTMKIKAAKPGLSPDLVPAESFMDSS-FPGCIQREKHYNTLQYE----IAAASLARVFQLVLTNKERLNIEDYSVSQTTLDQVFVNFAKQQS 2180          

HSP 2 Score: 488.419 bits (1256), Expect = 0.000e+0
Identity = 337/1021 (33.01%), Postives = 529/1021 (51.81%), Query Frame = 2
Query:  656 SLINSTKSIPTCQLAFMNYFTKSNGLSVLYPIIGPLVFGKIYYTPNSAFTQEIIRRANSTFRILDNLRLASVEWR-LTFSNW-LINNSTNMGLLNDA--------------RNYCANSRTLMCQIINNSLSIETIQSTIASLSAMFVLIENSL-------NCTQLNKFTPMPSSIDIDNLSKQSSLGIL------AGIVFTDDFQYVTPQNATFLNYQIRMPASRIDSTKNFKVLDRFWTPIPRVNTLTNFNYYTSGFLFLQEIIDQAFIELITDNASVNIGSSMQIMPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTXXXXXXXXXXXXXXXXXGKXXXXXXXXXXXXXXXXXXXXXXCQCFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNND--NIEISDNFRQREENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSE-------------TCHNNKASESGTKLLE--------------FIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANINGPKVSFEFENNLVLLS----GLSLIFQQISGLFIKRFHHTKRNIKGLFSE 3532
            S I    + P C  A M     +    +++  + PLV GKI YTP+S   ++II+ AN+TF  L+ L+     W  L    W    NS  M ++ D               R    +++ ++  + N       +  T    S +F L + ++        C  L+KF      +D +NL    +L +L      AG+VF D + + T +    + ++IRM    ++ T   K+ DR+W P PR + + +  Y   GF +LQ++I+   ++L T +    +G  +Q MPYPCY++D  +  L+   P  +V+AW  +V+ ++KSIV EKE RLKE ++ MG+SN V W +WF  + +++     L+T I+  GK+L +S+PII+FL L  + V+ I QCF++SVFF+ +N+AA   GI+YF  YLP +    +QD ++ +M   V LL+ V+F     ++   E+   G Q+ N+  S +    +     + M+ +D+V Y ++AWY++ VFPG+YG+ +P+YF     YW+  S  ++  N  I++ F    +   I    K   +L++     +   K  K K         +  + Q+          K         I        +I   DIR +M+ IR  +G+CPQHNILF +LTVE+HI FY L+KG    E + ++ ++++++GL  K    ++NLSGGM+RKLS+AMAFVG SR++ LDEPT+GVDP+SRR IWDL++KYR+  RT+IL+THHMDEAD L DR+AIIS+GKL C GS LFLK  FG G+YL L +  + Q +             TC      +  ++ L+               I   +P +KLI+    + T +L +       + SLF +L+ +L  + ++S+G+SDTSLEE+FLKV  D         E   +S M             VS L          + NG   S E +++    S    G SL+ +Q   L +KRFHH  R+ K   ++
Sbjct:  351 SYIYDKTATPFCN-ALMQNLESNPITKIVWNSVKPLVMGKILYTPDSPAVRKIIKSANTTFEELERLQKIGKVWEELGPQLWDFFQNSIQMNMIRDTLRNPTVMDFLDRRLRETEFSTKDILNFLHNGPEGERFMNMTSFDWSDVFRLADQAIRMFNRYSECISLDKFV---GHMD-ENLMTHQALHLLGENKFWAGLVFMDMYPW-TIELPRHVKFKIRMDIDAVERTN--KIKDRYWDPGPRADPVEDHRYIWGGFAYLQDLIEHGILKLHTGH-DWPLGVYLQQMPYPCYVDDMFMLTLNRCFPIFMVLAWIYSVSMVVKSIVLEKEMRLKETLKAMGVSNGVIWYTWFIDSFIMMTASTALLTGIVMAGKVLNYSNPIILFLFLLTFTVATIMQCFLMSVFFNKANLAAACSGIIYFTLYLPHIFCFAWQDRITKDMKLAVSLLSPVAFGFGTEYLSRYEEQGLGLQWDNIGTSPLEGDEYSFFTSIRMMLLDAVLYGVLAWYLDNVFPGQYGIGRPFYFPLQSSYWLKPSPPSETSNAGINEYFSSEHQVCNI----KYRFELDLPECNGSRNSKHCKHKEKRERMEKEREREEQL----------KMQEEIQQEEIQKDHHLVPYIYGRDIRTEMDAIRQSLGMCPQHNILFKHLTVEEHILFYSLMKGREHKEAEQEVENMLEDLGLPHKRDEEAQNLSGGMQRKLSVAMAFVGGSRVVILDEPTSGVDPYSRRSIWDLLLKYRT-GRTVILSTHHMDEADLLSDRVAIISKGKLHCSGSPLFLKNCFGVGFYLTLVRRMKDQRKKENECDCASECSCTCSTCTRYKEESQALQPERVLDGNVESITTLIHHHVPEAKLIEMIGQEMTYLLPNKGFKYRAYASLFRELEETLGDMGLSSFGISDTSLEEIFLKVTAD--------GEAANSSIMC------------VSGL--------VTDANGVGASLESDSSEGRASRQVKGFSLVLKQFHALLVKRFHHATRSHKDFLAQ 1319          

HSP 3 Score: 165.622 bits (418), Expect = 3.737e-40
Identity = 121/401 (30.17%), Postives = 199/401 (49.63%), Query Frame = 2
Query: 2138 FLFTRRYWIPFSKNNDNIEISDNFRQREENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTS-----LFEQLDSSLDFLKIASYGLSDTSLEEVFLKVA-----DDPSQISHKRQ-----EKQIT 3295
            + F   +WI     +   +  D+  Q  E I   G     +D+   +LI +L K + + K PA+D + +     +  G LG NGAGKTTT  +LTG    TSG   +    I  ++  +   +G CPQ + +   LT  +H+Y Y  L+G+ +SEI       ++++GLS+     +   SGG KRKLS A+A +G   ++ LDEPT G+DP SRR +W  I+      R ++LT+H M+E + LC R+AI+  G  KC G+   LK  FG GY + ++             KA++ G         ++P    +D +         H +T + +  +     +F+ + ++ + L I  Y +S T+L++VF+  A     +D +  SH RQ     EK+++
Sbjct: 1825 YKFFLHHWISDYGMSLGTDEDDDVAQERERIYKGG---NKNDI---LLIRDLSKTYRRRKRPAVDKICVGVPAGECFGLLGVNGAGKTTTFKMLTGDTDVTSGELSVAGYSILSNILDVHQNMGYCPQFDAIDELLTGREHLYLYARLRGIPESEISRVAEWGIQKLGLSEYAGNCAGTYSGGNKRKLSTAIAMIGCPPLVLLDEPTTGMDPHSRRFLWTAILSIIRDGRAVVLTSHSMEECEALCTRLAIMVNGTFKCLGTIQHLKYKFGGGYVVTMKI------------KAAKPGLS-----PDLVPAESFMDSSFPGCIQREKHYNTLQYEIAAASLARVFQLVLTNKERLNIEDYSVSQTTLDQVFVNFAKQQSGEDDTAPSHLRQSGPKREKKVS 2202          

HSP 4 Score: 107.071 bits (266), Expect = 2.092e-22
Identity = 64/214 (29.91%), Postives = 114/214 (53.27%), Query Frame = 1
Query: 5443 INGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVK-IRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYR 6081
            I G  I  +     +++G CPQ + L   LT EE + FY+ ++G +  +    V+  L++L L    ++    +SGG +RK+  A+A +G  ++V LDEPT G+D  +RR +W L+  L       VIL++H+M+E ++L  R+AI+  G++   GS   LK+ FG  +Y+  +R   ++    +  +  +  +    +  R KEE+  +   R
Sbjct:  959 IYGRDIRTEMDAIRQSLGMCPQHNILFKHLTVEEHILFYSLMKGREHKEAEQEVENMLEDLGLPHKRDEEAQNLSGGMQRKLSVAMAFVGGSRVVILDEPTSGVDPYSRRSIWDLL--LKYRTGRTVILSTHHMDEADLLSDRVAIISKGKLHCSGSPLFLKNCFGVGFYLTLVRRMKDQRKKENECDCASECSCTCSTCTRYKEESQALQPER 1170          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Xenopus
Match: klf9 (Kruppel-like factor 9 [Source:Xenbase;Acc:XB-GENE-483889])

HSP 1 Score: 541.191 bits (1393), Expect = 0.000e+0
Identity = 366/1091 (33.55%), Postives = 565/1091 (51.79%), Query Frame = 2
Query:  449 WSNVNPNLYTQLLNSINYISPVISSFITSIKEM-QTGDQTLINKNLKILGQLLCGS--------------DQNDIDVFLQNFNLSLINSTK----------SIPTCQLAFMNYFTKSNGLSVLYPIIGPLVFGKIYYTPNSAFTQEIIRRANSTFRILDNLRLASVEWRLTFSN-W-LINNSTNMGLLNDARNYCANSRTLMCQIINNSLSIETI---------------------QSTIASLSAMFVLIENSLNCTQLNKFTPMPSSIDIDNLSKQSSLGIL------AGIVFTDDFQYVTPQNATFLNYQIRMPASRIDSTKNFKVLDRFWTPIPRVNTLTNFNYYTSGFLFLQEIIDQAFIELITDNASVNIGSSMQIMPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTXXXXXXXXXXXXXXXXXGKXXXXXXXXXXXXXXXXXXXXXXCQCFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENITIDG---FEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYY--LFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKV----ADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANINGPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGLFSE 3532
            W  V  NL   L   +    P I   +  ++ + Q G  T   + +  L  L CG               + N+  VFL       +NSTK          + P C  A +     +    + +  + PL+ GK+ Y+P+S   +EI+++ANSTF  L+ +R     W       W   ++S  M L+ D          L  Q+ +  L+ + +                     ++          L    + C  L+KF       D ++     +L +L      AG+VF D F + T    + + Y+IRM    ++ TK  K+ DR+W P PR + + +  Y   GF +LQ++ID   I+  T +  V  G  +Q MPYPC+++D  +  L+   P  +V+AW  +++ L+K IV EKE RLKE M+ MG++N V W++ F  +  ++    IL+T+++ +G +L +S+PII+F  L  + ++ I Q F++SVFF  +N+AA   G++YF  YLP ++   +QD ++ ++      L+ V+F     ++   E+   G Q+ N+  S +    +     + M+ +D+  Y  +AWY++ VFPG+YG+PKPWYF F   YW  F                E     DG   FE EP  +  G+ I++LVK +  +  PA+D +N+ FY+ QIT FLGHNGAGKTTT+SI+TG+  PTSGT ++   DI+  M+ IR  +G+CPQHNILF +LTVE+HI FY  LKG ++ + + Q   +++++G+  K    ++NLSGGM+RKLS+A+AFVG S+++ LDEPT+GVDP+SRR IWDL++KYRS  RTIIL+THHMDEAD L DRIAI+SQGKL C GS LFLK  FG G+Y  L LE  F +              + L E I   +P +KL++    +   +L         + SLF +L+ +L  L ++S+G+SDT LEEV   +     ++     ++   +      L T+ D  +           K   N  NIN  +           + G  L+ QQ + L IKRF H  R+ K  F++
Sbjct:  251 WGKVMSNLSESLKELVQ--KPSIQDLLWVLRPLVQDGGPTTFTQLINSLSDLFCGYPEGGGARVFSFNWYEDNNYKVFLG------VNSTKKETYYLYDKTTTPFCN-ALIQSMESNPATKIAWSAMKPLLMGKVLYSPDSPAVREILKKANSTFEQLERVRQMGKAWEEVGPQLWNFFHSSVQMNLVRDTIKNPTVKEFLTRQLGDEGLTADDVINFLYNGNQDERPEGQVNYDWRNIFNITDHAIRLFNQYMGCLTLDKF----EGHDDESHLTHHALYLLEENKFWAGLVFLDMFPW-TNTLPSHVKYKIRMDIDAVEKTK--KIKDRYWDPGPRADPVEDMRYIWGGFAYLQDMIDHGIIKSQT-STEVPAGIYLQQMPYPCFVDDVFMITLNRCFPIFMVLAWIYSISMLVKDIVLEKELRLKETMKNMGVTNDVIWLTRFIDSFTVMTTSTILLTVVIVVGGVLHYSNPIILFCFLMAFTIATIMQAFLMSVFFSKANLAAACSGVIYFTLYLPHILCFAWQDRMTIKLKTLASFLSPVAFGFGTEYLSRYEEQGLGLQWGNIRKSPMEGDEYSFLFSIFMMLLDAFIYWTLAWYIDHVFPGEYGIPKPWYFPFLATYWCKF----------------EHEFGGDGNPFFEPEPPGMVPGVYIQDLVKVYENTYKPAVDRMNITFYEGQITAFLGHNGAGKTTTLSIITGLFPPTSGTVWVRGRDIQTHMDSIRQSLGMCPQHNILFRHLTVEEHILFYAQLKGKSRKQAERQAEVMLEDMGIPHKRNDEAQNLSGGMQRKLSVALAFVGESKVVVLDEPTSGVDPYSRRSIWDLLLKYRS-GRTIILSTHHMDEADLLGDRIAIVSQGKLFCSGSPLFLKNCFGTGFYLTLLLEIMFNV--------------SGLTELIHHHVPEAKLLESIGQELIYLLPSKDFKFRAYASLFRELEETLGDLGLSSFGISDTPLEEVVYHIPVNSGNNIGPCMYRNSHRAQVINRLMTIKDSHHC----------KAEKNPPNINDREADGRGSRQ---IKGTELLQQQFNALIIKRFKHATRSHKDFFAQ 1280          

HSP 2 Score: 391.734 bits (1005), Expect = 0.000e+0
Identity = 280/911 (30.74%), Postives = 452/911 (49.62%), Query Frame = 1
Query: 3604 PSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMN----TSLYQLEN------FKCLYPYNTN-----KWSEKSPIEISLVTPECDCSTTGNQI----CSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIM-----------KQYGGLQF--ILPSFFGQSCQVIGESQIWFDFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFS------YLRYNISGGDENYNAFEWDITGNKICSL---GILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPY-EIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSID------FRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLS-DRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEV 6189
            PS+T+ PW+   +        F+  E   ++     +  + +  G  G RCM     +  YQ  N         + P  TN     +W+  +P      +P C CS+    +    C    +GG     RI  SS+ + DL+  NISD+L+K +   I            ++YGG+     LP    +   ++        F   +    +  +   Q       Q F  +   + N+ ++W N+KG+ SM  + N+ +N +LR+ + A K  + +GI   N+PL  T+  L         ++V +AI VIF +SFIPASFV++LI+ERV+ +K  Q+VSGV P +YW++NF WD I Y+ISV +V++ F+AF+ ++Y  S N+ A I LLF Y  AVIP MYP S+  +  STA+V +S  NL +G  ++  TF LDL++ ++ SL   N+ LK + LIFP + LGRG+IDL+ +      Y R+   G +   N F+W+  G  I ++   G+++    L+I     +H+          +  PY  +  D D++ F                   +      +P++D         +CFG   +N + +          +F +  G+   +   +G      + +L    ++         +  IDD L   +++                 +LY   R+RG+   +I +  D  ++ L L  + +  T   SGGNKRK+ TAIALIG P +V LDEPT GMD  +RRFLW  I ++  E + AV+LTSH+MEECEVLC RLAIMV G  K +G++QHLK KFG  Y V +++  ++  L+ D   +E  I      S + +E++  +++Y+  SS  L+ +F++    + +  ++EYSVSQ +LD+V
Sbjct: 1305 PSLTLHPWIYGQQF------VFFSNEQPGNEQMATFSNAFLNSPGL-GTRCMKDQPLSKKYQCTNTSNEWTMPAVSPSVTNMLLSQEWTRDNP------SPSCTCSSRSKLMMLPECPEG-AGGRPPPQRIQPSSEIIQDLTERNISDFLLKTYPDLIRSSMKSKYWVNEQRYGGISVGGKLPVLHVKGGDIV-------SFFSQVGQMTNVTAAISQ-----ELQTFLQNLETEDNI-KVWFNNKGWHSMVIFINVANNAILRANLGADKDPEEFGITTMNHPLNLTKDQLSEVTVLTTSVDVVVAICVIFAMSFIPASFVLYLIQERVSNAKHLQFVSGVTPAIYWLTNFAWDIINYAISVAMVVIIFIAFDKKAYTSSSNLPALIALLFFYGWAVIPMMYPASYLFNVPSTAYVALSCINLFIGINSSAITFILDLFE-NNRSLLKFNEKLKDLLLIFPHFCLGRGLIDLAMNQAVTDVYARF---GEEHVSNPFQWEFLGRNIFAMAVEGVVYFTLNLLI-----QHRFFF------RRSGPYHHLAKDFDINQFS------------------WTYPGKQSPAVDRLCVGVRPGECFGLLGVNGAGK--------TTTFKMLTGD---IQVTSGDASVAGYSILQDIADVHQNTGYCPQFDAIDDLLTGREHL-----------------QLY--GRLRGVPEDEIDMVADWGIEKLGLGKYADNLTGTYSGGNKRKLSTAIALIGCPPVVLLDEPTTGMDPQSRRFLWNSIVSIIKEGR-AVVLTSHSMEECEVLCTRLAIMVKGTFKCLGTIQHLKYKFGDGYIVTMKVRASKPGLAPDPGPVEKFIQTNFPGSVQ-REKHYNMLQYQLSSS-SLARVFQLLISNKDSLNIEEYSVSQTTLDQV 2122          

HSP 3 Score: 167.933 bits (424), Expect = 1.024e-40
Identity = 109/310 (35.16%), Postives = 166/310 (53.55%), Query Frame = 2
Query: 2303 FPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEV 3232
            +P  ++PA+D L +     +  G LG NGAGKTTT  +LTG +  TSG A +    I  D+  +    G CPQ + +   LT  +H+  YG L+G+ + EI       ++++GL K    ++   SGG KRKLS A+A +G   ++ LDEPT G+DP SRR +W+ IV      R ++LT+H M+E + LC R+AI+ +G  KC G+   LK  FGDGY +       ++        A + G  + +FI+   P S   ++        LS +S  R     +F+ L S+ D L I  Y +S T+L++V
Sbjct: 1825 YPGKQSPAVDRLCVGVRPGECFGLLGVNGAGKTTTFKMLTGDIQVTSGDASVAGYSILQDIADVHQNTGYCPQFDAIDDLLTGREHLQLYGRLRGVPEDEIDMVADWGIEKLGLGKYADNLTGTYSGGNKRKLSTAIALIGCPPVVLLDEPTTGMDPQSRRFLWNSIVSIIKEGRAVVLTSHSMEECEVLCTRLAIMVKGTFKCLGTIQHLKYKFGDGYIV------TMKVRASKPGLAPDPG-PVEKFIQTNFPGSVQREKHYNMLQYQLSSSSLAR-----VFQLLISNKDSLNIEEYSVSQTTLDQV 2122          

HSP 4 Score: 135.576 bits (340), Expect = 6.721e-31
Identity = 87/312 (27.88%), Postives = 156/312 (50.00%), Query Frame = 1
Query: 5293 EDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVII------EYRFDSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKN 6210
            E+  K AV+ ++    EG+    LG NGAGKTTT  ++ G    T G   + G  I        +++G CPQ + L   LT EE + FY +++G          ++ L+++ +    N     +SGG +RK+  A+A +G  K+V LDEPT G+D  +RR +W L+  L       +IL++H+M+E ++L  R+AI+  G++   GS   LK+ FG  +Y+ + L      + + + +  +I+  +  +  ++     +I      +++F +   L   FR  E+   +  +  + +S   L+EV  +   N
Sbjct:  894 ENTYKPAVDRMNITFYEGQITAFLGHNGAGKTTTLSIITGLFPPTSGTVWVRGRDIQTHMDSIRQSLGMCPQHNILFRHLTVEEHILFYAQLKGKSRKQAERQAEVMLEDMGIPHKRNDEAQNLSGGMQRKLSVALAFVGESKVVVLDEPTSGVDPYSRRSIWDLL--LKYRSGRTIILSTHHMDEADLLGDRIAIVSQGKLFCSGSPLFLKNCFGTGFYLTLLLE----IMFNVSGLTELIHHHVPEAKLLESIGQELIYLLPSKDFKFRAYASL---FRELEETLGDLGLSSFGISDTPLEEVVYHIPVN 1196          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Xenopus
Match: klf9 (Kruppel-like factor 9 [Source:Xenbase;Acc:XB-GENE-483889])

HSP 1 Score: 541.191 bits (1393), Expect = 0.000e+0
Identity = 329/918 (35.84%), Postives = 499/918 (54.36%), Query Frame = 1
Query: 3604 PSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMN----TSLYQLEN------FKCLYPYNTN-----KWSEKSPIEISLVTPECDCSTTGNQI----CSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIM-----------KQYGGLQF--ILPSFFGQSCQVIGESQIWFDFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFS------YLRYNISGGDENYNAFEWDITGNKICSL---GILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLS-DRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRNI 6231
            PS+T+ PW+   +        F+  E   ++     +  + +  G  G RCM     +  YQ  N         + P  TN     +W+  +P      +P C CS+    +    C     G P    RI  SS+ + DL+  NISD+L+K +   I            ++YGG+     LP    +   ++        F   +    +  +           Q F  +   + N+ ++W N+KG+ SM  + N+ +N +LR+ + A K  + +GI   N+PL  T+  L         ++V +AI VIF +SFIPASFV++LI+ERV+ +K  Q+VSGV P +YW++NF WD I Y+ISV +V++ F+AF+ ++Y  S N+ A I LLF Y  AVIP MYP S+  +  STA+V +S  NL +G  ++  TF LDL++ ++ SL   N+ LK + LIFP + LGRG+IDL+ +      Y R+   G +   N F+W+  G  I ++   G+++    L+I     +H+        +    P  ++  ED DV +ER+R+ +     ND+L++  LTK Y                      K+  AV+ +  GV+ GECFGLLGVNGAGKTTTFKML G+  +T G+A + GYSI+ D    H+N G+CPQFDA+  LLT  E L  Y R+RG+   +I +  D  ++ L L  + +  T   SGGNKRK+ TAIALIG P +V LDEPT GMD  +RRFLW  I ++  E + AV+LTSH+MEECEVLC RLAIMV G  K +G++QHLK KFG  Y V +++  ++  L+ D   +E  I      S + +E++  +++Y+  SS  L+ +F++    + +  ++EYSVSQ +LD+VF+NFAK  +   +I
Sbjct: 1474 PSLTLHPWIYGQQF------VFFSNEQPGNEQMATFSNAFLNSPGL-GTRCMKDQPLSKKYQCTNTSNEWTMPAVSPSVTNMLLSQEWTRDNP------SPSCTCSSRSKLMMLPECPEGAGGRP-PPQRIQPSSEIIQDLTERNISDFLLKTYPDLIRSSMKSKYWVNEQRYGGISVGGKLPVLHVKGGDIVS-------FFSQVGQMTNVTAGTTTKAISQELQTFLQNLETEDNI-KVWFNNKGWHSMVIFINVANNAILRANLGADKDPEEFGITTMNHPLNLTKDQLSEVTVLTTSVDVVVAICVIFAMSFIPASFVLYLIQERVSNAKHLQFVSGVTPAIYWLTNFAWDIINYAISVAMVVIIFIAFDKKAYTSSSNLPALIALLFFYGWAVIPMMYPASYLFNVPSTAYVALSCINLFIGINSSAITFILDLFE-NNRSLLKFNEKLKDLLLIFPHFCLGRGLIDLAMNQAVTDVYARF---GEEHVSNPFQWEFLGRNIFAMAVEGVVYFTLNLLI-----QHRFFFSTWFSE---PPKGLVEGEDEDVAQERQRV-IKGGGKNDILKLKELTKTY--------------------PGKQSPAVDRLCVGVRPGECFGLLGVNGAGKTTTFKMLTGDIQVTSGDASVAGYSILQDIADVHQNTGYCPQFDAIDDLLTGREHLQLYGRLRGVPEDEIDMVADWGIEKLGLGKYADNLTGTYSGGNKRKLSTAIALIGCPPVVLLDEPTTGMDPQSRRFLWNSIVSIIKEGR-AVVLTSHSMEECEVLCTRLAIMVKGTFKCLGTIQHLKYKFGDGYIVTMKVRASKPGLAPDPGPVEKFIQTNFPGSVQ-REKHYNMLQYQLSSS-SLARVFQLLISNKDSLNIEEYSVSQTTLDQVFVNFAKQQTEDEDI 2333          

HSP 2 Score: 327.405 bits (838), Expect = 0.000e+0
Identity = 201/491 (40.94%), Postives = 281/491 (57.23%), Query Frame = 2
Query: 2174 KNNDNIEISDNFRQREENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESG--------------------------TKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHK------RQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKT------INTANINGPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGLFSE 3532
            + ND  ++ D F      I    FE EP  +  G+ I++LVK +  +  PA+D +N+ FY+ QIT FLGHNGAGKTTT+SI+TG+  PTSGT ++   DI+  M+ IR  +G+CPQHNILF +LTVE+HI FY  LKG ++ + + Q   +++++G+  K    ++NLSGGM+RKLS+A+AFVG S+++ LDEPT+GVDP+SRR IWDL++KYRS  RTIIL+THHMDEAD L DRIAI+SQGKL C GS LFLK  FG G+YL L +      +T   + AS                             + L E I   +P +KL++    +   +L         + SLF +L+ +L  L ++S+G+SDT LEE+FLKV  D    +        +Q K  TS  +D  T   N+       S RK +       N  NIN  +           + G  L+ QQ + L IKRF H  R+ K  F++
Sbjct:  967 ERNDKDDMKDGFTY----IGNPFFEPEPPGMVPGVYIQDLVKVYENTYKPAVDRMNITFYEGQITAFLGHNGAGKTTTLSIITGLFPPTSGTVWVRGRDIQTHMDSIRQSLGMCPQHNILFRHLTVEEHILFYAQLKGKSRKQAERQAEVMLEDMGIPHKRNDEAQNLSGGMQRKLSVALAFVGESKVVVLDEPTSGVDPYSRRSIWDLLLKYRS-GRTIILSTHHMDEADLLGDRIAIVSQGKLFCSGSPLFLKNCFGTGFYLTLVRRMRNIKDTGKKDSASCQSDCSCPCSSCTPKVKENLLEQELDGDVSGLTELIHHHVPEAKLLESIGQELIYLLPSKDFKFRAYASLFRELEETLGDLGLSSFGISDTPLEEIFLKVTADSVTGTETPEEWMLQQRKSRTSLGVDNQTTVINIDNKGQESSIRKDSHHCKAEKNPPNINDREADGRGSRQ---IKGTELLQQQFNALIIKRFKHATRSHKDFFAQ 1449          

HSP 3 Score: 243.047 bits (619), Expect = 1.369e-63
Identity = 187/671 (27.87%), Postives = 318/671 (47.39%), Query Frame = 2
Query:  449 WSNVNPNLYTQLLNSINYISPVISSFITSIKEM-QTGDQTLINKNLKILGQLLCGS--------------DQNDIDVFLQNFNLSLINSTK----------SIPTCQLAFMNYFTKSNGLSVLYPIIGPLVFGKIYYTPNSAFTQEIIRRANSTFRILDNLRLASVEWRLTFSN-W-LINNSTNMGLLNDARNYCANSRTLMCQIINNSLSIETI---------------------QSTIASLSAMFVLIENSLNCTQLNKFTPMPSSIDIDNLSKQSSLGIL------AGIVFTDDFQYVTPQNATFLNYQIRMPASRIDSTKNFKVLDRFWTPIPRVNTLTNFNYYTSGFLFLQEIIDQAFIELITDNASVNIGSSMQIMPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTXXXXXXXXXXXXXXXXXGKXXXXXXXXXXXXXXXXXXXXXXCQCFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSK----NNDNIEISDNFRQREENITIDGFEKEPDDLEIGILIE 2287
            W  V  NL   L   +    P I   +  ++ + Q G  T   + +  L  L CG               + N+  VFL       +NSTK          + P C  A +     +    + +  + PL+ GK+ Y+P+S   +EI+++ANSTF  L+ +R     W       W   ++S  M L+ D          L  Q+ +  L+ + +                     ++          L    + C  L+KF       D ++     +L +L      AG+VF D F + T    + + Y+IRM    ++ TK  K+ DR+W P PR + + +  Y   GF +LQ++ID   I+  T +  V  G  +Q MPYPC+++D  +  L+   P  +V+AW  +++ L+K IV EKE RLKE M+ MG++N V W++ F  +  ++    IL+T+++ +G +L +S+PII+F  L  + ++ I Q F++SVFF  +N+AA   G++YF  YLP ++   +QD ++ ++      L+ V+F     ++   E+   G Q+ N+  S +    +     + M+ +D+  Y  +AWY++ VFPG+YG+PKPWYF F   YW  F      + D+IE   +  +  E   I+  + +P+ L  G+  E
Sbjct:  273 WGKVMSNLSESLKELVQ--KPSIQDLLWVLRPLVQDGGPTTFTQLINSLSDLFCGYPEGGGARVFSFNWYEDNNYKVFLG------VNSTKKETYYLYDKTTTPFCN-ALIQSMESNPATKIAWSAMKPLLMGKVLYSPDSPAVREILKKANSTFEQLERVRQMGKAWEEVGPQLWNFFHSSVQMNLVRDTIKNPTVKEFLTRQLGDEGLTADDVINFLYNGNQDERPEGQVNYDWRNIFNITDHAIRLFNQYMGCLTLDKF----EGHDDESHLTHHALYLLEENKFWAGLVFLDMFPW-TNTLPSHVKYKIRMDIDAVEKTK--KIKDRYWDPGPRADPVEDMRYIWGGFAYLQDMIDHGIIKSQT-STEVPAGIYLQQMPYPCFVDDVFMITLNRCFPIFMVLAWIYSISMLVKDIVLEKELRLKETMKNMGVTNDVIWLTRFIDSFTVMTTSTILLTVVIVVGGVLHYSNPIILFCFLMAFTIATIMQAFLMSVFFSKANLAAACSGVIYFTLYLPHILCFAWQDRMTIKLKTLASFLSPVAFGFGTEYLSRYEEQGLGLQWGNIRKSPMEGDEYSFLFSIFMMLLDAFIYWTLAWYIDHVFPGEYGIPKPWYFPFLATYWCKFEHEFGGDADSIETELSIHEHIEENHIEPTDNQPEALPDGVKEE 926          

HSP 4 Score: 174.866 bits (442), Expect = 8.668e-43
Identity = 113/327 (34.56%), Postives = 175/327 (53.52%), Query Frame = 2
Query: 2282 IENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQ 3262
            ++ L K +P  ++PA+D L +     +  G LG NGAGKTTT  +LTG +  TSG A +    I  D+  +    G CPQ + +   LT  +H+  YG L+G+ + EI       ++++GL K    ++   SGG KRKLS A+A +G   ++ LDEPT G+DP SRR +W+ IV      R ++LT+H M+E + LC R+AI+ +G  KC G+   LK  FGDGY +       ++        A + G  + +FI+   P S   ++        LS +S  R     +F+ L S+ D L I  Y +S T+L++VF+  A   ++
Sbjct: 2015 LKELTKTYPGKQSPAVDRLCVGVRPGECFGLLGVNGAGKTTTFKMLTGDIQVTSGDASVAGYSILQDIADVHQNTGYCPQFDAIDDLLTGREHLQLYGRLRGVPEDEIDMVADWGIEKLGLGKYADNLTGTYSGGNKRKLSTAIALIGCPPVVLLDEPTTGMDPQSRRFLWNSIVSIIKEGRAVVLTSHSMEECEVLCTRLAIMVKGTFKCLGTIQHLKYKFGDGYIV------TMKVRASKPGLAPDPG-PVEKFIQTNFPGSVQREKHYNMLQYQLSSSSLAR-----VFQLLISNKDSLNIEEYSVSQTTLDQVFVNFAKQQTE 2329          

HSP 5 Score: 134.42 bits (337), Expect = 1.479e-30
Identity = 74/223 (33.18%), Postives = 121/223 (54.26%), Query Frame = 1
Query: 5293 EDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKI 5961
            E+  K AV+ ++    EG+    LG NGAGKTTT  ++ G    T G   + G  I        +++G CPQ + L   LT EE + FY +++G          ++ L+++ +    N     +SGG +RK+  A+A +G  K+V LDEPT G+D  +RR +W L+  L       +IL++H+M+E ++L  R+AI+  G++   GS   LK+ FG  +Y+ +
Sbjct: 1007 ENTYKPAVDRMNITFYEGQITAFLGHNGAGKTTTLSIITGLFPPTSGTVWVRGRDIQTHMDSIRQSLGMCPQHNILFRHLTVEEHILFYAQLKGKSRKQAERQAEVMLEDMGIPHKRNDEAQNLSGGMQRKLSVALAFVGESKVVVLDEPTSGVDPYSRRSIWDLL--LKYRSGRTIILSTHHMDEADLLGDRIAIVSQGKLFCSGSPLFLKNCFGTGFYLTL 1227          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Xenopus
Match: klf9 (Kruppel-like factor 9 [Source:Xenbase;Acc:XB-GENE-483889])

HSP 1 Score: 540.806 bits (1392), Expect = 0.000e+0
Identity = 329/918 (35.84%), Postives = 500/918 (54.47%), Query Frame = 1
Query: 3604 PSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMN----TSLYQLEN------FKCLYPYNTN-----KWSEKSPIEISLVTPECDCSTTGNQI----CSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIM-----------KQYGGLQF--ILPSFFGQSCQVIGESQIWFDFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFS------YLRYNISGGDENYNAFEWDITGNKICSL---GILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLS-DRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRNI 6231
            PS+T+ PW+   +        F+  E   ++     +  + +  G  G RCM     +  YQ  N         + P  TN     +W+  +P      +P C CS+    +    C    +GG     RI  SS+ + DL+  NISD+L+K +   I            ++YGG+     LP    +   ++        F   +    +  +           Q F  +   + N+ ++W N+KG+ SM  + N+ +N +LR+ + A K  + +GI   N+PL  T+  L         ++V +AI VIF +SFIPASFV++LI+ERV+ +K  Q+VSGV P +YW++NF WD I Y+ISV +V++ F+AF+ ++Y  S N+ A I LLF Y  AVIP MYP S+  +  STA+V +S  NL +G  ++  TF LDL++ ++ SL   N+ LK + LIFP + LGRG+IDL+ +      Y R+   G +   N F+W+  G  I ++   G+++    L+I     +H+        +    P  ++  ED DV +ER+R+ +     ND+L++  LTK Y                      K+  AV+ +  GV+ GECFGLLGVNGAGKTTTFKML G+  +T G+A + GYSI+ D    H+N G+CPQFDA+  LLT  E L  Y R+RG+   +I +  D  ++ L L  + +  T   SGGNKRK+ TAIALIG P +V LDEPT GMD  +RRFLW  I ++  E + AV+LTSH+MEECEVLC RLAIMV G  K +G++QHLK KFG  Y V +++  ++  L+ D   +E  I      S + +E++  +++Y+  SS  L+ +F++    + +  ++EYSVSQ +LD+VF+NFAK  +   +I
Sbjct: 1363 PSLTLHPWIYGQQF------VFFSNEQPGNEQMATFSNAFLNSPGL-GTRCMKDQPLSKKYQCTNTSNEWTMPAVSPSVTNMLLSQEWTRDNP------SPSCTCSSRSKLMMLPECPEG-AGGRPPPQRIQPSSEIIQDLTERNISDFLLKTYPDLIRSSMKSKYWVNEQRYGGISVGGKLPVLHVKGGDIV-------SFFSQVGQMTNVTAGTTTKAISQELQTFLQNLETEDNI-KVWFNNKGWHSMVIFINVANNAILRANLGADKDPEEFGITTMNHPLNLTKDQLSEVTVLTTSVDVVVAICVIFAMSFIPASFVLYLIQERVSNAKHLQFVSGVTPAIYWLTNFAWDIINYAISVAMVVIIFIAFDKKAYTSSSNLPALIALLFFYGWAVIPMMYPASYLFNVPSTAYVALSCINLFIGINSSAITFILDLFE-NNRSLLKFNEKLKDLLLIFPHFCLGRGLIDLAMNQAVTDVYARF---GEEHVSNPFQWEFLGRNIFAMAVEGVVYFTLNLLI-----QHRFFFSTWFSE---PPKGLVEGEDEDVAQERQRV-IKGGGKNDILKLKELTKTY--------------------PGKQSPAVDRLCVGVRPGECFGLLGVNGAGKTTTFKMLTGDIQVTSGDASVAGYSILQDIADVHQNTGYCPQFDAIDDLLTGREHLQLYGRLRGVPEDEIDMVADWGIEKLGLGKYADNLTGTYSGGNKRKLSTAIALIGCPPVVLLDEPTTGMDPQSRRFLWNSIVSIIKEGR-AVVLTSHSMEECEVLCTRLAIMVKGTFKCLGTIQHLKYKFGDGYIVTMKVRASKPGLAPDPGPVEKFIQTNFPGSVQ-REKHYNMLQYQLSSS-SLARVFQLLISNKDSLNIEEYSVSQTTLDQVFVNFAKQQTEDEDI 2222          

HSP 2 Score: 536.954 bits (1382), Expect = 0.000e+0
Identity = 367/1113 (32.97%), Postives = 568/1113 (51.03%), Query Frame = 2
Query:  449 WSNVNPNLYTQLLNSINYISPVISSFITSIKEM-QTGDQTLINKNLKILGQLLCGS--------------DQNDIDVFLQNFNLSLINSTK----------SIPTCQLAFMNYFTKSNGLSVLYPIIGPLVFGKIYYTPNSAFTQEIIRRANSTFRILDNLRLASVEWRLTFSN-W-LINNSTNMGLLNDARNYCANSRTLMCQIINNSLSIETI---------------------QSTIASLSAMFVLIENSLNCTQLNKFTPMPSSIDIDNLSKQSSLGIL------AGIVFTDDFQYVTPQNATFLNYQIRMPASRIDSTKNFKVLDRFWTPIPRVNTLTNFNYYTSGFLFLQEIIDQAFIELITDNASVNIGSSMQIMPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTXXXXXXXXXXXXXXXXXGKXXXXXXXXXXXXXXXXXXXXXXCQCFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENITIDG---FEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFE----------IQSETCHNNKASESGTK--------------LLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKV----ADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANINGPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGLFSE 3532
            W  V  NL   L   I    P I   +  ++ + Q G  T   + +  L  L CG               + N+  VFL       +NSTK          + P C  A +     +    + +  + PL+ GK+ Y+P+S   +EI+++ANSTF  L+ +R     W       W   ++S  M L+ D          L  Q+ +  L+ + +                     ++          L    + C  L+KF       D ++     +L +L      AG+VF D F + T    + + Y+IRM    ++ TK  K+ DR+W P PR + + +  Y   GF +LQ++ID   I+  T +  V  G  +Q MPYPC+++D  +  L+   P  +V+AW  +++ L+K IV EKE RLKE M+ MG++N V W++ F  +  ++    IL+T+++ +G +L +S+PII+F  L  + ++ I Q F++SVFF  +N+AA   G++YF  YLP ++   +QD ++ ++      L+ V+F     ++   E+   G Q+ N+  S +    +     + M+ +D+  Y  +AWY++ VFPG+YG+PKPWYF F   YW  F                E     DG   FE EP  +  G+ I++LVK +  +  PA+D +N+ FY+ QIT FLGHNGAGKTTT+SI+TG+  PTSGT ++   DI+  M+ IR  +G+CPQHNILF +LTVE+HI FY  LKG ++ + + Q   +++++G+  K    ++NLSGGM+RKLS+A+AFVG S+++ LDEPT+GVDP+SRR IWDL++KYRS  RTIIL+THHMDEAD L DRIAI+SQGKL C GS LFLK  FG G+YL L +             + + T H+        K              L E I   +P +KL++    +   +L         + SLF +L+ +L  L ++S+G+SDT LEEV   +     ++     ++  +  + S+      D  +           K   N  NIN  +           + G  L+ QQ + L IKRF H  R+ K  F++
Sbjct:  273 WGKVMSNLSESLKEVIQ--KPSIQDLLWVLRPLVQDGGPTTFTQLINSLSDLFCGYPEGGGARVFSFNWYEDNNYKVFLG------VNSTKKETYYLYDKTTTPFCN-ALIQSMESNPATKIAWSAMKPLLMGKVLYSPDSPAVREILKKANSTFEQLERVRQMGKAWEEVGPQLWNFFHSSVQMNLVRDTIKNPTVKEFLTRQLGDEGLTADDVINFLYNGNQDERPEGQVNYDWRNIFNITDHAIRLFNQYMGCLTLDKF----EGHDDESHLTHHALYLLEENKFWAGLVFLDMFPW-TNTLPSHVKYKIRMDIDAVEKTK--KIKDRYWDPGPRADPVEDMRYIWGGFAYLQDMIDHGIIKSQT-STEVPAGIYLQQMPYPCFVDDVFMITLNRCFPIFMVLAWIYSISMLVKDIVLEKELRLKETMKNMGVTNDVIWLTRFIDSFTVMTTSTILLTVVIVVGGVLHYSNPIILFCFLMAFTIATIMQAFLMSVFFSKANLAAACSGVIYFTLYLPHILCFAWQDRMTIKLKTLASFLSPVAFGFGTEYLSRYEEQGLGLQWGNIRKSPMEGDEYSFLFSIFMMLLDAFIYWTLAWYIDHVFPGEYGIPKPWYFPFLATYWCKF----------------EHEFGGDGNPFFEPEPPGMVPGVYIQDLVKVYENTYKPAVDRMNITFYEGQITAFLGHNGAGKTTTLSIITGLFPPTSGTVWVRGRDIQTHMDSIRQSLGMCPQHNILFRHLTVEEHILFYAQLKGKSRKQAERQAEVMLEDMGIPHKRNDEAQNLSGGMQRKLSVALAFVGESKVVVLDEPTSGVDPYSRRSIWDLLLKYRS-GRTIILSTHHMDEADLLGDRIAIVSQGKLFCSGSPLFLKNCFGTGFYLTLVRRMRNIKDTGKKDSVSNITSHSISVCTPKVKENLLEQELDGDVSGLTELIHHHVPEAKLLESIGQELIYLLPSKDFKFRAYASLFRELEETLGDLGLSSFGISDTPLEEVVYHIPVNSGNNIGPCMYRNSQLHLASQESSIRKDSHHC----------KAEKNPPNINDREADGRGSRQ---IKGTELLQQQFNALIIKRFKHATRSHKDFFAQ 1338          

HSP 3 Score: 175.252 bits (443), Expect = 6.547e-43
Identity = 113/327 (34.56%), Postives = 175/327 (53.52%), Query Frame = 2
Query: 2282 IENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQ 3262
            ++ L K +P  ++PA+D L +     +  G LG NGAGKTTT  +LTG +  TSG A +    I  D+  +    G CPQ + +   LT  +H+  YG L+G+ + EI       ++++GL K    ++   SGG KRKLS A+A +G   ++ LDEPT G+DP SRR +W+ IV      R ++LT+H M+E + LC R+AI+ +G  KC G+   LK  FGDGY +       ++        A + G  + +FI+   P S   ++        LS +S  R     +F+ L S+ D L I  Y +S T+L++VF+  A   ++
Sbjct: 1904 LKELTKTYPGKQSPAVDRLCVGVRPGECFGLLGVNGAGKTTTFKMLTGDIQVTSGDASVAGYSILQDIADVHQNTGYCPQFDAIDDLLTGREHLQLYGRLRGVPEDEIDMVADWGIEKLGLGKYADNLTGTYSGGNKRKLSTAIALIGCPPVVLLDEPTTGMDPQSRRFLWNSIVSIIKEGRAVVLTSHSMEECEVLCTRLAIMVKGTFKCLGTIQHLKYKFGDGYIV------TMKVRASKPGLAPDPG-PVEKFIQTNFPGSVQREKHYNMLQYQLSSSSLAR-----VFQLLISNKDSLNIEEYSVSQTTLDQVFVNFAKQQTE 2218          

HSP 4 Score: 137.502 bits (345), Expect = 2.106e-31
Identity = 83/269 (30.86%), Postives = 137/269 (50.93%), Query Frame = 1
Query: 5293 EDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVK-IRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSV 6096
            E+  K AV+ ++    EG+    LG NGAGKTTT  ++ G    T G   + G  I        +++G CPQ + L   LT EE + FY +++G          ++ L+++ +    N     +SGG +RK+  A+A +G  K+V LDEPT G+D  +RR +W L+  L       +IL++H+M+E ++L  R+AI+  G++   GS   LK+ FG  +Y+  +R   N      ++ +  I +  I       +EN  ++E   D  V
Sbjct:  916 ENTYKPAVDRMNITFYEGQITAFLGHNGAGKTTTLSIITGLFPPTSGTVWVRGRDIQTHMDSIRQSLGMCPQHNILFRHLTVEEHILFYAQLKGKSRKQAERQAEVMLEDMGIPHKRNDEAQNLSGGMQRKLSVALAFVGESKVVVLDEPTSGVDPYSRRSIWDLL--LKYRSGRTIILSTHHMDEADLLGDRIAIVSQGKLFCSGSPLFLKNCFGTGFYLTLVRRMRNIKDTGKKDSVSNITSHSISVCTPKVKEN--LLEQELDGDV 1180          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Xenopus
Match: klf9 (Kruppel-like factor 9 [Source:Xenbase;Acc:XB-GENE-483889])

HSP 1 Score: 540.421 bits (1391), Expect = 0.000e+0
Identity = 329/918 (35.84%), Postives = 500/918 (54.47%), Query Frame = 1
Query: 3604 PSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMN----TSLYQLEN------FKCLYPYNTN-----KWSEKSPIEISLVTPECDCSTTGNQI----CSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIM-----------KQYGGLQF--ILPSFFGQSCQVIGESQIWFDFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFS------YLRYNISGGDENYNAFEWDITGNKICSL---GILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLS-DRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRNI 6231
            PS+T+ PW+   +        F+  E   ++     +  + +  G  G RCM     +  YQ  N         + P  TN     +W+  +P      +P C CS+    +    C    +GG     RI  SS+ + DL+  NISD+L+K +   I            ++YGG+     LP    +   ++        F   +    +  +           Q F  +   + N+ ++W N+KG+ SM  + N+ +N +LR+ + A K  + +GI   N+PL  T+  L         ++V +AI VIF +SFIPASFV++LI+ERV+ +K  Q+VSGV P +YW++NF WD I Y+ISV +V++ F+AF+ ++Y  S N+ A I LLF Y  AVIP MYP S+  +  STA+V +S  NL +G  ++  TF LDL++ ++ SL   N+ LK + LIFP + LGRG+IDL+ +      Y R+   G +   N F+W+  G  I ++   G+++    L+I     +H+        +    P  ++  ED DV +ER+R+ +     ND+L++  LTK Y                      K+  AV+ +  GV+ GECFGLLGVNGAGKTTTFKML G+  +T G+A + GYSI+ D    H+N G+CPQFDA+  LLT  E L  Y R+RG+   +I +  D  ++ L L  + +  T   SGGNKRK+ TAIALIG P +V LDEPT GMD  +RRFLW  I ++  E + AV+LTSH+MEECEVLC RLAIMV G  K +G++QHLK KFG  Y V +++  ++  L+ D   +E  I      S + +E++  +++Y+  SS  L+ +F++    + +  ++EYSVSQ +LD+VF+NFAK  +   +I
Sbjct: 1350 PSLTLHPWIYGQQF------VFFSNEQPGNEQMATFSNAFLNSPGL-GTRCMKDQPLSKKYQCTNTSNEWTMPAVSPSVTNMLLSQEWTRDNP------SPSCTCSSRSKLMMLPECPEG-AGGRPPPQRIQPSSEIIQDLTERNISDFLLKTYPDLIRSSMKSKYWVNEQRYGGISVGGKLPVLHVKGGDIV-------SFFSQVGQMTNVTAGTTTKAISQELQTFLQNLETEDNI-KVWFNNKGWHSMVIFINVANNAILRANLGADKDPEEFGITTMNHPLNLTKDQLSEVTVLTTSVDVVVAICVIFAMSFIPASFVLYLIQERVSNAKHLQFVSGVTPAIYWLTNFAWDIINYAISVAMVVIIFIAFDKKAYTSSSNLPALIALLFFYGWAVIPMMYPASYLFNVPSTAYVALSCINLFIGINSSAITFILDLFE-NNRSLLKFNEKLKDLLLIFPHFCLGRGLIDLAMNQAVTDVYARF---GEEHVSNPFQWEFLGRNIFAMAVEGVVYFTLNLLI-----QHRFFFSTWFSE---PPKGLVEGEDEDVAQERQRV-IKGGGKNDILKLKELTKTY--------------------PGKQSPAVDRLCVGVRPGECFGLLGVNGAGKTTTFKMLTGDIQVTSGDASVAGYSILQDIADVHQNTGYCPQFDAIDDLLTGREHLQLYGRLRGVPEDEIDMVADWGIEKLGLGKYADNLTGTYSGGNKRKLSTAIALIGCPPVVLLDEPTTGMDPQSRRFLWNSIVSIIKEGR-AVVLTSHSMEECEVLCTRLAIMVKGTFKCLGTIQHLKYKFGDGYIVTMKVRASKPGLAPDPGPVEKFIQTNFPGSVQ-REKHYNMLQYQLSSS-SLARVFQLLISNKDSLNIEEYSVSQTTLDQVFVNFAKQQTEDEDI 2209          

HSP 2 Score: 534.258 bits (1375), Expect = 0.000e+0
Identity = 367/1113 (32.97%), Postives = 568/1113 (51.03%), Query Frame = 2
Query:  449 WSNVNPNLYTQLLNSINYISPVISSFITSIKEM-QTGDQTLINKNLKILGQLLCGS--------------DQNDIDVFLQNFNLSLINSTK----------SIPTCQLAFMNYFTKSNGLSVLYPIIGPLVFGKIYYTPNSAFTQEIIRRANSTFRILDNLRLASVEWRLTFSN-W-LINNSTNMGLLNDARNYCANSRTLMCQIINNSLSIETI---------------------QSTIASLSAMFVLIENSLNCTQLNKFTPMPSSIDIDNLSKQSSLGIL------AGIVFTDDFQYVTPQNATFLNYQIRMPASRIDSTKNFKVLDRFWTPIPRVNTLTNFNYYTSGFLFLQEIIDQAFIELITDNASVNIGSSMQIMPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTXXXXXXXXXXXXXXXXXGKXXXXXXXXXXXXXXXXXXXXXXCQCFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENITIDG---FEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASE-----------------SGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANI--------NGPKVSFEFENN---LVLLSGLSLIFQQISGLFIKRFHHTKRNIKGLFSE 3532
            W  V  NL   L   I    P I   +  ++ + Q G  T   + +  L  L CG               + N+  VFL       +NSTK          + P C  A +     +    + +  + PL+ GK+ Y+P+S   +EI+++ANSTF  L+ +R     W       W   ++S  M L+ D          L  Q+ +  L+ + +                     ++          L    + C  L+KF       D ++     +L +L      AG+VF D F + T    + + Y+IRM    ++ TK  K+ DR+W P PR + + +  Y   GF +LQ++ID   I+  T +  V  G  +Q MPYPC+++D  +  L+   P  +V+AW  +++ L+K IV EKE RLKE M+ MG++N V W++ F  +  ++    IL+T+++ +G +L +S+PII+F  L  + ++ I Q F++SVFF  +N+AA   G++YF  YLP ++   +QD ++ ++      L+ V+F     ++   E+   G Q+ N+  S +    +     + M+ +D+  Y  +AWY++ VFPG+YG+PKPWYF F   YW  F                E     DG   FE EP  +  G+ I++LVK +  +  PA+D +N+ FY+ QIT FLGHNGAGKTTT+SI+TG+  PTSGT ++   DI+  M+ IR  +G+CPQHNILF +LTVE+HI FY  LKG ++ + + Q   +++++G+  K    ++NLSGGM+RKLS+A+AFVG S+++ LDEPT+GVDP+SRR IWDL++KYRS  RTIIL+THHMDEAD L DRIAI+SQGKL C GS LFLK  FG G+YL L +      +T   +  S                    + L E I   +P +KL++    +   +L         + SLF +L+ +L  L ++S+G+SDT LEEV   +                       +  G N    +    +R   ++ A+I        + P+    FE +      + G  L+ QQ + L IKRF H  R+ K  F++
Sbjct:  273 WGKVMSNLSESLKEVIQ--KPSIQDLLWVLRPLVQDGGPTTFTQLINSLSDLFCGYPEGGGARVFSFNWYEDNNYKVFLG------VNSTKKETYYLYDKTTTPFCN-ALIQSMESNPATKIAWSAMKPLLMGKVLYSPDSPAVREILKKANSTFEQLERVRQMGKAWEEVGPQLWNFFHSSVQMNLVRDTIKNPTVKEFLTRQLGDEGLTADDVINFLYNGNQDERPEGQVNYDWRNIFNITDHAIRLFNQYMGCLTLDKF----EGHDDESHLTHHALYLLEENKFWAGLVFLDMFPW-TNTLPSHVKYKIRMDIDAVEKTK--KIKDRYWDPGPRADPVEDMRYIWGGFAYLQDMIDHGIIKSQT-STEVPAGIYLQQMPYPCFVDDVFMITLNRCFPIFMVLAWIYSISMLVKDIVLEKELRLKETMKNMGVTNDVIWLTRFIDSFTVMTTSTILLTVVIVVGGVLHYSNPIILFCFLMAFTIATIMQAFLMSVFFSKANLAAACSGVIYFTLYLPHILCFAWQDRMTIKLKTLASFLSPVAFGFGTEYLSRYEEQGLGLQWGNIRKSPMEGDEYSFLFSIFMMLLDAFIYWTLAWYIDHVFPGEYGIPKPWYFPFLATYWCKF----------------EHEFGGDGNPFFEPEPPGMVPGVYIQDLVKVYENTYKPAVDRMNITFYEGQITAFLGHNGAGKTTTLSIITGLFPPTSGTVWVRGRDIQTHMDSIRQSLGMCPQHNILFRHLTVEEHILFYAQLKGKSRKQAERQAEVMLEDMGIPHKRNDEAQNLSGGMQRKLSVALAFVGESKVVVLDEPTSGVDPYSRRSIWDLLLKYRS-GRTIILSTHHMDEADLLGDRIAIVSQGKLFCSGSPLFLKNCFGTGFYLTLVRRMRNIKDTGKKDSVSNITSHSISENLLEQELDGDVSGLTELIHHHVPEAKLLESIGQELIYLLPSKDFKFRAYASLFRELEETLGDLGLSSFGISDTPLEEVVYHIP----------------------VNSGNN----IGPCMYRNSQLHLASIIMSGVFLLDFPESYSRFEADGRGSRQIKGTELLQQQFNALIIKRFKHATRSHKDFFAQ 1325          

HSP 3 Score: 175.637 bits (444), Expect = 4.910e-43
Identity = 113/327 (34.56%), Postives = 175/327 (53.52%), Query Frame = 2
Query: 2282 IENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQ 3262
            ++ L K +P  ++PA+D L +     +  G LG NGAGKTTT  +LTG +  TSG A +    I  D+  +    G CPQ + +   LT  +H+  YG L+G+ + EI       ++++GL K    ++   SGG KRKLS A+A +G   ++ LDEPT G+DP SRR +W+ IV      R ++LT+H M+E + LC R+AI+ +G  KC G+   LK  FGDGY +       ++        A + G  + +FI+   P S   ++        LS +S  R     +F+ L S+ D L I  Y +S T+L++VF+  A   ++
Sbjct: 1891 LKELTKTYPGKQSPAVDRLCVGVRPGECFGLLGVNGAGKTTTFKMLTGDIQVTSGDASVAGYSILQDIADVHQNTGYCPQFDAIDDLLTGREHLQLYGRLRGVPEDEIDMVADWGIEKLGLGKYADNLTGTYSGGNKRKLSTAIALIGCPPVVLLDEPTTGMDPQSRRFLWNSIVSIIKEGRAVVLTSHSMEECEVLCTRLAIMVKGTFKCLGTIQHLKYKFGDGYIV------TMKVRASKPGLAPDPG-PVEKFIQTNFPGSVQREKHYNMLQYQLSSSSLAR-----VFQLLISNKDSLNIEEYSVSQTTLDQVFVNFAKQQTE 2205          

HSP 4 Score: 135.576 bits (340), Expect = 8.251e-31
Identity = 78/247 (31.58%), Postives = 129/247 (52.23%), Query Frame = 1
Query: 5293 EDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVK-IRLHPNRNSLSDRNEIETIINKEI 6030
            E+  K AV+ ++    EG+    LG NGAGKTTT  ++ G    T G   + G  I        +++G CPQ + L   LT EE + FY +++G          ++ L+++ +    N     +SGG +RK+  A+A +G  K+V LDEPT G+D  +RR +W L+  L       +IL++H+M+E ++L  R+AI+  G++   GS   LK+ FG  +Y+  +R   N      ++ +  I +  I
Sbjct:  916 ENTYKPAVDRMNITFYEGQITAFLGHNGAGKTTTLSIITGLFPPTSGTVWVRGRDIQTHMDSIRQSLGMCPQHNILFRHLTVEEHILFYAQLKGKSRKQAERQAEVMLEDMGIPHKRNDEAQNLSGGMQRKLSVALAFVGESKVVVLDEPTSGVDPYSRRSIWDLL--LKYRSGRTIILSTHHMDEADLLGDRIAIVSQGKLFCSGSPLFLKNCFGTGFYLTLVRRMRNIKDTGKKDSVSNITSHSI 1160          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Xenopus
Match: klf9 (Kruppel-like factor 9 [Source:Xenbase;Acc:XB-GENE-483889])

HSP 1 Score: 540.036 bits (1390), Expect = 0.000e+0
Identity = 329/918 (35.84%), Postives = 500/918 (54.47%), Query Frame = 1
Query: 3604 PSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMN----TSLYQLEN------FKCLYPYNTN-----KWSEKSPIEISLVTPECDCSTTGNQI----CSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIM-----------KQYGGLQF--ILPSFFGQSCQVIGESQIWFDFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFS------YLRYNISGGDENYNAFEWDITGNKICSL---GILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLS-DRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRNI 6231
            PS+T+ PW+   +        F+  E   ++     +  + +  G  G RCM     +  YQ  N         + P  TN     +W+  +P      +P C CS+    +    C    +GG     RI  SS+ + DL+  NISD+L+K +   I            ++YGG+     LP    +   ++        F   +    +  +           Q F  +   + N+ ++W N+KG+ SM  + N+ +N +LR+ + A K  + +GI   N+PL  T+  L         ++V +AI VIF +SFIPASFV++LI+ERV+ +K  Q+VSGV P +YW++NF WD I Y+ISV +V++ F+AF+ ++Y  S N+ A I LLF Y  AVIP MYP S+  +  STA+V +S  NL +G  ++  TF LDL++ ++ SL   N+ LK + LIFP + LGRG+IDL+ +      Y R+   G +   N F+W+  G  I ++   G+++    L+I     +H+        +    P  ++  ED DV +ER+R+ +     ND+L++  LTK Y                      K+  AV+ +  GV+ GECFGLLGVNGAGKTTTFKML G+  +T G+A + GYSI+ D    H+N G+CPQFDA+  LLT  E L  Y R+RG+   +I +  D  ++ L L  + +  T   SGGNKRK+ TAIALIG P +V LDEPT GMD  +RRFLW  I ++  E + AV+LTSH+MEECEVLC RLAIMV G  K +G++QHLK KFG  Y V +++  ++  L+ D   +E  I      S + +E++  +++Y+  SS  L+ +F++    + +  ++EYSVSQ +LD+VF+NFAK  +   +I
Sbjct: 1331 PSLTLHPWIYGQQF------VFFSNEQPGNEQMATFSNAFLNSPGL-GTRCMKDQPLSKKYQCTNTSNEWTMPAVSPSVTNMLLSQEWTRDNP------SPSCTCSSRSKLMMLPECPEG-AGGRPPPQRIQPSSEIIQDLTERNISDFLLKTYPDLIRSSMKSKYWVNEQRYGGISVGGKLPVLHVKGGDIV-------SFFSQVGQMTNVTAGTTTKAISQELQTFLQNLETEDNI-KVWFNNKGWHSMVIFINVANNAILRANLGADKDPEEFGITTMNHPLNLTKDQLSEVTVLTTSVDVVVAICVIFAMSFIPASFVLYLIQERVSNAKHLQFVSGVTPAIYWLTNFAWDIINYAISVAMVVIIFIAFDKKAYTSSSNLPALIALLFFYGWAVIPMMYPASYLFNVPSTAYVALSCINLFIGINSSAITFILDLFE-NNRSLLKFNEKLKDLLLIFPHFCLGRGLIDLAMNQAVTDVYARF---GEEHVSNPFQWEFLGRNIFAMAVEGVVYFTLNLLI-----QHRFFFSTWFSE---PPKGLVEGEDEDVAQERQRV-IKGGGKNDILKLKELTKTY--------------------PGKQSPAVDRLCVGVRPGECFGLLGVNGAGKTTTFKMLTGDIQVTSGDASVAGYSILQDIADVHQNTGYCPQFDAIDDLLTGREHLQLYGRLRGVPEDEIDMVADWGIEKLGLGKYADNLTGTYSGGNKRKLSTAIALIGCPPVVLLDEPTTGMDPQSRRFLWNSIVSIIKEGR-AVVLTSHSMEECEVLCTRLAIMVKGTFKCLGTIQHLKYKFGDGYIVTMKVRASKPGLAPDPGPVEKFIQTNFPGSVQ-REKHYNMLQYQLSSS-SLARVFQLLISNKDSLNIEEYSVSQTTLDQVFVNFAKQQTEDEDI 2190          

HSP 2 Score: 534.258 bits (1375), Expect = 0.000e+0
Identity = 367/1113 (32.97%), Postives = 568/1113 (51.03%), Query Frame = 2
Query:  449 WSNVNPNLYTQLLNSINYISPVISSFITSIKEM-QTGDQTLINKNLKILGQLLCGS--------------DQNDIDVFLQNFNLSLINSTK----------SIPTCQLAFMNYFTKSNGLSVLYPIIGPLVFGKIYYTPNSAFTQEIIRRANSTFRILDNLRLASVEWRLTFSN-W-LINNSTNMGLLNDARNYCANSRTLMCQIINNSLSIETI---------------------QSTIASLSAMFVLIENSLNCTQLNKFTPMPSSIDIDNLSKQSSLGIL------AGIVFTDDFQYVTPQNATFLNYQIRMPASRIDSTKNFKVLDRFWTPIPRVNTLTNFNYYTSGFLFLQEIIDQAFIELITDNASVNIGSSMQIMPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTXXXXXXXXXXXXXXXXXGKXXXXXXXXXXXXXXXXXXXXXXCQCFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENITIDG---FEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASE-----------------SGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANI--------NGPKVSFEFENN---LVLLSGLSLIFQQISGLFIKRFHHTKRNIKGLFSE 3532
            W  V  NL   L   I    P I   +  ++ + Q G  T   + +  L  L CG               + N+  VFL       +NSTK          + P C  A +     +    + +  + PL+ GK+ Y+P+S   +EI+++ANSTF  L+ +R     W       W   ++S  M L+ D          L  Q+ +  L+ + +                     ++          L    + C  L+KF       D ++     +L +L      AG+VF D F + T    + + Y+IRM    ++ TK  K+ DR+W P PR + + +  Y   GF +LQ++ID   I+  T +  V  G  +Q MPYPC+++D  +  L+   P  +V+AW  +++ L+K IV EKE RLKE M+ MG++N V W++ F  +  ++    IL+T+++ +G +L +S+PII+F  L  + ++ I Q F++SVFF  +N+AA   G++YF  YLP ++   +QD ++ ++      L+ V+F     ++   E+   G Q+ N+  S +    +     + M+ +D+  Y  +AWY++ VFPG+YG+PKPWYF F   YW  F                E     DG   FE EP  +  G+ I++LVK +  +  PA+D +N+ FY+ QIT FLGHNGAGKTTT+SI+TG+  PTSGT ++   DI+  M+ IR  +G+CPQHNILF +LTVE+HI FY  LKG ++ + + Q   +++++G+  K    ++NLSGGM+RKLS+A+AFVG S+++ LDEPT+GVDP+SRR IWDL++KYRS  RTIIL+THHMDEAD L DRIAI+SQGKL C GS LFLK  FG G+YL L +      +T   +  S                    + L E I   +P +KL++    +   +L         + SLF +L+ +L  L ++S+G+SDT LEEV   +                       +  G N    +    +R   ++ A+I        + P+    FE +      + G  L+ QQ + L IKRF H  R+ K  F++
Sbjct:  254 WGKVMSNLSESLKEVIQ--KPSIQDLLWVLRPLVQDGGPTTFTQLINSLSDLFCGYPEGGGARVFSFNWYEDNNYKVFLG------VNSTKKETYYLYDKTTTPFCN-ALIQSMESNPATKIAWSAMKPLLMGKVLYSPDSPAVREILKKANSTFEQLERVRQMGKAWEEVGPQLWNFFHSSVQMNLVRDTIKNPTVKEFLTRQLGDEGLTADDVINFLYNGNQDERPEGQVNYDWRNIFNITDHAIRLFNQYMGCLTLDKF----EGHDDESHLTHHALYLLEENKFWAGLVFLDMFPW-TNTLPSHVKYKIRMDIDAVEKTK--KIKDRYWDPGPRADPVEDMRYIWGGFAYLQDMIDHGIIKSQT-STEVPAGIYLQQMPYPCFVDDVFMITLNRCFPIFMVLAWIYSISMLVKDIVLEKELRLKETMKNMGVTNDVIWLTRFIDSFTVMTTSTILLTVVIVVGGVLHYSNPIILFCFLMAFTIATIMQAFLMSVFFSKANLAAACSGVIYFTLYLPHILCFAWQDRMTIKLKTLASFLSPVAFGFGTEYLSRYEEQGLGLQWGNIRKSPMEGDEYSFLFSIFMMLLDAFIYWTLAWYIDHVFPGEYGIPKPWYFPFLATYWCKF----------------EHEFGGDGNPFFEPEPPGMVPGVYIQDLVKVYENTYKPAVDRMNITFYEGQITAFLGHNGAGKTTTLSIITGLFPPTSGTVWVRGRDIQTHMDSIRQSLGMCPQHNILFRHLTVEEHILFYAQLKGKSRKQAERQAEVMLEDMGIPHKRNDEAQNLSGGMQRKLSVALAFVGESKVVVLDEPTSGVDPYSRRSIWDLLLKYRS-GRTIILSTHHMDEADLLGDRIAIVSQGKLFCSGSPLFLKNCFGTGFYLTLVRRMRNIKDTGKKDSVSNITSHSISENLLEQELDGDVSGLTELIHHHVPEAKLLESIGQELIYLLPSKDFKFRAYASLFRELEETLGDLGLSSFGISDTPLEEVVYHIP----------------------VNSGNN----IGPCMYRNSQLHLASIIMSGVFLLDFPESYSRFEADGRGSRQIKGTELLQQQFNALIIKRFKHATRSHKDFFAQ 1306          

HSP 3 Score: 175.637 bits (444), Expect = 4.846e-43
Identity = 113/327 (34.56%), Postives = 175/327 (53.52%), Query Frame = 2
Query: 2282 IENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQ 3262
            ++ L K +P  ++PA+D L +     +  G LG NGAGKTTT  +LTG +  TSG A +    I  D+  +    G CPQ + +   LT  +H+  YG L+G+ + EI       ++++GL K    ++   SGG KRKLS A+A +G   ++ LDEPT G+DP SRR +W+ IV      R ++LT+H M+E + LC R+AI+ +G  KC G+   LK  FGDGY +       ++        A + G  + +FI+   P S   ++        LS +S  R     +F+ L S+ D L I  Y +S T+L++VF+  A   ++
Sbjct: 1872 LKELTKTYPGKQSPAVDRLCVGVRPGECFGLLGVNGAGKTTTFKMLTGDIQVTSGDASVAGYSILQDIADVHQNTGYCPQFDAIDDLLTGREHLQLYGRLRGVPEDEIDMVADWGIEKLGLGKYADNLTGTYSGGNKRKLSTAIALIGCPPVVLLDEPTTGMDPQSRRFLWNSIVSIIKEGRAVVLTSHSMEECEVLCTRLAIMVKGTFKCLGTIQHLKYKFGDGYIV------TMKVRASKPGLAPDPG-PVEKFIQTNFPGSVQREKHYNMLQYQLSSSSLAR-----VFQLLISNKDSLNIEEYSVSQTTLDQVFVNFAKQQTE 2186          

HSP 4 Score: 135.191 bits (339), Expect = 9.732e-31
Identity = 78/247 (31.58%), Postives = 129/247 (52.23%), Query Frame = 1
Query: 5293 EDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVK-IRLHPNRNSLSDRNEIETIINKEI 6030
            E+  K AV+ ++    EG+    LG NGAGKTTT  ++ G    T G   + G  I        +++G CPQ + L   LT EE + FY +++G          ++ L+++ +    N     +SGG +RK+  A+A +G  K+V LDEPT G+D  +RR +W L+  L       +IL++H+M+E ++L  R+AI+  G++   GS   LK+ FG  +Y+  +R   N      ++ +  I +  I
Sbjct:  897 ENTYKPAVDRMNITFYEGQITAFLGHNGAGKTTTLSIITGLFPPTSGTVWVRGRDIQTHMDSIRQSLGMCPQHNILFRHLTVEEHILFYAQLKGKSRKQAERQAEVMLEDMGIPHKRNDEAQNLSGGMQRKLSVALAFVGESKVVVLDEPTSGVDPYSRRSIWDLL--LKYRSGRTIILSTHHMDEADLLGDRIAIVSQGKLFCSGSPLFLKNCFGTGFYLTLVRRMRNIKDTGKKDSVSNITSHSI 1141          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Mouse
Match: Abca1 (ATP-binding cassette, sub-family A (ABC1), member 1 [Source:MGI Symbol;Acc:MGI:99607])

HSP 1 Score: 590.882 bits (1522), Expect = 0.000e+0
Identity = 377/1050 (35.90%), Postives = 569/1050 (54.19%), Query Frame = 2
Query:  617 QNDIDVFLQNFNLSLINSTKSIPTCQLAFMNYFTKSNGLS-VLYPIIGPLVFGKIYYTPNSAFTQEIIRRANSTFRILDNLRLASVEWR-LTFSNW-LINNSTNMGLLNDARNYCAN--------------SRTLMCQIINNSLSIETIQSTIASLSAMF-------VLIENSLNCTQLNKFTPMPSSIDIDNLSKQ--SSLGILAGIVFTDDFQYVTPQNATF---LNYQIRMPASRIDSTKNFKVLDRFWTPIPRVNTLTNFNYYTSGFLFLQEIIDQAFIELITDNASVNIGSSMQIMPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTXXXXXXXXXXXXXXXXXGKXXXXXXXXXXXXXXXXXXXXXXCQCFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGL-SKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFL-EKSFE---------------IQSETCHNNKASESG--------------TKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTI--------NTANINGPKVSFEFENNLVL----------LSGLSLIFQQISGLFIKRFHHTKRNIKGLFSE 3532
            + D+D F  N          + P C     N   +S+ LS +++  + PL+ GKI YTP++  T++++   N TF+ L         W  L+   W  + NS  M L+    +   N              ++ +M  +  N   +++   ++ +    F         I   + C  LNK  P+P+ + + N S +        AGIVFT     +TP +      + Y+IRM    ++ T   K+ D +W P PR +   +  Y   GF +LQ++++QA I ++T  +    G  +Q MPYPCY++D  +  +S  MP  + +AW  +V  +IKSIVYEKE RLKE MR+MG+ N + W SWF S+++ L++   L+ +ILKLG +L +S P ++F+ L  + +  I QCF+IS  F  +N+AA  GGI+YF  YLP+++ + +QD +   +     LL+ V+F     +    E+   G Q+ NLF S + +  F +   + M+  D+  Y ++ WY+EAVFPG+YG+P+PWYF  T+ YW       + I+   +    ++ ++    E+EP  L +G+ I+NLVK +      A+D L L FY+ QIT FLGHNGAGKTTT+SILTG+  PTSGTA+IL  DIR +M  IR  +G+CPQHN+LF  LTVE+HI+FY  LKG+++  +K ++  +  +VGL   KLK  +  LSGGM+RKLS+A+AFVG S+++ LDEPTAGVDP+SRRGIW+L++KYR   RTIIL+THHMDEAD L DRIAIIS GKL C GSSLFLK   G GYYL L +K  E               ++ E   +  +S++G              + +   I+K +  ++L+++   + T VL + +     F  LF ++D  L  L I+SYG+S+T+LEE+FLKVA++                 +D  T  G LP   +  +F  K          +  + N   +  E     +L          L G  L  QQ   L  KR    +R+ KG F++
Sbjct:  340 EEDVDTFYDN---------STTPYCNDLMKNL--ESSPLSRIIWKALKPLLVGKILYTPDTPATRQVMAEVNKTFQELAVFHDLEGMWEELSPQIWTFMENSQEMDLVRTLLDSRGNDQFWEQKLDGLDWTAQDIMAFLAKNPEDVQSPNGSVYTWREAFNETNQAIQTISRFMECVNLNKLEPIPTEVRLINKSMELLDERKFWAGIVFTG----ITPDSVELPHHVKYKIRMDIDNVERTN--KIKDGYWDPGPRADPFEDMRYVWGGFAYLQDVVEQAIIRVLT-GSEKKTGVYVQQMPYPCYVDDIFLRVMSRSMPLFMTLAWIYSVAVIIKSIVYEKEARLKETMRIMGLDNGILWFSWFVSSLIPLLVSAGLLVVILKLGNLLPYSDPSVVFVFLSVFAMVTILQCFLISTLFSRANLAAACGGIIYFTLYLPYVLCVAWQDYVGFSIKIFASLLSPVAFGFGCEYFALFEEQGIGVQWDNLFESPVEEDGFNLTTAVSMMLFDTFLYGVMTWYIEAVFPGQYGIPRPWYFPCTKSYWF-----GEEIDEKSHPGSSQKGVSEICMEEEPTHLRLGVSIQNLVKVYRDGMKVAVDGLALNFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYILGKDIRSEMSSIRQNLGVCPQHNVLFDMLTVEEHIWFYARLKGLSEKHVKAEMEQMALDVGLPPSKLKSKTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYSRRGIWELLLKYRQ-GRTIILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKKDVESSLSSCRNSSSTVSCLKKEDSVSQSSSDAGLGSDHESDTLTIDVSAISNLIRKHVSEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGISETTLEEIFLKVAEESG---------------VDAETSDGTLPARRNRRAFGDKQSCLHPFTEDDAVDPNDSDIDPESRETDLLSGMDGKGSYQLKGWKLTQQQFVALLWKRLLIARRSRKGFFAQ 1350          

HSP 2 Score: 503.056 bits (1294), Expect = 0.000e+0
Identity = 314/908 (34.58%), Postives = 491/908 (54.07%), Query Frame = 1
Query: 3604 PSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCM------NTSLYQLENFKCLYP--------YNTNKWSEKSPIEISLVTPECDCSTTGNQ----ICSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMK-----------QYGGLQFILPSFFGQSCQVIGESQIWFD----FRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNIS---GGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSV-KLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDS 6216
            PS+ + PW+   +       TF   +   D  + +L      D G  G RCM      +T     E    + P        +    W+ K+P      +P C CS+   +    +C     G      R   ++D L +L+  NISDYL+K +   I K           +YGG      S    + Q +  S    D     ++ +  ++D++++    +FL+    F      K N+ ++W N+KG+ ++ ++ N+ +N +LR+ +   +    YGI   N+PL  T+  L         ++V ++I VIF +SF+PASFV+FLI+ERV+ +K  Q++SGV P +YW+SNF WD   Y +   +VI+ F+ F  +SY+ S N+    +LL LY  ++ P MYP SF     STA+VV+++ NL +G   ++ TF L+L+   +  L   ND LK +FLIFP + LGRG+ID+  +    +     G +   +   WD+ G  + ++ +  V + LI V ++ +      I+ + VK K    + DED DV +ER+RI L+    ND+L++  LTKIY                      KRK AV+ I  G+  GECFGLLGVNGAGK+TTFKML G+  +T G+A +N  SI+ +  + H+NMG+CPQFDA+  LLT  E + F+  +RG+   ++    + +++ L L  +  K     SGGNKRK+ TA+ALIG P +VFLDEPT GMD  ARRFLW    ++  E + +V+LTSH+MEECE LC R+AIMV+G  + +GSVQHLK++FG  Y + +R+  +   L    E   +     +  + +KE++  +++Y+  SS+  L+ IF +    +    +++YSVSQ +LD+VF+NFAK+ S
Sbjct: 1375 PSLELQPWMYNEQY------TFVSNDAPEDMGTQELLNALTKDPG-FGTRCMEGNPIPDTPCLAGEEDWTISPVPQSIVDLFQNGNWTMKNP------SPACQCSSDKIKKMLPVCPPGAGGL-PPPQRKQKTADILQNLTGRNISDYLVKTYVQIIAKSLKNKIWVNEFRYGGF-----SLGVSNSQALPPSHEVNDAIKQMKKLLKLTKDSSAD----RFLSSLGRFMAGLDTKNNV-KVWFNNKGWHAISSFLNVINNAILRANLQKGENPSQYGITAFNHPLNLTKQQLSEVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVSKAKHLQFISGVKPVIYWLSNFVWDMCNYVVPATLVIIIFICFQQKSYVSSTNLPVLALLLLLYGWSITPLMYPASFVFKIPSTAYVVLTSVNLFIGINGSVATFVLELFT--NNKLNDINDILKSVFLIFPHFCLGRGLIDMVKNQAMADALERFGENRFVSPLSWDLVGRNLFAMAVEGVVFFLITVLIQYR----FFIRPRPVKAK-LPPLNDEDEDVRRERQRI-LDGGGQNDILEIKELTKIY--------------------RRKRKPAVDRICIGIPPGECFGLLGVNGAGKSTTFKMLTGDTPVTRGDAFLNKNSILSNIHEVHQNMGYCPQFDAITELLTGREHVEFFALLRGVPEKEVGKVGEWAIRKLGLVKYGEKYASNYSGGNKRKLSTAMALIGGPPVVFLDEPTTGMDPKARRFLWNCALSIVKEGR-SVVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGYTIVVRIAGSNPDLKPVQEFFGL----AFPGSVLKEKHRNMLQYQLPSSLSSLARIFSILSQSKKRLHIEDYSVSQTTLDQVFVNFAKDQS 2225          

HSP 3 Score: 185.652 bits (470), Expect = 3.856e-46
Identity = 128/417 (30.70%), Postives = 211/417 (50.60%), Query Frame = 2
Query: 2027 VGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKT--QWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISH 3271
            VG  L  + ++ V + LI   ++  F   +  P+P      +    P +  ++++       +RE    +DG  +  D LEI    + L K + + + PA+D + +     +  G LG NGAGK+TT  +LTG    T G AF+  N I  ++  +   +G CPQ + +   LT  +H+ F+ LL+G+ + E+       ++++GL K  +  + N SGG KRKLS AMA +G   ++FLDEPT G+DP +RR +W+  +      R+++LT+H M+E + LC R+AI+  G+ +C GS   LK  FGDGY + +  +            ++     + EF     P S L ++ +   Q+ +  S +S  R     +F  L  S   L I  Y +S T+L++VF+  A D S   H
Sbjct: 1849 VGRNLFAMAVEGVVFFLITVLIQYRF---FIRPRP-----VKAKLPPLNDEDEDV-------RRERQRILDGGGQN-DILEI----KELTKIYRRKRKPAVDRICIGIPPGECFGLLGVNGAGKSTTFKMLTGDTPVTRGDAFLNKNSILSNIHEVHQNMGYCPQFDAITELLTGREHVEFFALLRGVPEKEVGKVGEWAIRKLGLVKYGEKYASNYSGGNKRKLSTAMALIGGPPVVFLDEPTTGMDPKARRFLWNCALSIVKEGRSVVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGYTIVVRIA-----------GSNPDLKPVQEFFGLAFPGSVLKEKHRNMLQYQLPSSLSSLAR-----IFSILSQSKKRLHIEDYSVSQTTLDQVFVNFAKDQSDDDH 2229          

HSP 4 Score: 162.155 bits (409), Expect = 4.503e-39
Identity = 103/360 (28.61%), Postives = 171/360 (47.50%), Query Frame = 1
Query: 5293 EDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNK-PTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKI--------------------------------------RLHPNRNSLSDRNEIETIINKEIWSSARMKE----ENAVIIEYRFDSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRNISNGN 6243
             D  K+AV+ ++    EG+    LG NGAGKTTT  +L G    T G A I G  I  +     +N+G CPQ + L  +LT EE ++FY R++G+    +   ++    ++ L P   K  T  +SGG +RK+  A+A +G  K+V LDEPT G+D  +RR +W L+  L       +IL++H+M+E ++L  R+AI+  G++  +GS   LK++ G  YY+ +                                        H +     D + I  +I K + S AR+ E    E   ++ Y         ++F   +D  ++  +  Y +S+ +L+E+F+  A+   V    S+G 
Sbjct:  909 RDGMKVAVDGLALNFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYILGKDIRSEMSSIRQNLGVCPQHNVLFDMLTVEEHIWFYARLKGLSEKHVKAEMEQMALDVGLPPSKLKSKTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYSRRGIWELL--LKYRQGRTIILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKKDVESSLSSCRNSSSTVSCLKKEDSVSQSSSDAGLGSDHESDTLTIDVSAISNLIRKHV-SEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGISETTLEEIFLKVAEESGVDAETSDGT 1265          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Mouse
Match: Abca7 (ATP-binding cassette, sub-family A (ABC1), member 7 [Source:MGI Symbol;Acc:MGI:1351646])

HSP 1 Score: 568.54 bits (1464), Expect = 4.881e-167
Identity = 389/1261 (30.85%), Postives = 628/1261 (49.80%), Query Frame = 2
Query:  143 PFSLIIEMLIPLFVIFILVAVRRITSSYSMGTCELREKQMGSMGPIPFLRDFICTFNTSCYN------------------------TTQIDWTKNSINDFLTFMNNISSLYSSLYTTNFTVPGFVDWSNVNPNLYTQLLNSI---NYISPVISSFITSIKEMQTGDQTLINK----------------------NLKILGQLLCGS--------------DQNDIDVFLQNFNLSLINSTKSIPTCQLAFMNYFTKSNGLSVLYPIIGPLVFGKIYYTPNSAFTQEIIRRANSTFRILDNLRLASVEWRLTFSNWL--INNSTNMGLLN---DARNYCANSRTLMCQ--------IINNSLSIETIQSTIASLSAMFVLIENSLNCTQLNKFTPMPS-----SIDIDNLSKQSSLGILAGIVFTDDFQYVTPQNAT-------FLNYQIRMPASRIDSTKNFKVLDRFWTPIPRVNTLTNFNYYTSGFLFLQEIIDQAFIELITDNASVNIGSSMQIMPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTXXXXXXXXXXXXXXXXXGKXXXXXXXXXXXXXXXXXXXXXXCQCFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKA-----------------------------------------SESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANI--NGPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGLFSE 3532
            P  L++E+L PLF+ FILVAVR          C    K + S G +P+L+  +C  N SC+                          T+     +SI D L  +  +  +  ++       P   D      ++ T+LL  I     + PV+     S+++     + L  +                      +L+++ + LC +              + N ++ F+       +      P C   F+          +L+  + PL+ GKI + P++ FT++++ + N TF  L  LR     W +        +N+STN+ +L    D        +T   Q         ++ S    + +   A +  +  ++   + C  L+K   +PS     S  ++ L ++    + AGIVF      + P   +        L ++IRM     D T+  K+ D+FW P P  +   +  Y   GF++LQ++++QA + ++    S   G  +Q MP+PCY++D  +  LS  +P  L +AW  +V   +K++V EKE RL+E MR MG+S  V W+ WF S +   ++   L+ ++LKLG IL +S P++IFL L  + V+ + Q F++S FF  +N+AA  GG+ YF  YLP+++ + +++ L         LL+ V+F      +  LE+  DGAQ+ NL      D+ F +      + +D+V Y L  WY+EAV PG+YG+P+PW F F R YW        ++        ++  + +   E+ P  L  G+ I  L K F     PAL  LNL FY+  IT FLGHNGAGKTTT+SIL+G+  P+SG+A IL +D++ +M  IR  +G+CPQ+N+LF  LTVE+H++FYG LKG++ + +  +   ++++VGL+ K    +++LSGGM+RKLS+A+AFVG SR++ +DEPTAGVDP SRRGIW+L++KYR   RT+IL+THH+DEA+ L DR+A+++ G L CCGS LFL+++ G GYYL L KS   QS   H+ K                                          + S  ++LE +++ +P ++L+++   +  +VL +       F  +F++LD  L+ L +  YG+SDT+LEE+FLKV +D    +H+          L T T     P+P         T   A++  NG         N   + G +L  QQ+  L  KRF   +R+ +GLF++
Sbjct:   22 PIQLLVELLWPLFLFFILVAVRHSHPPLEHHECHFPNKPLPSAGTVPWLQGLVCNVNNSCFQHPTPGEKPGVLSNFKDSLISRLLADTRTVLGGHSIQDMLDALGKLIPVLRAV--GGGARPQESDQPTSQGSV-TKLLEKILQRASLDPVLGQAQDSMRKFSDAIRDLAQELLTLPSLMELRALLRRPRGSAGSLELVSEALCSTKGPSSPGGLSLNWYEANQLNEFMGPEVAPALPDNSLSPACS-EFVGTLDDHPVSRLLWRRLKPLILGKILFAPDTNFTRKLMAQVNQTFEELALLRDLHELWGVLGPQIFNFMNDSTNVAMLQRLLDVGGTGQRQQTPRAQKKLEAIKDFLDPSRGGYSWREAHADMGRLAGILGQMMECVSLDKLEAVPSEEALVSRALELLGERR---LWAGIVFLSPEHPLDPSELSSPALSPGHLRFKIRMDID--DVTRTNKIRDKFWDPGPSADPFMDLRYVWGGFVYLQDLLEQAAVRVLGGGNS-RTGLYLQQMPHPCYVDDVFLRVLSRSLPLFLTLAWIYSVALTVKAVVREKETRLRETMRAMGLSRAVLWLGWFLSCLGPFLVSAALLVLVLKLGNILPYSHPVVIFLFLAAFAVATVAQSFLLSAFFSRANLAAACGGLAYFALYLPYVLCVAWRERLHLGGLLAASLLSPVAFGFGCESLALLEEQGDGAQWHNLGTGPAEDV-FSLAQVSAFLLLDAVIYGLALWYLEAVCPGQYGIPEPWNFPFRRSYWCGPGPPKSSVLAPA---PQDPKVLV---EEPPLGLVPGVSIRGLKKHFRGCPQPALQGLNLDFYEGHITAFLGHNGAGKTTTLSILSGLFPPSSGSASILGHDVQTNMAAIRPHLGICPQYNVLFDMLTVEEHVWFYGRLKGVSAAAMGPERERLIRDVGLTLKRDTQTRHLSGGMQRKLSVAIAFVGGSRVVIMDEPTAGVDPASRRGIWELLLKYRE-GRTLILSTHHLDEAELLGDRVAMVAGGSLCCCGSPLFLRRHLGCGYYLTLVKSS--QSLVTHDAKGDSEDPRREKKSDGNGRTSDTAFTRGTSDKSNQAPAPGAVPITPSTARILELVQQHVPGAQLVEDLPHELLLVLPYAGALDGSFAMVFQELDQQLELLGLTGYGISDTNLEEIFLKVVED----AHREGGDSRPQLHLRTCT-----PQP--------PTGPEASVLENGELAPQGLAPNAAQVQGWTLTCQQLRALLHKRFLLARRSRRGLFAQ 1245          

HSP 2 Score: 456.833 bits (1174), Expect = 5.485e-130
Identity = 276/840 (32.86%), Postives = 447/840 (53.21%), Query Frame = 1
Query: 3811 TNKWSEKSPIEISLVTPECDCSTTGNQI----CSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMK-----------QYGGLQFILPSFFGQSCQVIGESQIWFDFRQ--SINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDL--------SFSYLRYNISGGDENYNA-FEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVK--LSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRNISNGNA 6246
            +  W+ +SP      +P C CS  G +     C +   G       +    + + +L+  N+SD+L+K + + + +           +YGG      S  G+   +    ++     +  ++ S +  N+    +  L  + L  ++     N  +IW N+KG+ +M A+ N  +N LL + + +      + I   N+PL  T+  L         ++V ++I V+F +SF+PASF + LIEER+T +K  Q VSG+   +YW+ NF WD   Y ++V IV+  FLAF  ++Y+  +N+ A ++LL LY  ++ P MYP SFF S  STA+VV++  NL +G  +++ TF L+L    D +L+  +  LK++FLIFP + LGRG+ID+        +F  L      GD+ + +   WDI G  +  L ++  G   +++ +  +H+  L  + K   L P   + +ED DV +ERER+        DVL +  LTK+Y                      +R  AV+ +  G+  GECFGLLGVNGAGKT+TF+M+ G+   + G A++ G+++  +   AH++MG+CPQ DA+  LLT  E L  + R+RG+  + +       L  L L  + ++P    SGGNKRK+ TA+AL+G P +VFLDEPT GMD  ARRFLW  + ++  E + +V+LTSH+MEECE LC RLAIMV+G  + +GS QHLK +FG  + + +R+ P      D+ E      +  +  A ++E +   + ++     +  L+ +FR          V+++SVSQ +L+EVF+ F+K+       S   A
Sbjct: 1347 SGNWTPESP------SPACQCSQPGARRLLPDCPAGAGGP-PPPQAVAGLGEVVQNLTGRNVSDFLVKTYPSLVRRGLKTKKWVDEVRYGGF-----SLGGRDPDLPTGHEVVRTLAEIRALLSPQPGNALDRILNNLTQWALGLDAR----NSLKIWFNNKGWHAMVAFVNRANNGLLHALLPSGPVRHAHSITTLNHPLNLTKEQLSEATLIASSVDVLVSICVVFAMSFVPASFTLVLIEERITRAKHLQLVSGLPQTLYWLGNFLWDMCNYLVAVCIVVFIFLAFQQRAYVAPENLPALLLLLLLYGWSITPLMYPASFFFSVPSTAYVVLTCINLFIGINSSMATFVLELL--SDQNLQEVSRILKQVFLIFPHFCLGRGLIDMVRNQAMADAFERL------GDKQFQSPLRWDIIGKNL--LAMMAQGPLFLLITLLLQHRNRLLPQSKPRLLPP---LGEEDEDVAQERERVT-KGATQGDVLVLRDLTKVYR--------------------GQRNPAVDRLCLGIPPGECFGLLGVNGAGKTSTFRMVTGDTLPSSGEAVLAGHNVAQERSAAHRSMGYCPQSDAIFDLLTGREHLELFARLRGVPEAQVAQTALSGLVRLGLPSYADRPAGTYSGGNKRKLATALALVGDPAVVFLDEPTTGMDPSARRFLWNSLLSVVREGR-SVVLTSHSMEECEALCTRLAIMVNGRFRCLGSSQHLKGRFGAGHTLTLRVPP------DQPEPAIAFIRITFPGAELREVHGSRLRFQLPPGGRCTLTRVFRELAAQGRAHGVEDFSVSQTTLEEVFLYFSKDQGEEEESSRQEA 2129          

HSP 3 Score: 171.014 bits (432), Expect = 8.973e-42
Identity = 104/339 (30.68%), Postives = 176/339 (51.92%), Query Frame = 2
Query: 2276 ILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISH-KRQEKQ 3289
            +++ +L K +   + PA+D L L     +  G LG NGAGKT+T  ++TG   P+SG A +  +++  +       +G CPQ + +F  LT  +H+  +  L+G+ ++++       +  +GL       +   SGG KRKL+ A+A VG+  ++FLDEPT G+DP +RR +W+ ++      R+++LT+H M+E + LC R+AI+  G+ +C GSS  LK  FG G+ L L    + Q E              + FI+   P ++L +   ++    L      R   T +F +L +      +  + +S T+LEEVFL  + D  +     RQE +
Sbjct: 1807 LVLRDLTKVYRGQRNPAVDRLCLGIPPGECFGLLGVNGAGKTSTFRMVTGDTLPSSGEAVLAGHNVAQERSAAHRSMGYCPQSDAIFDLLTGREHLELFARLRGVPEAQVAQTALSGLVRLGLPSYADRPAGTYSGGNKRKLATALALVGDPAVVFLDEPTTGMDPSARRFLWNSLLSVVREGRSVVLTSHSMEECEALCTRLAIMVNGRFRCLGSSQHLKGRFGAGHTLTLRVPPD-QPEPA------------IAFIRITFPGAELREVHGSRLRFQLPPG--GRCTLTRVFRELAAQGRAHGVEDFSVSQTTLEEVFLYFSKDQGEEEESSRQEAE 2130          

HSP 4 Score: 141.354 bits (355), Expect = 1.102e-32
Identity = 71/217 (32.72%), Postives = 123/217 (56.68%), Query Frame = 1
Query: 5311 AVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKI 5961
            A+  ++    EG     LG NGAGKTTT  +L G    + G+A I G+ +  +      ++G CPQ++ L  +LT EE ++FY R++G+  + +    +  ++++ LT   +  T  +SGG +RK+  AIA +G  ++V +DEPT G+D  +RR +W L+  L       +IL++H+++E E+L  R+A++  G +   GS   L+   G  YY+ +
Sbjct:  820 ALQGLNLDFYEGHITAFLGHNGAGKTTTLSILSGLFPPSSGSASILGHDVQTNMAAIRPHLGICPQYNVLFDMLTVEEHVWFYGRLKGVSAAAMGPERERLIRDVGLTLKRDTQTRHLSGGMQRKLSVAIAFVGGSRVVIMDEPTAGVDPASRRGIWELL--LKYREGRTLILSTHHLDEAELLGDRVAMVAGGSLCCCGSPLFLRRHLGCGYYLTL 1034          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Mouse
Match: Abca7 (ATP-binding cassette, sub-family A (ABC1), member 7 [Source:MGI Symbol;Acc:MGI:1351646])

HSP 1 Score: 568.54 bits (1464), Expect = 4.881e-167
Identity = 389/1261 (30.85%), Postives = 628/1261 (49.80%), Query Frame = 2
Query:  143 PFSLIIEMLIPLFVIFILVAVRRITSSYSMGTCELREKQMGSMGPIPFLRDFICTFNTSCYN------------------------TTQIDWTKNSINDFLTFMNNISSLYSSLYTTNFTVPGFVDWSNVNPNLYTQLLNSI---NYISPVISSFITSIKEMQTGDQTLINK----------------------NLKILGQLLCGS--------------DQNDIDVFLQNFNLSLINSTKSIPTCQLAFMNYFTKSNGLSVLYPIIGPLVFGKIYYTPNSAFTQEIIRRANSTFRILDNLRLASVEWRLTFSNWL--INNSTNMGLLN---DARNYCANSRTLMCQ--------IINNSLSIETIQSTIASLSAMFVLIENSLNCTQLNKFTPMPS-----SIDIDNLSKQSSLGILAGIVFTDDFQYVTPQNAT-------FLNYQIRMPASRIDSTKNFKVLDRFWTPIPRVNTLTNFNYYTSGFLFLQEIIDQAFIELITDNASVNIGSSMQIMPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTXXXXXXXXXXXXXXXXXGKXXXXXXXXXXXXXXXXXXXXXXCQCFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKA-----------------------------------------SESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANI--NGPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGLFSE 3532
            P  L++E+L PLF+ FILVAVR          C    K + S G +P+L+  +C  N SC+                          T+     +SI D L  +  +  +  ++       P   D      ++ T+LL  I     + PV+     S+++     + L  +                      +L+++ + LC +              + N ++ F+       +      P C   F+          +L+  + PL+ GKI + P++ FT++++ + N TF  L  LR     W +        +N+STN+ +L    D        +T   Q         ++ S    + +   A +  +  ++   + C  L+K   +PS     S  ++ L ++    + AGIVF      + P   +        L ++IRM     D T+  K+ D+FW P P  +   +  Y   GF++LQ++++QA + ++    S   G  +Q MP+PCY++D  +  LS  +P  L +AW  +V   +K++V EKE RL+E MR MG+S  V W+ WF S +   ++   L+ ++LKLG IL +S P++IFL L  + V+ + Q F++S FF  +N+AA  GG+ YF  YLP+++ + +++ L         LL+ V+F      +  LE+  DGAQ+ NL      D+ F +      + +D+V Y L  WY+EAV PG+YG+P+PW F F R YW        ++        ++  + +   E+ P  L  G+ I  L K F     PAL  LNL FY+  IT FLGHNGAGKTTT+SIL+G+  P+SG+A IL +D++ +M  IR  +G+CPQ+N+LF  LTVE+H++FYG LKG++ + +  +   ++++VGL+ K    +++LSGGM+RKLS+A+AFVG SR++ +DEPTAGVDP SRRGIW+L++KYR   RT+IL+THH+DEA+ L DR+A+++ G L CCGS LFL+++ G GYYL L KS   QS   H+ K                                          + S  ++LE +++ +P ++L+++   +  +VL +       F  +F++LD  L+ L +  YG+SDT+LEE+FLKV +D    +H+          L T T     P+P         T   A++  NG         N   + G +L  QQ+  L  KRF   +R+ +GLF++
Sbjct:   22 PIQLLVELLWPLFLFFILVAVRHSHPPLEHHECHFPNKPLPSAGTVPWLQGLVCNVNNSCFQHPTPGEKPGVLSNFKDSLISRLLADTRTVLGGHSIQDMLDALGKLIPVLRAV--GGGARPQESDQPTSQGSV-TKLLEKILQRASLDPVLGQAQDSMRKFSDAIRDLAQELLTLPSLMELRALLRRPRGSAGSLELVSEALCSTKGPSSPGGLSLNWYEANQLNEFMGPEVAPALPDNSLSPACS-EFVGTLDDHPVSRLLWRRLKPLILGKILFAPDTNFTRKLMAQVNQTFEELALLRDLHELWGVLGPQIFNFMNDSTNVAMLQRLLDVGGTGQRQQTPRAQKKLEAIKDFLDPSRGGYSWREAHADMGRLAGILGQMMECVSLDKLEAVPSEEALVSRALELLGERR---LWAGIVFLSPEHPLDPSELSSPALSPGHLRFKIRMDID--DVTRTNKIRDKFWDPGPSADPFMDLRYVWGGFVYLQDLLEQAAVRVLGGGNS-RTGLYLQQMPHPCYVDDVFLRVLSRSLPLFLTLAWIYSVALTVKAVVREKETRLRETMRAMGLSRAVLWLGWFLSCLGPFLVSAALLVLVLKLGNILPYSHPVVIFLFLAAFAVATVAQSFLLSAFFSRANLAAACGGLAYFALYLPYVLCVAWRERLHLGGLLAASLLSPVAFGFGCESLALLEEQGDGAQWHNLGTGPAEDV-FSLAQVSAFLLLDAVIYGLALWYLEAVCPGQYGIPEPWNFPFRRSYWCGPGPPKSSVLAPA---PQDPKVLV---EEPPLGLVPGVSIRGLKKHFRGCPQPALQGLNLDFYEGHITAFLGHNGAGKTTTLSILSGLFPPSSGSASILGHDVQTNMAAIRPHLGICPQYNVLFDMLTVEEHVWFYGRLKGVSAAAMGPERERLIRDVGLTLKRDTQTRHLSGGMQRKLSVAIAFVGGSRVVIMDEPTAGVDPASRRGIWELLLKYRE-GRTLILSTHHLDEAELLGDRVAMVAGGSLCCCGSPLFLRRHLGCGYYLTLVKSS--QSLVTHDAKGDSEDPRREKKSDGNGRTSDTAFTRGTSDKSNQAPAPGAVPITPSTARILELVQQHVPGAQLVEDLPHELLLVLPYAGALDGSFAMVFQELDQQLELLGLTGYGISDTNLEEIFLKVVED----AHREGGDSRPQLHLRTCT-----PQP--------PTGPEASVLENGELAPQGLAPNAAQVQGWTLTCQQLRALLHKRFLLARRSRRGLFAQ 1245          

HSP 2 Score: 456.833 bits (1174), Expect = 5.485e-130
Identity = 276/840 (32.86%), Postives = 447/840 (53.21%), Query Frame = 1
Query: 3811 TNKWSEKSPIEISLVTPECDCSTTGNQI----CSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMK-----------QYGGLQFILPSFFGQSCQVIGESQIWFDFRQ--SINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDL--------SFSYLRYNISGGDENYNA-FEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVK--LSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRNISNGNA 6246
            +  W+ +SP      +P C CS  G +     C +   G       +    + + +L+  N+SD+L+K + + + +           +YGG      S  G+   +    ++     +  ++ S +  N+    +  L  + L  ++     N  +IW N+KG+ +M A+ N  +N LL + + +      + I   N+PL  T+  L         ++V ++I V+F +SF+PASF + LIEER+T +K  Q VSG+   +YW+ NF WD   Y ++V IV+  FLAF  ++Y+  +N+ A ++LL LY  ++ P MYP SFF S  STA+VV++  NL +G  +++ TF L+L    D +L+  +  LK++FLIFP + LGRG+ID+        +F  L      GD+ + +   WDI G  +  L ++  G   +++ +  +H+  L  + K   L P   + +ED DV +ERER+        DVL +  LTK+Y                      +R  AV+ +  G+  GECFGLLGVNGAGKT+TF+M+ G+   + G A++ G+++  +   AH++MG+CPQ DA+  LLT  E L  + R+RG+  + +       L  L L  + ++P    SGGNKRK+ TA+AL+G P +VFLDEPT GMD  ARRFLW  + ++  E + +V+LTSH+MEECE LC RLAIMV+G  + +GS QHLK +FG  + + +R+ P      D+ E      +  +  A ++E +   + ++     +  L+ +FR          V+++SVSQ +L+EVF+ F+K+       S   A
Sbjct: 1347 SGNWTPESP------SPACQCSQPGARRLLPDCPAGAGGP-PPPQAVAGLGEVVQNLTGRNVSDFLVKTYPSLVRRGLKTKKWVDEVRYGGF-----SLGGRDPDLPTGHEVVRTLAEIRALLSPQPGNALDRILNNLTQWALGLDAR----NSLKIWFNNKGWHAMVAFVNRANNGLLHALLPSGPVRHAHSITTLNHPLNLTKEQLSEATLIASSVDVLVSICVVFAMSFVPASFTLVLIEERITRAKHLQLVSGLPQTLYWLGNFLWDMCNYLVAVCIVVFIFLAFQQRAYVAPENLPALLLLLLLYGWSITPLMYPASFFFSVPSTAYVVLTCINLFIGINSSMATFVLELL--SDQNLQEVSRILKQVFLIFPHFCLGRGLIDMVRNQAMADAFERL------GDKQFQSPLRWDIIGKNL--LAMMAQGPLFLLITLLLQHRNRLLPQSKPRLLPP---LGEEDEDVAQERERVT-KGATQGDVLVLRDLTKVYR--------------------GQRNPAVDRLCLGIPPGECFGLLGVNGAGKTSTFRMVTGDTLPSSGEAVLAGHNVAQERSAAHRSMGYCPQSDAIFDLLTGREHLELFARLRGVPEAQVAQTALSGLVRLGLPSYADRPAGTYSGGNKRKLATALALVGDPAVVFLDEPTTGMDPSARRFLWNSLLSVVREGR-SVVLTSHSMEECEALCTRLAIMVNGRFRCLGSSQHLKGRFGAGHTLTLRVPP------DQPEPAIAFIRITFPGAELREVHGSRLRFQLPPGGRCTLTRVFRELAAQGRAHGVEDFSVSQTTLEEVFLYFSKDQGEEEESSRQEA 2129          

HSP 3 Score: 171.014 bits (432), Expect = 8.973e-42
Identity = 104/339 (30.68%), Postives = 176/339 (51.92%), Query Frame = 2
Query: 2276 ILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISH-KRQEKQ 3289
            +++ +L K +   + PA+D L L     +  G LG NGAGKT+T  ++TG   P+SG A +  +++  +       +G CPQ + +F  LT  +H+  +  L+G+ ++++       +  +GL       +   SGG KRKL+ A+A VG+  ++FLDEPT G+DP +RR +W+ ++      R+++LT+H M+E + LC R+AI+  G+ +C GSS  LK  FG G+ L L    + Q E              + FI+   P ++L +   ++    L      R   T +F +L +      +  + +S T+LEEVFL  + D  +     RQE +
Sbjct: 1807 LVLRDLTKVYRGQRNPAVDRLCLGIPPGECFGLLGVNGAGKTSTFRMVTGDTLPSSGEAVLAGHNVAQERSAAHRSMGYCPQSDAIFDLLTGREHLELFARLRGVPEAQVAQTALSGLVRLGLPSYADRPAGTYSGGNKRKLATALALVGDPAVVFLDEPTTGMDPSARRFLWNSLLSVVREGRSVVLTSHSMEECEALCTRLAIMVNGRFRCLGSSQHLKGRFGAGHTLTLRVPPD-QPEPA------------IAFIRITFPGAELREVHGSRLRFQLPPG--GRCTLTRVFRELAAQGRAHGVEDFSVSQTTLEEVFLYFSKDQGEEEESSRQEAE 2130          

HSP 4 Score: 141.354 bits (355), Expect = 1.102e-32
Identity = 71/217 (32.72%), Postives = 123/217 (56.68%), Query Frame = 1
Query: 5311 AVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKI 5961
            A+  ++    EG     LG NGAGKTTT  +L G    + G+A I G+ +  +      ++G CPQ++ L  +LT EE ++FY R++G+  + +    +  ++++ LT   +  T  +SGG +RK+  AIA +G  ++V +DEPT G+D  +RR +W L+  L       +IL++H+++E E+L  R+A++  G +   GS   L+   G  YY+ +
Sbjct:  820 ALQGLNLDFYEGHITAFLGHNGAGKTTTLSILSGLFPPSSGSASILGHDVQTNMAAIRPHLGICPQYNVLFDMLTVEEHVWFYGRLKGVSAAAMGPERERLIRDVGLTLKRDTQTRHLSGGMQRKLSVAIAFVGGSRVVIMDEPTAGVDPASRRGIWELL--LKYREGRTLILSTHHLDEAELLGDRVAMVAGGSLCCCGSPLFLRRHLGCGYYLTL 1034          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Mouse
Match: Abca7 (ATP-binding cassette, sub-family A (ABC1), member 7 [Source:MGI Symbol;Acc:MGI:1351646])

HSP 1 Score: 567.385 bits (1461), Expect = 1.202e-166
Identity = 387/1259 (30.74%), Postives = 626/1259 (49.72%), Query Frame = 2
Query:  143 PFSLIIEMLIPLFVIFILVAVRRITSSYSMGTCELREKQMGSMGPIPFLRDFICTFNTSCYN------------------------TTQIDWTKNSINDFLTFMNNISSLYSSLYTTNFTVPGFVDWSNVNPNLYTQLLNSI---NYISPVISSFITSIKEMQTGDQTLINK----------------------NLKILGQLLCGS--------------DQNDIDVFLQNFNLSLINSTKSIPTCQLAFMNYFTKSNGLSVLYPIIGPLVFGKIYYTPNSAFTQEIIRRANSTFRILDNLRLASVEWRLTFSNWL--INNSTNMGLLN---DARNYCANSRTLMCQ--------IINNSLSIETIQSTIASLSAMFVLIENSLNCTQLNKFTPMPS-----SIDIDNLSKQSSLGILAGIVFTDDFQYVTPQNAT-------FLNYQIRMPASRIDSTKNFKVLDRFWTPIPRVNTLTNFNYYTSGFLFLQEIIDQAFIELITDNASVNIGSSMQIMPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTXXXXXXXXXXXXXXXXXGKXXXXXXXXXXXXXXXXXXXXXXCQCFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKA-----------------------------------------SESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANINGPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGLFSE 3532
            P  L++E+L PLF+ FILVAVR          C    K + S G +P+L+  +C  N SC+                          T+     +SI D L  +  +  +  ++       P   D      ++ T+LL  I     + PV+     S+++     + L  +                      +L+++ + LC +              + N ++ F+       +      P C   F+          +L+  + PL+ GKI + P++ FT++++ + N TF  L  LR     W +        +N+STN+ +L    D        +T   Q         ++ S    + +   A +  +  ++   + C  L+K   +PS     S  ++ L ++    + AGIVF      + P   +        L ++IRM     D T+  K+ D+FW P P  +   +  Y   GF++LQ++++QA + ++    S   G  +Q MP+PCY++D  +  LS  +P  L +AW  +V   +K++V EKE RL+E MR MG+S  V W+ WF S +   ++   L+ ++LKLG IL +S P++IFL L  + V+ + Q F++S FF  +N+AA  GG+ YF  YLP+++ + +++ L         LL+ V+F      +  LE+  DGAQ+ NL      D+ F +      + +D+V Y L  WY+EAV PG+YG+P+PW F F R YW        ++        ++  + +   E+ P  L  G+ I  L K F     PAL  LNL FY+  IT FLGHNGAGKTTT+SIL+G+  P+SG+A IL +D++ +M  IR  +G+CPQ+N+LF  LTVE+H++FYG LKG++ + +  +   ++++VGL+ K    +++LSGGM+RKLS+A+AFVG SR++ +DEPTAGVDP SRRGIW+L++KYR   RT+IL+THH+DEA+ L DR+A+++ G L CCGS LFL+++ G GYYL L KS   QS   H+ K                                          + S  ++LE +++ +P ++L+++   +  +VL +       F  +F++LD  L+ L +  YG+SDT+LEE+FLKV +D    +H+          L T T         SVL   +      +   P+       N   + G +L  QQ+  L  KRF   +R+ +GLF++
Sbjct:   22 PIQLLVELLWPLFLFFILVAVRHSHPPLEHHECHFPNKPLPSAGTVPWLQGLVCNVNNSCFQHPTPGEKPGVLSNFKDSLISRLLADTRTVLGGHSIQDMLDALGKLIPVLRAV--GGGARPQESDQPTSQGSV-TKLLEKILQRASLDPVLGQAQDSMRKFSDAIRDLAQELLTLPSLMELRALLRRPRGSAGSLELVSEALCSTKGPSSPGGLSLNWYEANQLNEFMGPEVAPALPDNSLSPACS-EFVGTLDDHPVSRLLWRRLKPLILGKILFAPDTNFTRKLMAQVNQTFEELALLRDLHELWGVLGPQIFNFMNDSTNVAMLQRLLDVGGTGQRQQTPRAQKKLEAIKDFLDPSRGGYSWREAHADMGRLAGILGQMMECVSLDKLEAVPSEEALVSRALELLGERR---LWAGIVFLSPEHPLDPSELSSPALSPGHLRFKIRMDID--DVTRTNKIRDKFWDPGPSADPFMDLRYVWGGFVYLQDLLEQAAVRVLGGGNS-RTGLYLQQMPHPCYVDDVFLRVLSRSLPLFLTLAWIYSVALTVKAVVREKETRLRETMRAMGLSRAVLWLGWFLSCLGPFLVSAALLVLVLKLGNILPYSHPVVIFLFLAAFAVATVAQSFLLSAFFSRANLAAACGGLAYFALYLPYVLCVAWRERLHLGGLLAASLLSPVAFGFGCESLALLEEQGDGAQWHNLGTGPAEDV-FSLAQVSAFLLLDAVIYGLALWYLEAVCPGQYGIPEPWNFPFRRSYWCGPGPPKSSVLAPA---PQDPKVLV---EEPPLGLVPGVSIRGLKKHFRGCPQPALQGLNLDFYEGHITAFLGHNGAGKTTTLSILSGLFPPSSGSASILGHDVQTNMAAIRPHLGICPQYNVLFDMLTVEEHVWFYGRLKGVSAAAMGPERERLIRDVGLTLKRDTQTRHLSGGMQRKLSVAIAFVGGSRVVIMDEPTAGVDPASRRGIWELLLKYRE-GRTLILSTHHLDEAELLGDRVAMVAGGSLCCCGSPLFLRRHLGCGYYLTLVKSS--QSLVTHDAKGDSEDPRREKKSDGNGRTSDTAFTRGTSDKSNQAPAPGAVPITPSTARILELVQQHVPGAQLVEDLPHELLLVLPYAGALDGSFAMVFQELDQQLELLGLTGYGISDTNLEEIFLKVVED----AHREGGDSRPQLHLRTCTPQPPTGPEASVLENGELAKLVLDPQAPQ---GLAPNAAQVQGWTLTCQQLRALLHKRFLLARRSRRGLFAQ 1253          

HSP 2 Score: 456.833 bits (1174), Expect = 7.157e-130
Identity = 276/840 (32.86%), Postives = 447/840 (53.21%), Query Frame = 1
Query: 3811 TNKWSEKSPIEISLVTPECDCSTTGNQI----CSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMK-----------QYGGLQFILPSFFGQSCQVIGESQIWFDFRQ--SINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDL--------SFSYLRYNISGGDENYNA-FEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVK--LSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRNISNGNA 6246
            +  W+ +SP      +P C CS  G +     C +   G       +    + + +L+  N+SD+L+K + + + +           +YGG      S  G+   +    ++     +  ++ S +  N+    +  L  + L  ++     N  +IW N+KG+ +M A+ N  +N LL + + +      + I   N+PL  T+  L         ++V ++I V+F +SF+PASF + LIEER+T +K  Q VSG+   +YW+ NF WD   Y ++V IV+  FLAF  ++Y+  +N+ A ++LL LY  ++ P MYP SFF S  STA+VV++  NL +G  +++ TF L+L    D +L+  +  LK++FLIFP + LGRG+ID+        +F  L      GD+ + +   WDI G  +  L ++  G   +++ +  +H+  L  + K   L P   + +ED DV +ERER+        DVL +  LTK+Y                      +R  AV+ +  G+  GECFGLLGVNGAGKT+TF+M+ G+   + G A++ G+++  +   AH++MG+CPQ DA+  LLT  E L  + R+RG+  + +       L  L L  + ++P    SGGNKRK+ TA+AL+G P +VFLDEPT GMD  ARRFLW  + ++  E + +V+LTSH+MEECE LC RLAIMV+G  + +GS QHLK +FG  + + +R+ P      D+ E      +  +  A ++E +   + ++     +  L+ +FR          V+++SVSQ +L+EVF+ F+K+       S   A
Sbjct: 1355 SGNWTPESP------SPACQCSQPGARRLLPDCPAGAGGP-PPPQAVAGLGEVVQNLTGRNVSDFLVKTYPSLVRRGLKTKKWVDEVRYGGF-----SLGGRDPDLPTGHEVVRTLAEIRALLSPQPGNALDRILNNLTQWALGLDAR----NSLKIWFNNKGWHAMVAFVNRANNGLLHALLPSGPVRHAHSITTLNHPLNLTKEQLSEATLIASSVDVLVSICVVFAMSFVPASFTLVLIEERITRAKHLQLVSGLPQTLYWLGNFLWDMCNYLVAVCIVVFIFLAFQQRAYVAPENLPALLLLLLLYGWSITPLMYPASFFFSVPSTAYVVLTCINLFIGINSSMATFVLELL--SDQNLQEVSRILKQVFLIFPHFCLGRGLIDMVRNQAMADAFERL------GDKQFQSPLRWDIIGKNL--LAMMAQGPLFLLITLLLQHRNRLLPQSKPRLLPP---LGEEDEDVAQERERVT-KGATQGDVLVLRDLTKVYR--------------------GQRNPAVDRLCLGIPPGECFGLLGVNGAGKTSTFRMVTGDTLPSSGEAVLAGHNVAQERSAAHRSMGYCPQSDAIFDLLTGREHLELFARLRGVPEAQVAQTALSGLVRLGLPSYADRPAGTYSGGNKRKLATALALVGDPAVVFLDEPTTGMDPSARRFLWNSLLSVVREGR-SVVLTSHSMEECEALCTRLAIMVNGRFRCLGSSQHLKGRFGAGHTLTLRVPP------DQPEPAIAFIRITFPGAELREVHGSRLRFQLPPGGRCTLTRVFRELAAQGRAHGVEDFSVSQTTLEEVFLYFSKDQGEEEESSRQEA 2137          

HSP 3 Score: 171.014 bits (432), Expect = 8.992e-42
Identity = 104/339 (30.68%), Postives = 176/339 (51.92%), Query Frame = 2
Query: 2276 ILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISH-KRQEKQ 3289
            +++ +L K +   + PA+D L L     +  G LG NGAGKT+T  ++TG   P+SG A +  +++  +       +G CPQ + +F  LT  +H+  +  L+G+ ++++       +  +GL       +   SGG KRKL+ A+A VG+  ++FLDEPT G+DP +RR +W+ ++      R+++LT+H M+E + LC R+AI+  G+ +C GSS  LK  FG G+ L L    + Q E              + FI+   P ++L +   ++    L      R   T +F +L +      +  + +S T+LEEVFL  + D  +     RQE +
Sbjct: 1815 LVLRDLTKVYRGQRNPAVDRLCLGIPPGECFGLLGVNGAGKTSTFRMVTGDTLPSSGEAVLAGHNVAQERSAAHRSMGYCPQSDAIFDLLTGREHLELFARLRGVPEAQVAQTALSGLVRLGLPSYADRPAGTYSGGNKRKLATALALVGDPAVVFLDEPTTGMDPSARRFLWNSLLSVVREGRSVVLTSHSMEECEALCTRLAIMVNGRFRCLGSSQHLKGRFGAGHTLTLRVPPD-QPEPA------------IAFIRITFPGAELREVHGSRLRFQLPPG--GRCTLTRVFRELAAQGRAHGVEDFSVSQTTLEEVFLYFSKDQGEEEESSRQEAE 2138          

HSP 4 Score: 140.969 bits (354), Expect = 1.160e-32
Identity = 71/217 (32.72%), Postives = 123/217 (56.68%), Query Frame = 1
Query: 5311 AVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKI 5961
            A+  ++    EG     LG NGAGKTTT  +L G    + G+A I G+ +  +      ++G CPQ++ L  +LT EE ++FY R++G+  + +    +  ++++ LT   +  T  +SGG +RK+  AIA +G  ++V +DEPT G+D  +RR +W L+  L       +IL++H+++E E+L  R+A++  G +   GS   L+   G  YY+ +
Sbjct:  820 ALQGLNLDFYEGHITAFLGHNGAGKTTTLSILSGLFPPSSGSASILGHDVQTNMAAIRPHLGICPQYNVLFDMLTVEEHVWFYGRLKGVSAAAMGPERERLIRDVGLTLKRDTQTRHLSGGMQRKLSVAIAFVGGSRVVIMDEPTAGVDPASRRGIWELL--LKYREGRTLILSTHHLDEAELLGDRVAMVAGGSLCCCGSPLFLRRHLGCGYYLTL 1034          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Mouse
Match: Abca4 (ATP-binding cassette, sub-family A (ABC1), member 4 [Source:MGI Symbol;Acc:MGI:109424])

HSP 1 Score: 521.546 bits (1342), Expect = 1.353e-158
Identity = 299/831 (35.98%), Postives = 472/831 (56.80%), Query Frame = 1
Query: 3805 YNTNKWSEKSPIEISLVTPECDCSTTG--NQICSSPL-SGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIM-----------KQYGGLQF--ILPSFFGQSCQVIGESQIWF--DFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNISG--GDE-NYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLH-PNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRNI 6231
            +   KW+   P      +P C CST      +   P  +GG     R   S++ L DL++ NISDYL+K +   I            ++YGG+     LP+       + GE+ + F     Q +N S    +     + L++ +    +  IK     +W N+KG+ ++ ++ N+  N +LR+++   +  + YGI V + PL  T+  L         ++  +AI VIF +SF+PASFV++LI+ERVT +K  Q++SGV+P  YW++NF WD + Y++S  +V+  F+ F  ++Y    N+ A + LL LY  AVIP MYP SF     STA+V +S  NL +G  ++  TF L+L++ ++ +L   N  L+K+ ++FP + LGRG+IDL+ S    ++    G+E + N F+WD+ G  + ++ I  V + L+ + ++  H   L   + +   +P   + DED DV +ER+R+ ++     D+L++  LTK+Y+ S                       AV+ +  GV+ GECFGLLGVNGAGKTTTFKML G+  +T G+A + G SI+      H+NMG+CPQFDA+  LLT  E LY Y R+RG+   +I    +  +++L L+ + ++     SGGNKRK+ TAIAL G P ++ LDEPT GMD  ARR LW  I ++  E + AV+LTSH+MEECE LC RLAIMV G  + +G++QHLK KFG  Y V +++  P  + L D N +E         S + +E +  +++++  SS  L+ IF++    + + +++EYSV+Q +LD+VF+NFAK  + T ++
Sbjct:  265 FQKQKWTAAHP------SPSCKCSTREKLTMLPECPEGAGGLPPPQRTQRSTEVLQDLTNRNISDYLVKTYPALIRSSLKSKFWVNEQRYGGISIGGKLPAI-----PISGEALVGFLSGLGQMMNVSGGPVTREASKEMLDFLKHLETTDNIK-----VWFNNKGWHALVSFLNVAHNAILRASLPRDRDPEEYGITVISQPLNLTKEQLSDITVLTTSVDAVVAICVIFAMSFVPASFVLYLIQERVTKAKHLQFISGVSPTTYWLTNFLWDIMNYAVSAGLVVGIFIGFQKKAYTSPDNLPALVSLLMLYGWAVIPMMYPASFLFEVPSTAYVALSCANLFIGINSSAITFVLELFE-NNRTLLRFNAMLRKLLIVFPHFCLGRGLIDLALSQAVTDVYAQFGEEYSANPFQWDLIGKNLVAMAIEGVVYFLLTLLIQ--HHFFLTRWIAEPAREP---VFDEDDDVAEERQRV-MSGGNKTDILKLNELTKVYSGS--------------------SSPAVDRLCVGVRPGECFGLLGVNGAGKTTTFKMLTGDTTVTSGDATVAGKSILTSISDVHQNMGYCPQFDAIDDLLTGREHLYLYARLRGVPSKEIEKVANWGIQSLGLSLYADRLAGTYSGGNKRKLSTAIALTGCPPLLLLDEPTTGMDPQARRMLWNTIVSIIREGR-AVVLTSHSMEECEALCTRLAIMVKGTFQCLGTIQHLKYKFGDGYIVTMKIKSPKDDLLPDLNPVEQFFQGNFPGSVQ-RERHHSMLQFQVPSS-SLARIFQLLISHKDSLLIEEYSVTQTTLDQVFVNFAKQQTETYDL 1049          

HSP 2 Score: 164.851 bits (416), Expect = 3.139e-40
Identity = 125/429 (29.14%), Postives = 206/429 (48.02%), Query Frame = 2
Query: 1976 AQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQ 3262
            AQF   +++     +  +G  L+ + I+ V Y L+   ++             +F  TR  WI         +  D+  +  + +   G   + D L++      L K +  S +PA+D L +     +  G LG NGAGKTTT  +LTG  T TSG A +    I   +  +   +G CPQ + +   LT  +H+Y Y  L+G+   EI+      ++ +GLS     ++   SGG KRKLS A+A  G   ++ LDEPT G+DP +RR +W+ IV      R ++LT+H M+E + LC R+AI+ +G  +C G+   LK  FGDGY +    + +I+S     +        + +F +   P S   +   +     +  +S  R     +F+ L S  D L I  Y ++ T+L++VF+  A   ++
Sbjct:  650 AQFGEEYSANPFQWDL-IGKNLVAMAIEGVVYFLLTLLIQH------------HFFLTR--WIAEPAREPVFDEDDDVAEERQRVMSGG--NKTDILKL----NELTKVYSGSSSPAVDRLCVGVRPGECFGLLGVNGAGKTTTFKMLTGDTTVTSGDATVAGKSILTSISDVHQNMGYCPQFDAIDDLLTGREHLYLYARLRGVPSKEIEKVANWGIQSLGLSLYADRLAGTYSGGNKRKLSTAIALTGCPPLLLLDEPTTGMDPQARRMLWNTIVSIIREGRAVVLTSHSMEECEALCTRLAIMVKGTFQCLGTIQHLKYKFGDGYIV----TMKIKSP---KDDLLPDLNPVEQFFQGNFPGSVQRERHHSMLQFQVPSSSLAR-----IFQLLISHKDSLLIEEYSVTQTTLDQVFVNFAKQQTE 1045          

HSP 3 Score: 70.0922 bits (170), Expect = 3.971e-11
Identity = 49/177 (27.68%), Postives = 85/177 (48.02%), Query Frame = 2
Query: 3041 LEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQIS-------HKRQE---KQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANINGPK--VSFEFENNLVLL-SGLSLIFQQISGLFIKRFHHTKRNIKGLFSE 3532
            ++ +   +P +KL++    +   +L + +  +  + SLF +L+ +L  L ++S+G+SDT LEE+FLKV +D    S        KR++   +   S   + L      P           T +   ++ PK   S E E+  V   +G  LI Q +  L +KRFHHT R+ K   ++
Sbjct:    1 MDLVYHHVPEAKLVECIGQELIFLLPNKNFKQRAYASLFRELEETLADLGLSSFGISDTPLEEIFLKVTEDAGAGSMFVGGAQQKREQAGLRHPCSAPTEKLRQYAQAPH----------TCSPGQVDPPKGQPSPEPEDPGVPFNTGARLILQHVQALLVKRFHHTIRSRKDFVAQ 167          
BLAST of ATP binding cassette subfamily A member 1 vs. UniProt/SwissProt
Match: sp|P41233|ABCA1_MOUSE (Phospholipid-transporting ATPase ABCA1 OS=Mus musculus OX=10090 GN=Abca1 PE=1 SV=4)

HSP 1 Score: 590.882 bits (1522), Expect = 0.000e+0
Identity = 377/1050 (35.90%), Postives = 569/1050 (54.19%), Query Frame = 2
Query:  617 QNDIDVFLQNFNLSLINSTKSIPTCQLAFMNYFTKSNGLS-VLYPIIGPLVFGKIYYTPNSAFTQEIIRRANSTFRILDNLRLASVEWR-LTFSNW-LINNSTNMGLLNDARNYCAN--------------SRTLMCQIINNSLSIETIQSTIASLSAMF-------VLIENSLNCTQLNKFTPMPSSIDIDNLSKQ--SSLGILAGIVFTDDFQYVTPQNATF---LNYQIRMPASRIDSTKNFKVLDRFWTPIPRVNTLTNFNYYTSGFLFLQEIIDQAFIELITDNASVNIGSSMQIMPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTXXXXXXXXXXXXXXXXXGKXXXXXXXXXXXXXXXXXXXXXXCQCFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGL-SKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFL-EKSFE---------------IQSETCHNNKASESG--------------TKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTI--------NTANINGPKVSFEFENNLVL----------LSGLSLIFQQISGLFIKRFHHTKRNIKGLFSE 3532
            + D+D F  N          + P C     N   +S+ LS +++  + PL+ GKI YTP++  T++++   N TF+ L         W  L+   W  + NS  M L+    +   N              ++ +M  +  N   +++   ++ +    F         I   + C  LNK  P+P+ + + N S +        AGIVFT     +TP +      + Y+IRM    ++ T   K+ D +W P PR +   +  Y   GF +LQ++++QA I ++T  +    G  +Q MPYPCY++D  +  +S  MP  + +AW  +V  +IKSIVYEKE RLKE MR+MG+ N + W SWF S+++ L++   L+ +ILKLG +L +S P ++F+ L  + +  I QCF+IS  F  +N+AA  GGI+YF  YLP+++ + +QD +   +     LL+ V+F     +    E+   G Q+ NLF S + +  F +   + M+  D+  Y ++ WY+EAVFPG+YG+P+PWYF  T+ YW       + I+   +    ++ ++    E+EP  L +G+ I+NLVK +      A+D L L FY+ QIT FLGHNGAGKTTT+SILTG+  PTSGTA+IL  DIR +M  IR  +G+CPQHN+LF  LTVE+HI+FY  LKG+++  +K ++  +  +VGL   KLK  +  LSGGM+RKLS+A+AFVG S+++ LDEPTAGVDP+SRRGIW+L++KYR   RTIIL+THHMDEAD L DRIAIIS GKL C GSSLFLK   G GYYL L +K  E               ++ E   +  +S++G              + +   I+K +  ++L+++   + T VL + +     F  LF ++D  L  L I+SYG+S+T+LEE+FLKVA++                 +D  T  G LP   +  +F  K          +  + N   +  E     +L          L G  L  QQ   L  KR    +R+ KG F++
Sbjct:  340 EEDVDTFYDN---------STTPYCNDLMKNL--ESSPLSRIIWKALKPLLVGKILYTPDTPATRQVMAEVNKTFQELAVFHDLEGMWEELSPQIWTFMENSQEMDLVRTLLDSRGNDQFWEQKLDGLDWTAQDIMAFLAKNPEDVQSPNGSVYTWREAFNETNQAIQTISRFMECVNLNKLEPIPTEVRLINKSMELLDERKFWAGIVFTG----ITPDSVELPHHVKYKIRMDIDNVERTN--KIKDGYWDPGPRADPFEDMRYVWGGFAYLQDVVEQAIIRVLT-GSEKKTGVYVQQMPYPCYVDDIFLRVMSRSMPLFMTLAWIYSVAVIIKSIVYEKEARLKETMRIMGLDNGILWFSWFVSSLIPLLVSAGLLVVILKLGNLLPYSDPSVVFVFLSVFAMVTILQCFLISTLFSRANLAAACGGIIYFTLYLPYVLCVAWQDYVGFSIKIFASLLSPVAFGFGCEYFALFEEQGIGVQWDNLFESPVEEDGFNLTTAVSMMLFDTFLYGVMTWYIEAVFPGQYGIPRPWYFPCTKSYWF-----GEEIDEKSHPGSSQKGVSEICMEEEPTHLRLGVSIQNLVKVYRDGMKVAVDGLALNFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYILGKDIRSEMSSIRQNLGVCPQHNVLFDMLTVEEHIWFYARLKGLSEKHVKAEMEQMALDVGLPPSKLKSKTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYSRRGIWELLLKYRQ-GRTIILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKKDVESSLSSCRNSSSTVSCLKKEDSVSQSSSDAGLGSDHESDTLTIDVSAISNLIRKHVSEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGISETTLEEIFLKVAEESG---------------VDAETSDGTLPARRNRRAFGDKQSCLHPFTEDDAVDPNDSDIDPESRETDLLSGMDGKGSYQLKGWKLTQQQFVALLWKRLLIARRSRKGFFAQ 1350          

HSP 2 Score: 503.056 bits (1294), Expect = 0.000e+0
Identity = 314/908 (34.58%), Postives = 491/908 (54.07%), Query Frame = 1
Query: 3604 PSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCM------NTSLYQLENFKCLYP--------YNTNKWSEKSPIEISLVTPECDCSTTGNQ----ICSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMK-----------QYGGLQFILPSFFGQSCQVIGESQIWFD----FRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNIS---GGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSV-KLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDS 6216
            PS+ + PW+   +       TF   +   D  + +L      D G  G RCM      +T     E    + P        +    W+ K+P      +P C CS+   +    +C     G      R   ++D L +L+  NISDYL+K +   I K           +YGG      S    + Q +  S    D     ++ +  ++D++++    +FL+    F      K N+ ++W N+KG+ ++ ++ N+ +N +LR+ +   +    YGI   N+PL  T+  L         ++V ++I VIF +SF+PASFV+FLI+ERV+ +K  Q++SGV P +YW+SNF WD   Y +   +VI+ F+ F  +SY+ S N+    +LL LY  ++ P MYP SF     STA+VV+++ NL +G   ++ TF L+L+   +  L   ND LK +FLIFP + LGRG+ID+  +    +     G +   +   WD+ G  + ++ +  V + LI V ++ +      I+ + VK K    + DED DV +ER+RI L+    ND+L++  LTKIY                      KRK AV+ I  G+  GECFGLLGVNGAGK+TTFKML G+  +T G+A +N  SI+ +  + H+NMG+CPQFDA+  LLT  E + F+  +RG+   ++    + +++ L L  +  K     SGGNKRK+ TA+ALIG P +VFLDEPT GMD  ARRFLW    ++  E + +V+LTSH+MEECE LC R+AIMV+G  + +GSVQHLK++FG  Y + +R+  +   L    E   +     +  + +KE++  +++Y+  SS+  L+ IF +    +    +++YSVSQ +LD+VF+NFAK+ S
Sbjct: 1375 PSLELQPWMYNEQY------TFVSNDAPEDMGTQELLNALTKDPG-FGTRCMEGNPIPDTPCLAGEEDWTISPVPQSIVDLFQNGNWTMKNP------SPACQCSSDKIKKMLPVCPPGAGGL-PPPQRKQKTADILQNLTGRNISDYLVKTYVQIIAKSLKNKIWVNEFRYGGF-----SLGVSNSQALPPSHEVNDAIKQMKKLLKLTKDSSAD----RFLSSLGRFMAGLDTKNNV-KVWFNNKGWHAISSFLNVINNAILRANLQKGENPSQYGITAFNHPLNLTKQQLSEVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVSKAKHLQFISGVKPVIYWLSNFVWDMCNYVVPATLVIIIFICFQQKSYVSSTNLPVLALLLLLYGWSITPLMYPASFVFKIPSTAYVVLTSVNLFIGINGSVATFVLELFT--NNKLNDINDILKSVFLIFPHFCLGRGLIDMVKNQAMADALERFGENRFVSPLSWDLVGRNLFAMAVEGVVFFLITVLIQYR----FFIRPRPVKAK-LPPLNDEDEDVRRERQRI-LDGGGQNDILEIKELTKIY--------------------RRKRKPAVDRICIGIPPGECFGLLGVNGAGKSTTFKMLTGDTPVTRGDAFLNKNSILSNIHEVHQNMGYCPQFDAITELLTGREHVEFFALLRGVPEKEVGKVGEWAIRKLGLVKYGEKYASNYSGGNKRKLSTAMALIGGPPVVFLDEPTTGMDPKARRFLWNCALSIVKEGR-SVVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGYTIVVRIAGSNPDLKPVQEFFGL----AFPGSVLKEKHRNMLQYQLPSSLSSLARIFSILSQSKKRLHIEDYSVSQTTLDQVFVNFAKDQS 2225          

HSP 3 Score: 185.652 bits (470), Expect = 2.697e-45
Identity = 128/417 (30.70%), Postives = 211/417 (50.60%), Query Frame = 2
Query: 2027 VGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKT--QWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISH 3271
            VG  L  + ++ V + LI   ++  F   +  P+P      +    P +  ++++       +RE    +DG  +  D LEI    + L K + + + PA+D + +     +  G LG NGAGK+TT  +LTG    T G AF+  N I  ++  +   +G CPQ + +   LT  +H+ F+ LL+G+ + E+       ++++GL K  +  + N SGG KRKLS AMA +G   ++FLDEPT G+DP +RR +W+  +      R+++LT+H M+E + LC R+AI+  G+ +C GS   LK  FGDGY + +  +            ++     + EF     P S L ++ +   Q+ +  S +S  R     +F  L  S   L I  Y +S T+L++VF+  A D S   H
Sbjct: 1849 VGRNLFAMAVEGVVFFLITVLIQYRF---FIRPRP-----VKAKLPPLNDEDEDV-------RRERQRILDGGGQN-DILEI----KELTKIYRRKRKPAVDRICIGIPPGECFGLLGVNGAGKSTTFKMLTGDTPVTRGDAFLNKNSILSNIHEVHQNMGYCPQFDAITELLTGREHVEFFALLRGVPEKEVGKVGEWAIRKLGLVKYGEKYASNYSGGNKRKLSTAMALIGGPPVVFLDEPTTGMDPKARRFLWNCALSIVKEGRSVVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGYTIVVRIA-----------GSNPDLKPVQEFFGLAFPGSVLKEKHRNMLQYQLPSSLSSLAR-----IFSILSQSKKRLHIEDYSVSQTTLDQVFVNFAKDQSDDDH 2229          

HSP 4 Score: 162.155 bits (409), Expect = 3.150e-38
Identity = 103/360 (28.61%), Postives = 171/360 (47.50%), Query Frame = 1
Query: 5293 EDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNK-PTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKI--------------------------------------RLHPNRNSLSDRNEIETIINKEIWSSARMKE----ENAVIIEYRFDSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRNISNGN 6243
             D  K+AV+ ++    EG+    LG NGAGKTTT  +L G    T G A I G  I  +     +N+G CPQ + L  +LT EE ++FY R++G+    +   ++    ++ L P   K  T  +SGG +RK+  A+A +G  K+V LDEPT G+D  +RR +W L+  L       +IL++H+M+E ++L  R+AI+  G++  +GS   LK++ G  YY+ +                                        H +     D + I  +I K + S AR+ E    E   ++ Y         ++F   +D  ++  +  Y +S+ +L+E+F+  A+   V    S+G 
Sbjct:  909 RDGMKVAVDGLALNFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYILGKDIRSEMSSIRQNLGVCPQHNVLFDMLTVEEHIWFYARLKGLSEKHVKAEMEQMALDVGLPPSKLKSKTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYSRRGIWELL--LKYRQGRTIILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKKDVESSLSSCRNSSSTVSCLKKEDSVSQSSSDAGLGSDHESDTLTIDVSAISNLIRKHV-SEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGISETTLEEIFLKVAEESGVDAETSDGT 1265          
BLAST of ATP binding cassette subfamily A member 1 vs. UniProt/SwissProt
Match: sp|O95477|ABCA1_HUMAN (Phospholipid-transporting ATPase ABCA1 OS=Homo sapiens OX=9606 GN=ABCA1 PE=1 SV=3)

HSP 1 Score: 584.334 bits (1505), Expect = 0.000e+0
Identity = 371/1009 (36.77%), Postives = 554/1009 (54.91%), Query Frame = 2
Query:  737 VLYPIIGPLVFGKIYYTPNSAFTQEIIRRANSTFRILDNLRLASVEWR-LTFSNW-LINNSTNMGLLN----------------DARNYCANSRTLMC-----QIINNSLSIETIQSTIASLSAMFVLIENSLNCTQLNKFTPMPSSIDIDNLSKQ--SSLGILAGIVFTDDFQYVTPQNATF---LNYQIRMPASRIDSTKNFKVLDRFWTPIPRVNTLTNFNYYTSGFLFLQEIIDQAFIELITDNASVNIGSSMQIMPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTXXXXXXXXXXXXXXXXXGKXXXXXXXXXXXXXXXXXXXXXXCQCFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGL-SKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFL-EKSFE---------------IQSETCHNNKASESG--------------TKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTI--------NTANINGPKVSFEFENNLVL----------LSGLSLIFQQISGLFIKRFHHTKRNIKGLFSE 3532
            +++  + PL+ GKI YTP++  T++++   N TF+ L         W  L+   W  + NS  M L+                 D  ++ A             + +++ S+ T +      +     I   + C  LNK  P+ + + + N S +        AGIVFT     +TP +      + Y+IRM    ++ T   K+ D +W P PR +   +  Y   GF +LQ++++QA I ++T       G  MQ MPYPCY++D  +  +S  MP  + +AW  +V  +IK IVYEKE RLKE MR+MG+ N + W SWF S+++ L++   L+ +ILKLG +L +S P ++F+ L  + V  I QCF+IS  F  +N+AA  GGI+YF  YLP+++ + +QD +   +     LL+ V+F     +    E+   G Q+ NLF S + +  F +   + M+  D+  Y ++ WY+EAVFPG+YG+P+PWYF  T+ YW  F + +D      + ++R   I +   E+EP  L++G+ I+NLVK +      A+D L L FY+ QIT FLGHNGAGKTTT+SILTG+  PTSGTA+IL  DIR +M  IR  +G+CPQHN+LF  LTVE+HI+FY  LKG+++  +K ++  +  +VGL S KLK  +  LSGGM+RKLS+A+AFVG S+++ LDEPTAGVDP+SRRGIW+L++KYR   RTIIL+THHMDEAD L DRIAIIS GKL C GSSLFLK   G GYYL L +K  E               ++ E   +  +S++G              + +   I+K +  ++L+++   + T VL + +     F  LF ++D  L  L I+SYG+S+T+LEE+FLKVA++                 +D  T  G LP   +  +F  K          + A+ N   +  E     +L          + G  L  QQ   L  KR    +R+ KG F++
Sbjct:  370 IIWKALKPLLVGKILYTPDTPATRQVMAEVNKTFQELAVFHDLEGMWEELSPKIWTFMENSQEMDLVRMLLDSRDNDHFWEQQLDGLDWTAQDIVAFLAKHPEDVQSSNGSVYTWREAFNETNQAIRTISRFMECVNLNKLEPIATEVWLINKSMELLDERKFWAGIVFTG----ITPGSIELPHHVKYKIRMDIDNVERTN--KIKDGYWDPGPRADPFEDMRYVWGGFAYLQDVVEQAIIRVLTGTEK-KTGVYMQQMPYPCYVDDIFLRVMSRSMPLFMTLAWIYSVAVIIKGIVYEKEARLKETMRIMGLDNSILWFSWFISSLIPLLVSAGLLVVILKLGNLLPYSDPSVVFVFLSVFAVVTILQCFLISTLFSRANLAAACGGIIYFTLYLPYVLCVAWQDYVGFTLKIFASLLSPVAFGFGCEYFALFEEQGIGVQWDNLFESPVEEDGFNLTTSVSMMLFDTFLYGVMTWYIEAVFPGQYGIPRPWYFPCTKSYW--FGEESDEKSHPGSNQKRISEICM---EEEPTHLKLGVSIQNLVKVYRDGMKVAVDGLALNFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYILGKDIRSEMSTIRQNLGVCPQHNVLFDMLTVEEHIWFYARLKGLSEKHVKAEMEQMALDVGLPSSKLKSKTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYSRRGIWELLLKYRQ-GRTIILSTHHMDEADVLGDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKKDVESSLSSCRNSSSTVSYLKKEDSVSQSSSDAGLGSDHESDTLTIDVSAISNLIRKHVSEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGISETTLEEIFLKVAEESG---------------VDAETSDGTLPARRNRRAFGDKQSCLRPFTEDDAADPNDSDIDPESRETDLLSGMDGKGSYQVKGWKLTQQQFVALLWKRLLIARRSRKGFFAQ 1350          

HSP 2 Score: 507.679 bits (1306), Expect = 0.000e+0
Identity = 314/908 (34.58%), Postives = 494/908 (54.41%), Query Frame = 1
Query: 3604 PSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCM------NTSLYQLENFKCLYP--------YNTNKWSEKSPIEISLVTPECDCSTTGNQ----ICSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMK-----------QYGGLQFILPSFFGQSCQVIGESQIWFD----FRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNIS---GGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSV-KLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDS 6216
            PS+ + PW+   +       TF   +   D  + +L      D G  G RCM      +T     E      P        +    W+ ++P      +P C CS+   +    +C     G      R   ++D L DL+  NISDYL+K +   I K           +YGG      S    + Q +  SQ   D     ++ +  ++D++++    +FLN    F      K N+ ++W N+KG+ ++ ++ N+ +N +LR+ +   +   +YGI   N+PL  T+  L         ++V ++I VIF +SF+PASFV+FLI+ERV+ +K  Q++SGV P +YW+SNF WD   Y +   +VI+ F+ F  +SY+ S N+    +LL LY  ++ P MYP SF     STA+VV+++ NL +G   ++ TF L+L+   D  L + ND LK +FLIFP + LGRG+ID+  +    +     G +   +   WD+ G  + ++ +  V + LI V ++  ++  +  +  + KL P   + DED DV +ER+RI L+    ND+L++  LTKIY                      KRK AV+ I  G+  GECFGLLGVNGAGK++TFKML G+  +T G+A +N  SI+ +  + H+NMG+CPQFDA+  LLT  E + F+  +RG+   ++    + +++ L L  +  K     SGGNKRK+ TA+ALIG P +VFLDEPT GMD  ARRFLW    ++  E + +V+LTSH+MEECE LC R+AIMV+G  + +GSVQHLK++FG  Y + +R+  +   L    +   +     +  + +KE++  +++Y+  SS+  L+ IF +    +    +++YSVSQ +LD+VF+NFAK+ S
Sbjct: 1375 PSLELQPWMYNEQY------TFVSNDAPEDTGTLELLNALTKDPG-FGTRCMEGNPIPDTPCQAGEEEWTTAPVPQTIMDLFQNGNWTMQNP------SPACQCSSDKIKKMLPVCPPGAGGL-PPPQRKQNTADILQDLTGRNISDYLVKTYVQIIAKSLKNKIWVNEFRYGGF-----SLGVSNTQALPPSQEVNDAIKQMKKHLKLAKDSSAD----RFLNSLGRFMTGLDTKNNV-KVWFNNKGWHAISSFLNVINNAILRANLQKGENPSHYGITAFNHPLNLTKQQLSEVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVSKAKHLQFISGVKPVIYWLSNFVWDMCNYVVPATLVIIIFICFQQKSYVSSTNLPVLALLLLLYGWSITPLMYPASFVFKIPSTAYVVLTSVNLFIGINGSVATFVLELFT--DNKLNNINDILKSVFLIFPHFCLGRGLIDMVKNQAMADALERFGENRFVSPLSWDLVGRNLFAMAVEGVVFFLITVLIQ--YRFFIRPRPVNAKLSP---LNDEDEDVRRERQRI-LDGGGQNDILEIKELTKIY--------------------RRKRKPAVDRICVGIPPGECFGLLGVNGAGKSSTFKMLTGDTTVTRGDAFLNKNSILSNIHEVHQNMGYCPQFDAITELLTGREHVEFFALLRGVPEKEVGKVGEWAIRKLGLVKYGEKYAGNYSGGNKRKLSTAMALIGGPPVVFLDEPTTGMDPKARRFLWNCALSVVKEGR-SVVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGYTIVVRIAGSNPDLKPVQDFFGL----AFPGSVLKEKHRNMLQYQLPSSLSSLARIFSILSQSKKRLHIEDYSVSQTTLDQVFVNFAKDQS 2225          

HSP 3 Score: 182.57 bits (462), Expect = 1.891e-44
Identity = 131/417 (31.41%), Postives = 208/417 (49.88%), Query Frame = 2
Query: 2027 VGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKT--QWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISH 3271
            VG  L  + ++ V + LI   ++  F           F+  R      S  ND  E     RQR     +DG  +  D LEI    + L K + + + PA+D + +     +  G LG NGAGK++T  +LTG  T T G AF+  N I  ++  +   +G CPQ + +   LT  +H+ F+ LL+G+ + E+       ++++GL K  +  + N SGG KRKLS AMA +G   ++FLDEPT G+DP +RR +W+  +      R+++LT+H M+E + LC R+AI+  G+ +C GS   LK  FGDGY + +  +            ++     + +F     P S L ++ +   Q+ +  S +S  R     +F  L  S   L I  Y +S T+L++VF+  A D S   H
Sbjct: 1849 VGRNLFAMAVEGVVFFLITVLIQYRF-----------FIRPRPVNAKLSPLNDEDEDVRRERQR----ILDGGGQN-DILEI----KELTKIYRRKRKPAVDRICVGIPPGECFGLLGVNGAGKSSTFKMLTGDTTVTRGDAFLNKNSILSNIHEVHQNMGYCPQFDAITELLTGREHVEFFALLRGVPEKEVGKVGEWAIRKLGLVKYGEKYAGNYSGGNKRKLSTAMALIGGPPVVFLDEPTTGMDPKARRFLWNCALSVVKEGRSVVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGYTIVVRIA-----------GSNPDLKPVQDFFGLAFPGSVLKEKHRNMLQYQLPSSLSSLAR-----IFSILSQSKKRLHIEDYSVSQTTLDQVFVNFAKDQSDDDH 2229          

HSP 4 Score: 159.458 bits (402), Expect = 2.010e-37
Identity = 102/360 (28.33%), Postives = 170/360 (47.22%), Query Frame = 1
Query: 5293 EDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSL-TPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKI--------------------------------------RLHPNRNSLSDRNEIETIINKEIWSSARMKE----ENAVIIEYRFDSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRNISNGN 6243
             D  K+AV+ ++    EG+    LG NGAGKTTT  +L G    T G A I G  I  +     +N+G CPQ + L  +LT EE ++FY R++G+    +   ++    ++ L +      T  +SGG +RK+  A+A +G  K+V LDEPT G+D  +RR +W L+  L       +IL++H+M+E +VL  R+AI+  G++  +GS   LK++ G  YY+ +                                        H +     D + I  +I K + S AR+ E    E   ++ Y         ++F   +D  ++  +  Y +S+ +L+E+F+  A+   V    S+G 
Sbjct:  909 RDGMKVAVDGLALNFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYILGKDIRSEMSTIRQNLGVCPQHNVLFDMLTVEEHIWFYARLKGLSEKHVKAEMEQMALDVGLPSSKLKSKTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYSRRGIWELL--LKYRQGRTIILSTHHMDEADVLGDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKKDVESSLSSCRNSSSTVSYLKKEDSVSQSSSDAGLGSDHESDTLTIDVSAISNLIRKHV-SEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGISETTLEEIFLKVAEESGVDAETSDGT 1265          
BLAST of ATP binding cassette subfamily A member 1 vs. UniProt/SwissProt
Match: sp|Q7TNJ2|ABCA7_RAT (ATP-binding cassette sub-family A member 7 OS=Rattus norvegicus OX=10116 GN=Abca7 PE=1 SV=1)

HSP 1 Score: 580.867 bits (1496), Expect = 2.112e-170
Identity = 391/1256 (31.13%), Postives = 636/1256 (50.64%), Query Frame = 2
Query:  143 PFSLIIEMLIPLFVIFILVAVRRITSSYSMGTCELREKQMGSMGPIPFLRDFICTFNTSCYNTTQIDWTKNSINDFLTFMNNISSLYSSLYTT-------------NFTVP-----GFVDWSN-----VNPNLYTQLLNSI---NYISPVISSFITSIKEMQTGDQTLINK----------------------NLKILGQLLCGS--------------DQNDIDVFL-QNFNLSLINSTKSIPTCQLAFMNYFTKSNGLSVLYPIIGPLVFGKIYYTPNSAFTQEIIRRANSTFRILDNLRLASVEWRLTFSNWL--INNSTNMGLLN---DARNYCANSRTLMCQ--------IINNSLSIETIQSTIASLSAMFVLIENSLNCTQLNKFTPMPS-----SIDIDNLSKQSSLGILAGIVFT------DDFQYVTPQNATFLNYQIRMPASRIDSTKNFKVLDRFWTPIPRVNTLTNFNYYTSGFLFLQEIIDQAFIELITDNASVNIGSSMQIMPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTXXXXXXXXXXXXXXXXXGKXXXXXXXXXXXXXXXXXXXXXXCQCFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKS------FEIQSETCHNNKASESGTK---------------------------------LLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANINGPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGLFSE 3532
            P  L++E+L PLF+ FILVAVR          C    K + S G +P+L+  +C  N SC+           +++F   +  IS L +  +T                 +P     G   W             T+LL  I     +  V+     S+++     +T+  +                      +L+++ + LC +              + N I+ F+      +L +S+ S P C   F+          +L+  + PL+ GKI + P++ FT++++ + N TF  L  LR     W +        +N+STN+ +L    D        +T   Q         ++ S      Q   A +  +  ++   L C  L+K   +PS     S  ++ L ++    + AGIVF       D  +  +P      + ++++     D T+  K+ D+FW P P  + L +  Y   GF++LQ++++QA + +++   S   G  +Q MP+PCY++D  +  LS  +P  L +AW  +V   +K++V EKE RL+E MR MG+S  V W+ WF S +   ++   L+ ++LKLG IL +S P+++FL L  + V+ + Q F++S FF  +N+AA  GG+ YF  YLP+++ + +++ L       V LL+ V+F      +  LE+  DGAQ+ NL      D+ F +      + +D+V Y L  WY+EAV PG+YG+P+PW F F R YW        ++        ++  + +   E+ P  L  G+ I  L K F  S  PAL  LNL FY+  IT FLGHNGAGKTTT+SIL+G+  P+SG+A IL +D++ +M  IR  +G+CPQ+N+LF  LTVE+H++FYG LKG++ + I  +   ++++VGL  K    +++LSGGM+RKLS+A+AFVG SR++ +DEPTAGVDP SRRGIW+L++KYR   RT+IL+THH+DEA+ L DR+A+++ G L CCGS LFL+++ G GYYL L KS       +++ +T    +  +SG++                                 +LE +++ +P ++L++E   +  + L +       F ++F++LD  L+ L +  YG+SDT+LEE+FLKV ++          +Q   + L T T   +     SVL   +      +   PK S         + G +L  QQ+  L  KRF   +R+ +GLF++
Sbjct:   22 PIQLVVELLWPLFLFFILVAVRHSHPPLEHHECHFPNKPLPSAGTVPWLQGLVCNVNNSCFQHPTPGEKPGVLSNFKDSL--ISRLLADAHTVLGGHSTQDMLAALGKLIPVLRAVGSGAWPQESNQPAKQGSVTELLEKILQRASLETVLGQAQDSMRKFSDATRTVAQELLTLPSLVELRALLRRPRGSAGSLELISEALCSTKGPSSPGGLSLNWYEANQINEFMGPELAPTLPDSSLS-PACS-EFVGALDDHPVSRLLWRRLKPLILGKILFAPDTNFTRKLMAQVNQTFEELALLRDLHELWGVLGPQIFNFMNDSTNVAMLQKLLDVEGTGWQQQTPKGQKQLEAIRDFLDPSRGRYNWQEAHADMGRLAEILGQILECVSLDKLEAVPSEEALVSRALELLGERR---LWAGIVFLSPEHPLDSSEPPSPTTTGPGHLRVKIRMDIDDVTRTNKIRDKFWDPGPSADPLMDLRYVWGGFVYLQDLLEQAAVRVLSGRDS-RAGLYLQQMPHPCYVDDVFLRVLSRSLPLFLTLAWIYSVALTVKAVVREKETRLRETMRAMGLSRAVLWLGWFLSCLGPFLVSAALLVLVLKLGNILPYSHPVVVFLFLAAFAVATVAQSFLLSAFFSRANLAAACGGLAYFALYLPYVLCVAWRERLPLGGLLAVSLLSPVAFGFGCESLALLEEQGDGAQWHNLGTGPAEDV-FSLAQVSAFLLLDAVIYGLALWYLEAVCPGQYGIPEPWNFPFRRSYWCGPGPPKSSVLAPA---PQDPKVLV---EEPPPGLVPGVSIRGLKKHFRGSPQPALRGLNLDFYEGHITAFLGHNGAGKTTTLSILSGLFPPSSGSASILGHDVQTNMAAIRPHLGICPQYNVLFDMLTVEEHVWFYGRLKGVSAAAIDSEQEHLIRDVGLIPKRDTQTRHLSGGMQRKLSVAIAFVGGSRVVIMDEPTAGVDPASRRGIWELLLKYRE-GRTLILSTHHLDEAELLGDRVAMVASGSLCCCGSPLFLRRHLGCGYYLTLVKSSQSLVTHDLKGDTEDPRREKKSGSEGKTADTVLTRDGPHRSSQVPAPDAVPVTPSAALILELVQRHVPGAQLVEELPHELVLALPYAGALDGSFATVFQELDQQLERLGLTGYGISDTNLEEIFLKVVEEAHAHGEGGDPRQ--QQHLLTATPQPHTGPEASVLENGELAKLVLDPQAPKGS---APTTAQVQGWTLTCQQLRALLHKRFLLARRSRRGLFAQ 1256          

HSP 2 Score: 460.299 bits (1183), Expect = 3.138e-130
Identity = 279/827 (33.74%), Postives = 449/827 (54.29%), Query Frame = 1
Query: 3811 TNKWSEKSPIEISLVTPECDCSTTGNQ--ICSSPLSGGPESSNRIMAS-SDRLYDLSSYNISDYLMKNFKTFIMK-----------QYGGLQFILPSFFGQSCQVIGESQIWFDFRQ--SINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDL--------SFSYLRYNISGGDENYNA-FEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFD--SSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKN 6210
            +  W+  SP      +P C CS  G +  +   P   G     + MA   + + +L+  N+SD+L+K + + + +           +YGG      S  G+   +    ++     +  ++ S +  N+    +  L  + L  ++     N  +IW N+KG+ +M A+ N  +N LLR+ + +      + I   N+PL  T+  L         ++V ++I V+F +SF+PASF + LIEER+T +K  Q VSG+   +YW+ NF WD   Y ++V IV+L FLAF  ++Y+  +N+ A ++LL LY  ++ P MYP SFF S  STA+VV++  NL +G  +++ TF L+L    D +L+  +  LK++FLIFP + LGRG+ID+        +F  L      GD+ + +   WDI G  +  L ++  G   +++ +  +H+  L  + K  +L P   + +ED DV +ERER+        DVL +  LTK+Y                      +R  AV+++  G+  GECFGLLGVNGAGKT+TF+M+ G+   + G A++ G+++  +   AH++MG+CPQ DA+  LLT  E L  + R+RG+  + +       L  L L  + ++P    SGGNKRK+ TA+AL+G P +VFLDEPT GMD  ARRFLW  + ++  E + +V+LTSH+MEECE LC RLAIMV+G  + +GS QHLKS+FG  + + +R+ P      D+ E         +  A ++E +   + ++        L+ +FR          V+++SVSQ +L+EVF+ F+K+
Sbjct: 1358 SGNWTPDSP------SPACQCSQPGARRLLPDCPAGAGGPPPPQAMAGFGEVVQNLTGRNVSDFLVKTYPSLVRRGLKTKKWVDEVRYGGF-----SLGGRDPDLPSGREVVRTVAEMRALLSPQPGNTLDRILNNLTQWALGLDAR----NSLKIWFNNKGWHAMVAFVNRANNGLLRAFLPSGSVRHAHSITTLNHPLNLTKEQLSEATLIASSVDVLVSICVVFAMSFVPASFTLVLIEERITRAKHLQLVSGLPQTLYWLGNFLWDMCNYLVAVCIVVLIFLAFQQKAYVAPENLPALLLLLLLYGWSITPLMYPASFFFSVPSTAYVVLTCINLFIGINSSMATFVLEL--LSDQNLQEVSRILKQVFLIFPHFCLGRGLIDMVRNQAMADAFERL------GDKQFQSPLRWDIIGKNL--LAMVAQGPLFLLITLLLQHRNRLLPQPKS-RLPPP--LGEEDEDVVRERERVT-KGATQGDVLVLRDLTKVYR--------------------GQRSPAVDHLCLGIPPGECFGLLGVNGAGKTSTFRMVTGDTLPSSGEAVLAGHNVAQEPSAAHRSMGYCPQSDAIFDLLTGREHLELFARLRGVPEAQVAQTALSGLVRLGLPSYADRPAGTYSGGNKRKLATALALVGDPAVVFLDEPTTGMDPSARRFLWNNLLSVVREGR-SVVLTSHSMEECEALCTRLAIMVNGRFRCLGSAQHLKSRFGAGHTLTLRVPP------DQPEPAIAFIVTTFPDAELREVHGSRLRFQLPPGGGCTLARVFRELAAQGKAHGVEDFSVSQTTLEEVFLYFSKD 2128          

HSP 3 Score: 165.236 bits (417), Expect = 4.186e-39
Identity = 98/328 (29.88%), Postives = 174/328 (53.05%), Query Frame = 2
Query: 2276 ILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKL--IDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADD 3253
            +++ +L K +   ++PA+D+L L     +  G LG NGAGKT+T  ++TG   P+SG A +  +++  +       +G CPQ + +F  LT  +H+  +  L+G+ ++++       +  +GL       +   SGG KRKL+ A+A VG+  ++FLDEPT G+DP +RR +W+ ++      R+++LT+H M+E + LC R+AI+  G+ +C GS+  LK  FG G+ L L    + Q E              + FI    P+++L  +  ++ ++ +      T       +F +L +      +  + +S T+LEEVFL  + D
Sbjct: 1818 LVLRDLTKVYRGQRSPAVDHLCLGIPPGECFGLLGVNGAGKTSTFRMVTGDTLPSSGEAVLAGHNVAQEPSAAHRSMGYCPQSDAIFDLLTGREHLELFARLRGVPEAQVAQTALSGLVRLGLPSYADRPAGTYSGGNKRKLATALALVGDPAVVFLDEPTTGMDPSARRFLWNNLLSVVREGRSVVLTSHSMEECEALCTRLAIMVNGRFRCLGSAQHLKSRFGAGHTLTLRVPPD-QPEPA------------IAFIVTTFPDAELREVHGSRLRFQLPPGGGCT----LARVFRELAAQGKAHGVEDFSVSQTTLEEVFLYFSKD 2128          

HSP 4 Score: 144.436 bits (363), Expect = 7.620e-33
Identity = 72/217 (33.18%), Postives = 123/217 (56.68%), Query Frame = 1
Query: 5311 AVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKI 5961
            A+  ++    EG     LG NGAGKTTT  +L G    + G+A I G+ +  +      ++G CPQ++ L  +LT EE ++FY R++G+  + I    +  ++++ L P  +  T  +SGG +RK+  AIA +G  ++V +DEPT G+D  +RR +W L+  L       +IL++H+++E E+L  R+A++  G +   GS   L+   G  YY+ +
Sbjct:  821 ALRGLNLDFYEGHITAFLGHNGAGKTTTLSILSGLFPPSSGSASILGHDVQTNMAAIRPHLGICPQYNVLFDMLTVEEHVWFYGRLKGVSAAAIDSEQEHLIRDVGLIPKRDTQTRHLSGGMQRKLSVAIAFVGGSRVVIMDEPTAGVDPASRRGIWELL--LKYREGRTLILSTHHLDEAELLGDRVAMVASGSLCCCGSPLFLRRHLGCGYYLTL 1035          
BLAST of ATP binding cassette subfamily A member 1 vs. UniProt/SwissProt
Match: sp|Q8IZY2|ABCA7_HUMAN (Phospholipid-transporting ATPase ABCA7 OS=Homo sapiens OX=9606 GN=ABCA7 PE=1 SV=3)

HSP 1 Score: 570.466 bits (1469), Expect = 6.177e-167
Identity = 340/979 (34.73%), Postives = 547/979 (55.87%), Query Frame = 2
Query:  737 VLYPIIGPLVFGKIYYTPNSAFTQEIIRRANSTFRILDNLRLASVEWRLTFSN--WLINNSTNMGLLN--------DARNYCANSRTLMCQI---INNSLSIETIQSTIASLSAMFVLIENSLNCTQLNKFTPMPSSIDIDNLSKQ--SSLGILAGIVF------TDDFQYVTPQ-NATFLNYQIRMPASRIDSTKNFKVLDRFWTPIPRVNTLTNFNYYTSGFLFLQEIIDQAFIELITDNASVNIGSSMQIMPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTXXXXXXXXXXXXXXXXXGKXXXXXXXXXXXXXXXXXXXXXXCQCFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFL-----------------EKSFEIQSETCHNNKASESGT-KLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANINGPKVSFEFENN-------LVLLSGLSLIFQQISGLFIKRFHHTKRNIKGLFSE 3532
            +L+  + PL+ GK+ + P++ FT++++ + N TF  L  LR     W +        +N+S+N+ +L           R      R  M  +   ++      + Q   A +  +   +     C  L+K    PS   + + + Q  +     AG+VF      +D  ++ TP      +  +IRM    +  T+  K+ DRFW P P  + LT+  Y   GF++LQ+++++A + +++  A+   G  +Q MPYPCY++D  +  LS  +P  L +AW  +VT  +K++V EKE RL++ MR MG+S  V W+ WF S +   +L   L+ ++LKLG IL +S P ++FL L  + V+ + Q F++S FF  +N+AA  GG+ YF  YLP+++ + ++D L         LL+ V+F      +  LE+  +GAQ+ N+      D+ F +     ++ +D+  Y L  WY+EAV PG+YG+P+PW F F R YW                   +  + +   E+ P  L  G+ + +L K+FP S  PAL  L+L FYQ  IT FLGHNGAGKTTT+SIL+G+  P+ G+AFIL +D+R  M  IR  +G+CPQ+N+LF  LTV++H++FYG LKG++ + +  +   ++++VGL  K    +++LSGGM+RKLS+A+AFVG S+++ LDEPTAGVDP SRRGIW+L++KYR   RT+IL+THH+DEA+ L DR+A+++ G+L CCGS LFL+++ G GYYL L                 E S + + E  + ++ S  GT +LL  ++  +P ++L++E   +  +VL +   +   F +LF +LD+ L  L++  YG+SDTSLEE+FLKV ++ +  +    E     + L T   G ++      L  +     TA  NG       E +       +  + G +L  QQ+  L +KRF   +R+ +GLF++
Sbjct:  282 LLWRRLKPLILGKLLFAPDTPFTRKLMAQVNRTFEELTLLRDVREVWEMLGPRIFTFMNDSSNVAMLQRLLQMQDEGRRQPRPGGRDHMEALRSFLDPGSGGYSWQDAHADVGHLVGTLGRVTECLSLDKLEAAPSEAALVSRALQLLAEHRFWAGVVFLGPEDSSDPTEHPTPDLGPGHVRIKIRMDIDVV--TRTNKIRDRFWDPGPAADPLTDLRYVWGGFVYLQDLVERAAVRVLS-GANPRAGLYLQQMPYPCYVDDVFLRVLSRSLPLFLTLAWIYSVTLTVKAVVREKETRLRDTMRAMGLSRAVLWLGWFLSCLGPFLLSAALLVLVLKLGDILPYSHPGVVFLFLAAFAVATVTQSFLLSAFFSRANLAAACGGLAYFSLYLPYVLCVAWRDRLPAGGRVAASLLSPVAFGFGCESLALLEEQGEGAQWHNVGTRPTADV-FSLAQVSGLLLLDAALYGLATWYLEAVCPGQYGIPEPWNFPFRRSYWCGPRPPKSPAPCPTPL---DPKVLV---EEAPPGLSPGVSVRSLEKRFPGSPQPALRGLSLDFYQGHITAFLGHNGAGKTTTLSILSGLFPPSGGSAFILGHDVRSSMAAIRPHLGVCPQYNVLFDMLTVDEHVWFYGRLKGLSAAVVGPEQDRLLQDVGLVSKQSVQTRHLSGGMQRKLSVAIAFVGGSQVVILDEPTAGVDPASRRGIWELLLKYRE-GRTLILSTHHLDEAELLGDRVAVVAGGRLCCCGSPLFLRRHLGSGYYLTLVKARLPLTTNEKADTDMEGSVDTRQEKKNGSQGSRVGTPQLLALVQHWVPGARLVEELPHELVLVLPYTGAHDGSFATLFRELDTRLAELRLTGYGISDTSLEEIFLKVVEECA--ADTDMEDGSCGQHLCTGIAGLDV-----TLRLKMPPQETALENGEPAGSAPETDQGSGPDAVGRVQGWALTRQQLQALLLKRFLLARRSRRGLFAQ 1242          

HSP 2 Score: 453.751 bits (1166), Expect = 4.320e-128
Identity = 275/831 (33.09%), Postives = 440/831 (52.95%), Query Frame = 1
Query: 3811 TNKWSEKSPIEISLVTPECDCSTTGNQI----CSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMK-----------QYGGLQFILPSFFGQSCQVIGES--QIWFDFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDL--------SFSYLRYNISGGDENYNA-FEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLSDIFRVFEDLRTN---EMVKEYSVSQMSLDEVFINFAKNDS 6216
            +  W+ +SP      +P C CS  G +     C +   G       +  S + + +L+  N+SD+L+K +   + +           +YGG           S Q +G S  ++W         + D        + L     + +S   + +L +IW N+KG+ SM A+ N  SN +LR+ +    A   + I   N+PL  T+  L         ++V ++I V+F +SF+PASF + LIEERVT +K  Q + G++P +YW+ NF WD   Y +   IV+L FLAF  ++Y+   N+ A ++LL LY  ++ P MYP SFF S  STA+VV++  NL +G   ++ TF L+L  + D  L+  +  LK++FLIFP + LGRG+ID+        +F  L      GD  + +   W++ G  +  L ++  G   ++  +  +H+  L   L   +++   ++ +ED DV +ERER+ +      DVL +  LTK+Y                      +R  AV+ +  G+  GECFGLLGVNGAGKT+TF+M+ G+   + G A++ G+S+  +   AH +MG+CPQ DA+  LLT  E L    R+RG+  + +       L  L L+ + ++P    SGGNKRK+ TA+AL+G P +VFLDEPT GMD  ARRFLW  +  +  E + +V+LTSH+MEECE LC RLAIMV+G  + +GS QHLK +F   + + +R+       + R++         +  A ++E +   + ++     + + + RVF +L  +     V+++SVSQ  L+EVF+ F+K+  
Sbjct: 1333 SGNWTPESP------SPACQCSRPGARRLLPDCPAAAGGP-PPPQAVTGSGEVVQNLTGRNLSDFLVKTYPRLVRQGLKTKKWVNEVRYGGFSLGGRDPGLPSGQELGRSVEELWALLSPLPGGALD--------RVLKNLTAWAHSLDAQDSL-KIWFNNKGWHSMVAFVNRASNAILRAHLPPGPARHAHSITTLNHPLNLTKEQLSEGALMASSVDVLVSICVVFAMSFVPASFTLVLIEERVTRAKHLQLMGGLSPTLYWLGNFLWDMCNYLVPACIVVLIFLAFQQRAYVAPANLPALLLLLLLYGWSITPLMYPASFFFSVPSTAYVVLTCINLFIGINGSMATFVLEL--FSDQKLQEVSRILKQVFLIFPHFCLGRGLIDMVRNQAMADAFERL------GDRQFQSPLRWEVVGKNL--LAMVIQGPLFLLFTLLLQHRSQL---LPQPRVRSLPLLGEEDEDVARERERV-VQGATQGDVLVLRNLTKVYR--------------------GQRMPAVDRLCLGIPPGECFGLLGVNGAGKTSTFRMVTGDTLASRGEAVLAGHSVAREPSAAHLSMGYCPQSDAIFELLTGREHLELLARLRGVPEAQVAQTAGSGLARLGLSWYADRPAGTYSGGNKRKLATALALVGDPAVVFLDEPTTGMDPSARRFLWNSLLAVVREGR-SVMLTSHSMEECEALCSRLAIMVNGRFRCLGSPQHLKGRFAAGHTLTLRVP------AARSQPAAAFVAAEFPGAELREAHGGRLRFQLPPGGRCA-LARVFGELAVHGAEHGVEDFSVSQTMLEEVFLYFSKDQG 2105          

HSP 3 Score: 160.999 bits (406), Expect = 6.827e-38
Identity = 97/338 (28.70%), Postives = 166/338 (49.11%), Query Frame = 2
Query: 2276 ILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQ 3289
            +++ NL K +   + PA+D L L     +  G LG NGAGKT+T  ++TG    + G A +  + +  +       +G CPQ + +F  LT  +H+     L+G+ ++++       +  +GLS      +   SGG KRKL+ A+A VG+  ++FLDEPT G+DP +RR +W+ ++      R+++LT+H M+E + LC R+AI+  G+ +C GS   LK  F  G+ L L      +     +  A+        F+    P ++L +    +    L      R     +F +L        +  + +S T LEEVFL  + D  +     ++K+
Sbjct: 1793 LVLRNLTKVYRGQRMPAVDRLCLGIPPGECFGLLGVNGAGKTSTFRMVTGDTLASRGEAVLAGHSVAREPSAAHLSMGYCPQSDAIFELLTGREHLELLARLRGVPEAQVAQTAGSGLARLGLSWYADRPAGTYSGGNKRKLATALALVGDPAVVFLDEPTTGMDPSARRFLWNSLLAVVREGRSVMLTSHSMEECEALCSRLAIMVNGRFRCLGSPQHLKGRFAAGHTLTL------RVPAARSQPAA-------AFVAAEFPGAELREAHGGRLRFQLPPG--GRCALARVFGELAVHGAEHGVEDFSVSQTMLEEVFLYFSKDQGKDEDTEEQKE 2115          

HSP 4 Score: 152.525 bits (384), Expect = 2.596e-35
Identity = 102/357 (28.57%), Postives = 175/357 (49.02%), Query Frame = 1
Query: 5278 INVSSEDKR-----KLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYY---VKIRLHPNRNSLSD---RNEIETIINK------------------EIW-SSARMKEENA----VIIEYRFDSSVKLSDIFRVFEDLRTNEM-VKEYSVSQMSLDEVFINFAKNDSVTRNISNGN 6243
            ++V S +KR     + A+  +S    +G     LG NGAGKTTT  +L G    + G+A I G+ +         ++G CPQ++ L  +LT +E ++FY R++G+  + +    D  L+++ L    +  T  +SGG +RK+  AIA +G  ++V LDEPT G+D  +RR +W L+  L       +IL++H+++E E+L  R+A++  G +   GS   L+   G  YY   VK RL    N  +D      ++T   K                  + W   AR+ EE      +++ Y        + +FR   D R  E+ +  Y +S  SL+E+F+   +  +   ++ +G+
Sbjct:  807 VSVRSLEKRFPGSPQPALRGLSLDFYQGHITAFLGHNGAGKTTTLSILSGLFPPSGGSAFILGHDVRSSMAAIRPHLGVCPQYNVLFDMLTVDEHVWFYGRLKGLSAAVVGPEQDRLLQDVGLVSKQSVQTRHLSGGMQRKLSVAIAFVGGSQVVILDEPTAGVDPASRRGIWELL--LKYREGRTLILSTHHLDEAELLGDRVAVVAGGRLCCCGSPLFLRRHLGSGYYLTLVKARLPLTTNEKADTDMEGSVDTRQEKKNGSQGSRVGTPQLLALVQHWVPGARLVEELPHELVLVLPYTGAHDGSFATLFREL-DTRLAELRLTGYGISDTSLEEIFLKVVEECAADTDMEDGS 1160          
BLAST of ATP binding cassette subfamily A member 1 vs. UniProt/SwissProt
Match: sp|Q91V24|ABCA7_MOUSE (ATP-binding cassette sub-family A member 7 OS=Mus musculus OX=10090 GN=Abca7 PE=1 SV=1)

HSP 1 Score: 568.54 bits (1464), Expect = 3.414e-166
Identity = 389/1261 (30.85%), Postives = 628/1261 (49.80%), Query Frame = 2
Query:  143 PFSLIIEMLIPLFVIFILVAVRRITSSYSMGTCELREKQMGSMGPIPFLRDFICTFNTSCYN------------------------TTQIDWTKNSINDFLTFMNNISSLYSSLYTTNFTVPGFVDWSNVNPNLYTQLLNSI---NYISPVISSFITSIKEMQTGDQTLINK----------------------NLKILGQLLCGS--------------DQNDIDVFLQNFNLSLINSTKSIPTCQLAFMNYFTKSNGLSVLYPIIGPLVFGKIYYTPNSAFTQEIIRRANSTFRILDNLRLASVEWRLTFSNWL--INNSTNMGLLN---DARNYCANSRTLMCQ--------IINNSLSIETIQSTIASLSAMFVLIENSLNCTQLNKFTPMPS-----SIDIDNLSKQSSLGILAGIVFTDDFQYVTPQNAT-------FLNYQIRMPASRIDSTKNFKVLDRFWTPIPRVNTLTNFNYYTSGFLFLQEIIDQAFIELITDNASVNIGSSMQIMPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTXXXXXXXXXXXXXXXXXGKXXXXXXXXXXXXXXXXXXXXXXCQCFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKA-----------------------------------------SESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANI--NGPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGLFSE 3532
            P  L++E+L PLF+ FILVAVR          C    K + S G +P+L+  +C  N SC+                          T+     +SI D L  +  +  +  ++       P   D      ++ T+LL  I     + PV+     S+++     + L  +                      +L+++ + LC +              + N ++ F+       +      P C   F+          +L+  + PL+ GKI + P++ FT++++ + N TF  L  LR     W +        +N+STN+ +L    D        +T   Q         ++ S    + +   A +  +  ++   + C  L+K   +PS     S  ++ L ++    + AGIVF      + P   +        L ++IRM     D T+  K+ D+FW P P  +   +  Y   GF++LQ++++QA + ++    S   G  +Q MP+PCY++D  +  LS  +P  L +AW  +V   +K++V EKE RL+E MR MG+S  V W+ WF S +   ++   L+ ++LKLG IL +S P++IFL L  + V+ + Q F++S FF  +N+AA  GG+ YF  YLP+++ + +++ L         LL+ V+F      +  LE+  DGAQ+ NL      D+ F +      + +D+V Y L  WY+EAV PG+YG+P+PW F F R YW        ++        ++  + +   E+ P  L  G+ I  L K F     PAL  LNL FY+  IT FLGHNGAGKTTT+SIL+G+  P+SG+A IL +D++ +M  IR  +G+CPQ+N+LF  LTVE+H++FYG LKG++ + +  +   ++++VGL+ K    +++LSGGM+RKLS+A+AFVG SR++ +DEPTAGVDP SRRGIW+L++KYR   RT+IL+THH+DEA+ L DR+A+++ G L CCGS LFL+++ G GYYL L KS   QS   H+ K                                          + S  ++LE +++ +P ++L+++   +  +VL +       F  +F++LD  L+ L +  YG+SDT+LEE+FLKV +D    +H+          L T T     P+P         T   A++  NG         N   + G +L  QQ+  L  KRF   +R+ +GLF++
Sbjct:   22 PIQLLVELLWPLFLFFILVAVRHSHPPLEHHECHFPNKPLPSAGTVPWLQGLVCNVNNSCFQHPTPGEKPGVLSNFKDSLISRLLADTRTVLGGHSIQDMLDALGKLIPVLRAV--GGGARPQESDQPTSQGSV-TKLLEKILQRASLDPVLGQAQDSMRKFSDAIRDLAQELLTLPSLMELRALLRRPRGSAGSLELVSEALCSTKGPSSPGGLSLNWYEANQLNEFMGPEVAPALPDNSLSPACS-EFVGTLDDHPVSRLLWRRLKPLILGKILFAPDTNFTRKLMAQVNQTFEELALLRDLHELWGVLGPQIFNFMNDSTNVAMLQRLLDVGGTGQRQQTPRAQKKLEAIKDFLDPSRGGYSWREAHADMGRLAGILGQMMECVSLDKLEAVPSEEALVSRALELLGERR---LWAGIVFLSPEHPLDPSELSSPALSPGHLRFKIRMDID--DVTRTNKIRDKFWDPGPSADPFMDLRYVWGGFVYLQDLLEQAAVRVLGGGNS-RTGLYLQQMPHPCYVDDVFLRVLSRSLPLFLTLAWIYSVALTVKAVVREKETRLRETMRAMGLSRAVLWLGWFLSCLGPFLVSAALLVLVLKLGNILPYSHPVVIFLFLAAFAVATVAQSFLLSAFFSRANLAAACGGLAYFALYLPYVLCVAWRERLHLGGLLAASLLSPVAFGFGCESLALLEEQGDGAQWHNLGTGPAEDV-FSLAQVSAFLLLDAVIYGLALWYLEAVCPGQYGIPEPWNFPFRRSYWCGPGPPKSSVLAPA---PQDPKVLV---EEPPLGLVPGVSIRGLKKHFRGCPQPALQGLNLDFYEGHITAFLGHNGAGKTTTLSILSGLFPPSSGSASILGHDVQTNMAAIRPHLGICPQYNVLFDMLTVEEHVWFYGRLKGVSAAAMGPERERLIRDVGLTLKRDTQTRHLSGGMQRKLSVAIAFVGGSRVVIMDEPTAGVDPASRRGIWELLLKYRE-GRTLILSTHHLDEAELLGDRVAMVAGGSLCCCGSPLFLRRHLGCGYYLTLVKSS--QSLVTHDAKGDSEDPRREKKSDGNGRTSDTAFTRGTSDKSNQAPAPGAVPITPSTARILELVQQHVPGAQLVEDLPHELLLVLPYAGALDGSFAMVFQELDQQLELLGLTGYGISDTNLEEIFLKVVED----AHREGGDSRPQLHLRTCT-----PQP--------PTGPEASVLENGELAPQGLAPNAAQVQGWTLTCQQLRALLHKRFLLARRSRRGLFAQ 1245          

HSP 2 Score: 456.833 bits (1174), Expect = 3.837e-129
Identity = 276/840 (32.86%), Postives = 447/840 (53.21%), Query Frame = 1
Query: 3811 TNKWSEKSPIEISLVTPECDCSTTGNQI----CSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMK-----------QYGGLQFILPSFFGQSCQVIGESQIWFDFRQ--SINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDL--------SFSYLRYNISGGDENYNA-FEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVK--LSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRNISNGNA 6246
            +  W+ +SP      +P C CS  G +     C +   G       +    + + +L+  N+SD+L+K + + + +           +YGG      S  G+   +    ++     +  ++ S +  N+    +  L  + L  ++     N  +IW N+KG+ +M A+ N  +N LL + + +      + I   N+PL  T+  L         ++V ++I V+F +SF+PASF + LIEER+T +K  Q VSG+   +YW+ NF WD   Y ++V IV+  FLAF  ++Y+  +N+ A ++LL LY  ++ P MYP SFF S  STA+VV++  NL +G  +++ TF L+L    D +L+  +  LK++FLIFP + LGRG+ID+        +F  L      GD+ + +   WDI G  +  L ++  G   +++ +  +H+  L  + K   L P   + +ED DV +ERER+        DVL +  LTK+Y                      +R  AV+ +  G+  GECFGLLGVNGAGKT+TF+M+ G+   + G A++ G+++  +   AH++MG+CPQ DA+  LLT  E L  + R+RG+  + +       L  L L  + ++P    SGGNKRK+ TA+AL+G P +VFLDEPT GMD  ARRFLW  + ++  E + +V+LTSH+MEECE LC RLAIMV+G  + +GS QHLK +FG  + + +R+ P      D+ E      +  +  A ++E +   + ++     +  L+ +FR          V+++SVSQ +L+EVF+ F+K+       S   A
Sbjct: 1347 SGNWTPESP------SPACQCSQPGARRLLPDCPAGAGGP-PPPQAVAGLGEVVQNLTGRNVSDFLVKTYPSLVRRGLKTKKWVDEVRYGGF-----SLGGRDPDLPTGHEVVRTLAEIRALLSPQPGNALDRILNNLTQWALGLDAR----NSLKIWFNNKGWHAMVAFVNRANNGLLHALLPSGPVRHAHSITTLNHPLNLTKEQLSEATLIASSVDVLVSICVVFAMSFVPASFTLVLIEERITRAKHLQLVSGLPQTLYWLGNFLWDMCNYLVAVCIVVFIFLAFQQRAYVAPENLPALLLLLLLYGWSITPLMYPASFFFSVPSTAYVVLTCINLFIGINSSMATFVLELL--SDQNLQEVSRILKQVFLIFPHFCLGRGLIDMVRNQAMADAFERL------GDKQFQSPLRWDIIGKNL--LAMMAQGPLFLLITLLLQHRNRLLPQSKPRLLPP---LGEEDEDVAQERERVT-KGATQGDVLVLRDLTKVYR--------------------GQRNPAVDRLCLGIPPGECFGLLGVNGAGKTSTFRMVTGDTLPSSGEAVLAGHNVAQERSAAHRSMGYCPQSDAIFDLLTGREHLELFARLRGVPEAQVAQTALSGLVRLGLPSYADRPAGTYSGGNKRKLATALALVGDPAVVFLDEPTTGMDPSARRFLWNSLLSVVREGR-SVVLTSHSMEECEALCTRLAIMVNGRFRCLGSSQHLKGRFGAGHTLTLRVPP------DQPEPAIAFIRITFPGAELREVHGSRLRFQLPPGGRCTLTRVFRELAAQGRAHGVEDFSVSQTTLEEVFLYFSKDQGEEEESSRQEA 2129          

HSP 3 Score: 171.014 bits (432), Expect = 6.277e-41
Identity = 104/339 (30.68%), Postives = 176/339 (51.92%), Query Frame = 2
Query: 2276 ILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISH-KRQEKQ 3289
            +++ +L K +   + PA+D L L     +  G LG NGAGKT+T  ++TG   P+SG A +  +++  +       +G CPQ + +F  LT  +H+  +  L+G+ ++++       +  +GL       +   SGG KRKL+ A+A VG+  ++FLDEPT G+DP +RR +W+ ++      R+++LT+H M+E + LC R+AI+  G+ +C GSS  LK  FG G+ L L    + Q E              + FI+   P ++L +   ++    L      R   T +F +L +      +  + +S T+LEEVFL  + D  +     RQE +
Sbjct: 1807 LVLRDLTKVYRGQRNPAVDRLCLGIPPGECFGLLGVNGAGKTSTFRMVTGDTLPSSGEAVLAGHNVAQERSAAHRSMGYCPQSDAIFDLLTGREHLELFARLRGVPEAQVAQTALSGLVRLGLPSYADRPAGTYSGGNKRKLATALALVGDPAVVFLDEPTTGMDPSARRFLWNSLLSVVREGRSVVLTSHSMEECEALCTRLAIMVNGRFRCLGSSQHLKGRFGAGHTLTLRVPPD-QPEPA------------IAFIRITFPGAELREVHGSRLRFQLPPG--GRCTLTRVFRELAAQGRAHGVEDFSVSQTTLEEVFLYFSKDQGEEEESSRQEAE 2130          

HSP 4 Score: 141.354 bits (355), Expect = 7.705e-32
Identity = 71/217 (32.72%), Postives = 123/217 (56.68%), Query Frame = 1
Query: 5311 AVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKI 5961
            A+  ++    EG     LG NGAGKTTT  +L G    + G+A I G+ +  +      ++G CPQ++ L  +LT EE ++FY R++G+  + +    +  ++++ LT   +  T  +SGG +RK+  AIA +G  ++V +DEPT G+D  +RR +W L+  L       +IL++H+++E E+L  R+A++  G +   GS   L+   G  YY+ +
Sbjct:  820 ALQGLNLDFYEGHITAFLGHNGAGKTTTLSILSGLFPPSSGSASILGHDVQTNMAAIRPHLGICPQYNVLFDMLTVEEHVWFYGRLKGVSAAAMGPERERLIRDVGLTLKRDTQTRHLSGGMQRKLSVAIAFVGGSRVVIMDEPTAGVDPASRRGIWELL--LKYREGRTLILSTHHLDEAELLGDRVAMVAGGSLCCCGSPLFLRRHLGCGYYLTL 1034          
BLAST of ATP binding cassette subfamily A member 1 vs. TrEMBL
Match: A0A3P9L2N4 (Uncharacterized protein OS=Oryzias latipes OX=8090 PE=4 SV=1)

HSP 1 Score: 651.358 bits (1679), Expect = 0.000e+0
Identity = 433/1197 (36.17%), Postives = 650/1197 (54.30%), Query Frame = 2
Query:  152 LIIEMLIPLFVIFILVAVRRITSSYSMGTCELREKQMGSMGPIPFLRDFICTFNTSCYNTTQIDWTKNSINDFLTFMNNISSLYSSLYTTNFTVPGFVDWSNVNPNLYTQLLNSINYISPVISSFITSIKE-MQTGDQTLINKNLKILGQLLCG-------------SDQNDIDVFLQNFNLSLINSTKSIPTCQLAFMNYFTKSNGLSVLYPIIGPLVFGKIYYTPNSAFTQEIIRRANSTFRILDNLRLASVEWRL--TFSNWLINNSTNMGLLNDARNYCANSRTLMCQIINNSLSIETIQSTIASLSAMFVLIENSLNCTQLNKFTPMPSSIDI--DNLSKQSSLGILAGIVFTDDFQYVTPQNATFLNYQIRMPASRIDSTKNFKVLDRFWTPIPRVNTLTNFNYYTSGFLFLQEIIDQAFIELITDNASVNIGSSMQIMPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTXXXXXXXXXXXXXXXXXGKXXXXXXXXXXXXXXXXXXXXXXCQCFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENITIDGFEKEPD-DLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKS----FEIQSETCHNNKASESGTK----------------------------LLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADD------------PSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTIN-------TANINGPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGLFSE 3532
            L++E+L PLF+  ILVAVR  T   + G C    K M S G +P+L+  +C  +  CYN      T   +N+F    NN  S  S +              NV  NL  +L N   Y+       + S  E M++ D    N  +      LCG             SDQ D        N S  NS  S P C    ++    +  +  L+    PL+ GK+ YTP++   + ++  AN+TF  L  ++  +  W     F    + N T   ++N++               +++ +  T +     L+    L+   L C +LNKF  +P+   +  + L    +    AGIVF ++ Q  +     +L Y+IRM    +  T   KV +R W+P    N   N  Y   GF +L++IID A I L T + S  +G  +Q MPYPCY++D  +  L+  +P  + IAW  +V  ++K IV +KE+RLKE +R+MG+   V+W +W  + +L + +  +L+TII+K GK+L +S P ++F+ L  + +S I +CF+ISVFF  +N+AA  GG++YF+ YLP ++   ++D +  +   GV LL+ V+F      +   E+   G Q+ N+  S      +     ++M+ +D+  Y ++ WY+E VFPG+YG+P+PWYFLFT  YW  F K +   +I DNF+  + +   + F ++PD +++ G+ I NLVK +   K  A+D L++ FY++QIT FLGHNGAGKTTT+SILTG+  PTSGTA I   DIR DM+ IR  +G+CPQHN+LF  LTVE+HIYFYG LKG+  SE++ ++  ++K+VGL  K K + KNLSGGM+RKLS+A+AFVG S+I+ LDEPTAGVDPF+RRGIWDL++KY+   RTIIL+THHMDEAD L DRIAIIS GK++CCGSS+FLK++FG GYYL L +S       Q     +  A E  T+                            + +F++K +P    ++    + T +L +       F +LF++LD  +D L + SYG+SDT+LEE+FLKVA+D            P    +K+  ++     +      G   +  +    +KK  N       +A++NG           V+++G  LI QQ   LFIKRFHH +R+ KGL ++
Sbjct:   25 LLVEILWPLFLFVILVAVRTTTKPVNKGQCHYPNKAMPSAGLLPWLQGMMCNIDNPCYNDPTPGETPGQVNNF----NN--STASQILI------------NVQ-NLLLELSNGQGYLESKADVLVNSTNEAMKSLD--FQNDPIGSFSMFLCGKKPSSNSTFRFPTSDQQD------TMNSSFQNSQDSDPFCT-TLIDTMVTTPSMQFLWKNFRPLLKGKVLYTPDTPAARLLVEEANATFMALAAIKEFADSWGEDGPFVWGFVENGT--AVVNESSAN---------SNNSSADTPPTSEDAYNDLTQFLKLLSKVLGCFELNKFEAVPTEYQLVTEALEHLKNDTFWAGIVF-ENLQPNSSSIPPYLKYKIRMDVEEVQRTD--KVENRLWSPGANDNPYENLRYIWGGFAYLEDIIDHASIRLQT-STSQPLGVYVQQMPYPCYVDDPFLRALAGFLPLFMTIAWIFSVALIVKGIVGDKESRLKETVRIMGLRGEVYWSTWLLTCLLPMAISSVLLTIIIKYGKVLQYSDPSVVFIFLLVFCLSTISECFLISVFFSKANLAAACGGLIYFLLYLPHVLCYAWRDVMGFQAKVGVSLLSCVAFGYGCENLSKFEEQGVGIQWHNIATSPEEGQRYTFIVSILMMLLDAAIYWVLTWYIENVFPGQYGIPRPWYFLFTYSYW--FGKTSVPEDIPDNFKLLKRSSVPNEFLEKPDPNMKAGVSIRNLVKIYKTGKKVAVDGLSVDFYENQITSFLGHNGAGKTTTMSILTGLFPPTSGTALINGYDIRTDMDSIRKYLGMCPQHNVLFDELTVEEHIYFYGRLKGLNPSELQTEMDQMIKDVGLLHKRKDLVKNLSGGMQRKLSVAIAFVGGSKIVILDEPTAGVDPFARRGIWDLLLKYKK-GRTIILSTHHMDEADILGDRIAIISHGKMRCCGSSIFLKKSFGSGYYLTLVRSGTEVMTAQRSGIISGIAEEKPTESDCPSSSSLDEDRGCQSSDNSNPADLKHVTQFVRKHVPEVVFLESIGQEITFILPYARARDGTFATLFQELDKVMDKLGLTSYGVSDTTLEEIFLKVAEDTGVDKELSPTKEPVVKDYKKDSRESKRRSMSRFH--GKAAKGNTKDELKKKLSNKVEDFKKSASVNG--------RGSVVITGWKLIRQQFLALFIKRFHHARRSRKGLIAQ 1165          

HSP 2 Score: 505.753 bits (1301), Expect = 0.000e+0
Identity = 308/895 (34.41%), Postives = 485/895 (54.19%), Query Frame = 1
Query: 3604 PSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMNTSLYQLENFKC-------LYP---------YNTNKWSEKSPIEISLVTPECDCSTTGNQI----CSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMKQYGGLQFILPSFFGQSCQVIGESQIWFDFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNIS---GGDENYNAFEWDITGNKICSL---GILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSV-KLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAK 6207
            PS+ + PW+   +T      TFY  +   D    ++ E    + G  G RCM  +   +    C         P         +    WS  +P      +P C CST G  I    C     G      R+  ++D L +L+S N++D+L+K ++    K+YGG+     S  G + QV+            I  +  N   P     +   ++     G + N+ ++W  +KG+ SM ++ ++ +N +LR  +   + L+ YG++V+N+PL  ++  L     A    +V ++I VIF +SFIPASFV+FLI+ERV+ +K  Q+VSGVNP VYW+++F WD   Y I   +V+  F+ F  ++Y+  +N+ A I+LL +Y  A+ P MYP SF  +  STA+VV++  NL +G   ++ TF ++L++  D S+   N+ +K++ LIFP + LGRG++D++ +    N+    G D   +   W++ G  + ++   G +   + L+I     ++K     +L   K++  E    ED+DV +ER R+       NDVL++  LTK+Y                      K   AV  +  GV   ECFGLLG+NGAGKTTTFKML G+  ++ G A +NGYSI       H+NMG+CPQFDA++ LL   E L  Y R+RG+   ++ +  +  ++ L L  + NK     SGGNKRK+ TA+ALIG P ++FLDEPT GMD  ARRFLW  I ++  E + +V+LTSH+MEECE LC R+AIMV+G  + +GS+QHLK++FG  Y + +R+        D   +E  + +E +  + +KE++   ++Y+  S    L+ IF    D +    +++YSVSQ +LD+VF+NFAK
Sbjct: 1190 PSLELQPWMYNSQT------TFYSNDMPEDANVSRVVETLVDNPG-FGTRCMEGN--PIPRLPCSSGASDWFSPSVDQSVADIFLNGNWSMSNP------SPSCQCSTPGRTIIMPDCPPGAGGL-PPPQRVQNTTDTLLNLTSINMTDFLLKTYEHSGKKRYGGI-----SVGGINSQVLLT-------EVEIEEAFANLELPGNGDTIQKAEMVLKKLGTRNNV-KVWFYNKGWHSMVSFLSVVNNGILRGYLPEGQDLRQYGLSVSNHPLNLSKEQLSLSAMASTSSDVVVSICVIFAMSFIPASFVLFLIQERVSKAKHLQFVSGVNPTVYWVASFVWDICNYIIPCFLVVGIFICFQQKAYVSPQNLPALILLLVMYGWAITPMMYPASFIFTVPSTAYVVLTCLNLFIGINGSVATFVMELFE--DESITKINNIVKQVLLIFPHFCLGRGLMDMARNQAMANVFSNFGEDRFEDPLSWNMVGKNLIAMSIQGAVMFAFTLLI-----QYKFFYKPRLSLPKVQSEE---KEDVDVARERHRVHEGR-ANNDVLRICDLTKVY--------------------PRKSTPAVYRLCVGVPAAECFGLLGINGAGKTTTFKMLTGDIPVSSGEAFLNGYSIRTQMGDVHQNMGYCPQFDAINDLLNGREHLELYARLRGVPEEEVAMVAEWGIQKLGLVKYANKSAGTYSGGNKRKLSTAMALIGCPPVIFLDEPTTGMDPKARRFLWDCILSVIKEGR-SVVLTSHSMEECEALCTRMAIMVNGRFQCLGSIQHLKNRFGDGYTLIVRVG---GCPPDLKPVEDFV-EETFPGSVLKEKHHNTLQYQLLSQEGALAKIFTELTDHQQELDLEDYSVSQTTLDQVFVNFAK 2019          

HSP 3 Score: 174.481 bits (441), Expect = 1.846e-39
Identity = 114/350 (32.57%), Postives = 179/350 (51.14%), Query Frame = 2
Query: 2282 IENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNN-KASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNS------TNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLD 3310
            I +L K +P+  TPA+  L +    ++  G LG NGAGKTTT  +LTG +  +SG AF+    IR  M  +   +G CPQ + +   L   +H+  Y  L+G+ + E+       ++++GL K     +   SGG KRKLS AMA +G   +IFLDEPT G+DP +RR +WD I+      R+++LT+H M+E + LC R+AI+  G+ +C GS   LK  FGDGY L       ++   C  + K  E      +F+++  P S L ++          HN+      +       +F +L      L +  Y +S T+L++VF+  A +     H  ++ Q     +D
Sbjct: 1711 ICDLTKVYPRKSTPAVYRLCVGVPAAECFGLLGINGAGKTTTFKMLTGDIPVSSGEAFLNGYSIRTQMGDVHQNMGYCPQFDAINDLLNGREHLELYARLRGVPEEEVAMVAEWGIQKLGLVKYANKSAGTYSGGNKRKLSTAMALIGCPPVIFLDEPTTGMDPKARRFLWDCILSVIKEGRSVVLTSHSMEECEALCTRMAIMVNGRFQCLGSIQHLKNRFGDGYTLI------VRVGGCPPDLKPVE------DFVEETFPGSVLKEK---------HHNTLQYQLLSQEGALAKIFTELTDHQQELDLEDYSVSQTTLDQVFVNFAKE----QHDEEDLQAHDNPVD 2035          

HSP 4 Score: 172.17 bits (435), Expect = 8.716e-39
Identity = 109/354 (30.79%), Postives = 172/354 (48.59%), Query Frame = 1
Query: 5302 RKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLH--------------------------PNRNSL--------------SDRNEIETIINK---EIWSSARMKEENAVIIEYRFDSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRNIS 6234
            +K+AV+ +S    E +    LG NGAGKTTT  +L G    T G A+INGY I  D     K +G CPQ + L   LT EE +YFY R++G+ PS++   +D  +K++ L          +SGG +RK+  AIA +G  KIV LDEPT G+D  ARR +W L+  L  +    +IL++H+M+E ++L  R+AI+  G+M+  GS   LK  FG  YY+ +                             P+ +SL              +D   +   + K   E+     + +E   I+ Y        + +F+  + +     +  Y VS  +L+E+F+  A++  V + +S
Sbjct:  720 KKVAVDGLSVDFYENQITSFLGHNGAGKTTTMSILTGLFPPTSGTALINGYDIRTDMDSIRKYLGMCPQHNVLFDELTVEEHIYFYGRLKGLNPSELQTEMDQMIKDVGLLHKRKDLVKNLSGGMQRKLSVAIAFVGGSKIVILDEPTAGVDPFARRGIWDLL--LKYKKGRTIILSTHHMDEADILGDRIAIISHGKMRCCGSSIFLKKSFGSGYYLTLVRSGTEVMTAQRSGIISGIAEEKPTESDCPSSSSLDEDRGCQSSDNSNPADLKHVTQFVRKHVPEVVFLESIGQEITFILPYARARDGTFATLFQELDKVMDKLGLTSYGVSDTTLEEIFLKVAEDTGVDKELS 1071          
BLAST of ATP binding cassette subfamily A member 1 vs. TrEMBL
Match: A0A0U2QQ09 (ATP-binding cassette transporter subfamily A member 1-like protein OS=Oryzias melastigma OX=30732 PE=2 SV=1)

HSP 1 Score: 646.736 bits (1667), Expect = 0.000e+0
Identity = 431/1186 (36.34%), Postives = 659/1186 (55.56%), Query Frame = 2
Query:  152 LIIEMLIPLFVIFILVAVRRITSSYSMGTCELREKQMGSMGPIPFLRDFICTFNTSCYNTTQIDWTKNSINDFLTFMNNISSLYSSLYTTNFTVPGFVDWSNVNPNLY---TQLLNSINYISPVISSFITSIKEMQTGDQTLINKNLKILGQLLCGSDQNDIDVFL-----QNFNLSLINSTK--SIPTCQLAFMNYFTKSNGLSVLYPIIGPLVFGKIYYTPNSAFTQEIIRRANSTFRILDNLRLASVEWRLTFSNWLINNSTNMGLLNDARNYCANSRTLMCQIINNSLS--IETIQSTIASLSAMFVLIENSLNCTQLNKFTPMPSSIDI--DNLSKQSSLGILAGIVFTDDFQYVTPQNATFLNYQIRMPASRIDSTKNFKVLDRFWTPIPRVNTLTNFNYYTSGFLFLQEIIDQAFIELITDNASVNIGSSMQIMPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTXXXXXXXXXXXXXXXXXGKXXXXXXXXXXXXXXXXXXXXXXCQCFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENITIDGFEKEPD-DLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKS-FEIQS-----------ETCHNNKASESGTKLLE--------------------FIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADD------------PSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANINGPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGLFSE 3532
            L++E+L PLF+ FILV VR  T   + G C    K M S G +P+L+  +C  +  C N      T   +N+F   +  IS +  +L +    +P    WSN   +L     + +NS+++ +  I+SF                        LLCG   +    F      Q +N++  +++   S P C  +F++    +  ++ L+    PL+ GKI YTP++   + ++  ANSTF  L  ++  +  W       + N   N+ +L           T      NNS      T +    +++ +  LI   L C +LNKF  +P+  ++   +L   ++    AGIVF ++ Q  + +   +L Y+IRM    +  T   KV  R W+P  R N   +  Y   GF +L++IID A I L T + +  +G  +Q MPYPCY++D  I  +  ++P  L++A+  +V+  IK +V EKE RLKE +R +G+ N   W S FT T+++L +P +L+++++K GK+L +S P ++F+ L  +  + I QCF+ISVFF  +N+AA  GG++YF+ YLP ++   ++D +      GV LL+ V+F      +   E+   G Q+ N+  S     ++     ++M+ +D+V Y ++ WY+E VFPG+YG+PKPWYFLFT  YW          E +DNF + + +   + + ++PD +++ G+ I NLVK +   K  A+D L++ FY++QIT FLGHNGAGKTTT+SILTG+  PTSGTA I   DIR DM+ IR  +G+CPQHN+LF  LTVE+HIYFYG LKG+  SE+K ++  ++K+VGL  K K ++KNLSGGM+RKLS+A+AFVG S+I+ LDEPTAGVDPF+RRGIWDL++KY+   RTIIL+THHMDEAD L DRIAIIS GK++CCGSS+FLK++FG GYYL L +S  EI +           E   N   S SG+ L E                    F+++ +P +  ++    + T +L +       F +LF++LD  +D L + SYG+SDT+LEE+FLKVA+D            P    +K+  ++     +  L   G   +       ++K  N         S     + V+++G  LI +Q   LFIKRFHH +R+ KGL ++
Sbjct:   25 LLVEILWPLFLFFILVTVRTTTKPSNKGQCHYPNKAMPSAGVLPWLQSMMCNIDNPCSNYPTPGETPGQVNNFNDSI--ISKILINLQSFLLEIPEEGLWSNSMESLVNSSAEAVNSLDFQNDPINSF----------------------SMLLCGKQLSSNSTFKFPESEQTYNINSSSNSSQGSDPFCT-SFIDTLVNTPSMNFLWNNFRPLLRGKILYTPDTPAARLLVEEANSTFSTLAAIKELADSWGKQ-GPIIWNIVENITVL----------ETEFGADFNNSDGDPPSTSRDAYNNVTQIMSLISKILGCFELNKFEAVPTEYELVTKSLDHLNNDTFWAGIVF-ENLQPNSSRIPPYLKYKIRMDVEEVQRTD--KVESRLWSPGARDNPYEDLRYIWGGFAYLEDIIDHASIRLQT-SKNQPLGVFVQQMPYPCYVDDPFIQSIGAILPMFLILAFMSSVSMTIKGLVLEKELRLKEVLRAVGIQNGALWFSTFTETMILLTVPCVLISVMVKYGKVLQYSDPSVVFVFLLVFCFATISQCFLISVFFSKANLAAACGGLIYFLLYLPHVLCYAWRDVMGFNAKVGVSLLSCVAFGYGCENLSKYEEQGVGIQWHNIAKSPEEGESYTFIVSILMMLLDAVIYWVLTWYIENVFPGQYGIPKPWYFLFTSSYW---CGKTAVPEDTDNFDKLKGSSVQNEYMEKPDPNMKAGVSIRNLVKVYKTGKKVAVDGLSMDFYENQITSFLGHNGAGKTTTMSILTGLFPPTSGTALINGYDIRTDMDTIRGCLGMCPQHNVLFDELTVEEHIYFYGRLKGLNGSELKTEMDQMIKDVGLLHKRKDLAKNLSGGMQRKLSVAIAFVGGSKIVILDEPTAGVDPFARRGIWDLLLKYKK-GRTIILSTHHMDEADILGDRIAIISHGKMRCCGSSIFLKKSFGSGYYLTLVRSGTEIMTAQRSGIILGKIEEEPNESDSPSGSSLDEGFGSQSSDNSNPADLNHVTQFVRRHVPEAVFLESIGQEITFILPYARARDGTFATLFQELDQVMDKLGLTSYGVSDTTLEEIFLKVAEDTGVDKEISPTKEPVVKDYKKNSRESKRRSISRLH--GRAEKAKGKDELKEKFCNKVEDCRKNASVSGRGS-VVITGWELIRRQFLALFIKRFHHARRSRKGLIAQ 1163          

HSP 2 Score: 506.908 bits (1304), Expect = 0.000e+0
Identity = 308/895 (34.41%), Postives = 489/895 (54.64%), Query Frame = 1
Query: 3604 PSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMNTSLYQLENFKC-------LYP---------YNTNKWSEKSPIEISLVTPECDCSTTGNQI----CSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMKQYGGLQFILPSFFGQSCQVI-GESQIWFDFRQSINSS-RDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNIS---GGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRF-DSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKN 6210
            P++ + PW+        +  TFY  +   D  + ++ E    + G  G RCM      +    C         P         + T  WS  +P      +P C CST G  I    C     G      R+  ++D L +L+  N++D+L+K ++    K+YGG+     S  G + QVI  E +I   FR+  N+        PE        ++     G + N+ ++W  +KG+ SM ++ ++ +N +LR  +     ++ YG++V+N+PL  ++  +     A    +V ++I VIF +SFIPASFV+FLI+ERV+ +K  Q+VSGVNP +YWI++F WD   Y I   +V++ F+ F  ++Y+   N+ A I+LL +Y  A+ P MYP SF  +  STA+VV++  NL +G   ++ TF ++++  DD ++   ND +K++ L+FP + LGRG++D++ + +   I    G D   +   W++TG  + ++ I   G  +    +  ++K     +L   K++  E   +ED DV +ER+R+       ND+L++  LTK+Y                      K   AV  +  GV   ECFGLLG+NGAGKTTTFKML G+  ++ G A +NGYSI       H+NMG+CPQFDA++ LLT  E L  Y R+RG+   ++ +  +  +K L L  + NK     SGGNKRK+ TA+ALIG P ++FLDEPT GMD  ARRFLW  I ++  E + +V+LTSH+MEECE LC R+AIMV+G  K +GS+QHLK++FG  Y + +R+      L     +E  + +E +  + +KE++   ++Y+  ++   L+ IF      +    +++YSVSQ +LD+VF+NFAK 
Sbjct: 1188 PNLELQPWMYD-----ASQTTFYSDDTPDDANASRVVETLVDNPG-FGTRCMEGD--PIPGLPCSSGASDWFSPSVDQSIADIFLTGNWSMSNP------SPSCQCSTPGRTIIMPDCPPGAGGL-PPPQRVQNTTDTLLNLTGINMTDFLVKTYEHSGKKRYGGI-----SVGGINSQVILTEVEIEDAFRKLRNTFFWSERGIPEDT--FQKAEMVLKRLGTRNNV-KVWFYNKGWHSMVSFLSVANNGILRGNLPEGLNVRQYGLSVSNHPLNLSKEQMSLSAMASTSSDVVVSICVIFAMSFIPASFVLFLIQERVSKAKHLQFVSGVNPAIYWIASFTWDICNYIIPCFLVVVIFVCFQQKAYVSPPNLPALILLLVMYGWAITPMMYPASFIFTVPSTAYVVLTCVNLFIGINGSVATFVMEIF--DDENITYINDIVKQVLLVFPHFCLGRGLMDMARNQIMATIYSNFGEDRFEDPLSWNMTGKNLVAMAIQ--GAVMFAFTLLIQYKFFYKPRLASPKIRSEE---EEDEDVARERQRV-YEGRAENDMLRIRDLTKVY--------------------PRKSTPAVYRLCVGVPAAECFGLLGINGAGKTTTFKMLTGDIPVSSGEAFLNGYSIRTQMSDVHQNMGYCPQFDAINDLLTGREHLELYARLRGVPEHEVAMVAEWGIKKLGLVQYANKSAGTYSGGNKRKLSTAMALIGCPPVIFLDEPTTGMDPKARRFLWDCILSVIKEGR-SVVLTSHSMEECEALCTRMAIMVNGRFKCLGSIQHLKNRFGDGYTLIVRVGGRPPVL---KPVEDFV-EETFPGSVLKEKHHNTLQYQLPNNEGALAKIFNELTHHQQRLDLEDYSVSQTTLDQVFVNFAKQ 2026          

HSP 3 Score: 179.489 bits (454), Expect = 5.219e-41
Identity = 118/353 (33.43%), Postives = 180/353 (50.99%), Query Frame = 2
Query: 2192 EISDNFRQREENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLE-FIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVA 3247
            E  D    RE     +G  +  +D+   + I +L K +P+  TPA+  L +    ++  G LG NGAGKTTT  +LTG +  +SG AF+    IR  M  +   +G CPQ + +   LT  +H+  Y  L+G+ + E+       +K++GL +     +   SGG KRKLS AMA +G   +IFLDEPT G+DP +RR +WD I+      R+++LT+H M+E + LC R+AI+  G+ KC GS   LK  FGDGY L +                     K +E F+++  P S L ++        L +   N      +F +L      L +  Y +S T+L++VF+  A
Sbjct: 1692 EEEDEDVARERQRVYEG--RAENDM---LRIRDLTKVYPRKSTPAVYRLCVGVPAAECFGLLGINGAGKTTTFKMLTGDIPVSSGEAFLNGYSIRTQMSDVHQNMGYCPQFDAINDLLTGREHLELYARLRGVPEHEVAMVAEWGIKKLGLVQYANKSAGTYSGGNKRKLSTAMALIGCPPVIFLDEPTTGMDPKARRFLWDCILSVIKEGRSVVLTSHSMEECEALCTRMAIMVNGRFKCLGSIQHLKNRFGDGYTLIVRVG------------GRPPVLKPVEDFVEETFPGSVLKEKHHNTLQYQLPN---NEGALAKIFNELTHHQQRLDLEDYSVSQTTLDQVFVNFA 2024          

HSP 4 Score: 172.555 bits (436), Expect = 7.013e-39
Identity = 108/354 (30.51%), Postives = 172/354 (48.59%), Query Frame = 1
Query: 5302 RKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYV--------------------KIRLHPNR--------------------NSLSDRNEIETIINKEIWSSARMK---EENAVIIEYRFDSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRNIS 6234
            +K+AV+ +S    E +    LG NGAGKTTT  +L G    T G A+INGY I  D       +G CPQ + L   LT EE +YFY R++G+  S++   +D  +K++ L          +SGG +RK+  AIA +G  KIV LDEPT G+D  ARR +W L+  L  +    +IL++H+M+E ++L  R+AI+  G+M+  GS   LK  FG  YY+                    KI   PN                     ++ +D N +   + + +  +  ++   +E   I+ Y        + +F+  + +     +  Y VS  +L+E+F+  A++  V + IS
Sbjct:  718 KKVAVDGLSMDFYENQITSFLGHNGAGKTTTMSILTGLFPPTSGTALINGYDIRTDMDTIRGCLGMCPQHNVLFDELTVEEHIYFYGRLKGLNGSELKTEMDQMIKDVGLLHKRKDLAKNLSGGMQRKLSVAIAFVGGSKIVILDEPTAGVDPFARRGIWDLL--LKYKKGRTIILSTHHMDEADILGDRIAIISHGKMRCCGSSIFLKKSFGSGYYLTLVRSGTEIMTAQRSGIILGKIEEEPNESDSPSGSSLDEGFGSQSSDNSNPADLNHVTQFVRRHVPEAVFLESIGQEITFILPYARARDGTFATLFQELDQVMDKLGLTSYGVSDTTLEEIFLKVAEDTGVDKEIS 1069          
BLAST of ATP binding cassette subfamily A member 1 vs. TrEMBL
Match: A0A3P9L2H4 (Uncharacterized protein OS=Oryzias latipes OX=8090 PE=4 SV=1)

HSP 1 Score: 645.966 bits (1665), Expect = 0.000e+0
Identity = 434/1197 (36.26%), Postives = 650/1197 (54.30%), Query Frame = 2
Query:  152 LIIEMLIPLFVIFILVAVRRITSSYSMGTCELREKQMGSMGPIPFLRDFICTFNTSCYNTTQIDWTKNSINDFLTFMNNISSLYSSLYTTNFTVPGFVDWSNVNPNLYTQLLNSINYISPVISSFITSIKE-MQTGDQTLINKNLKILGQLLCG-------------SDQNDIDVFLQNFNLSLINSTKSIPTCQLAFMNYFTKSNGLSVLYPIIGPLVFGKIYYTPNSAFTQEIIRRANSTFRILDNLRLASVEWRL--TFSNWLINNSTNMGLLNDARNYCANSRTLMCQIINNSLSIETIQSTIASLSAMFVLIENSLNCTQLNKFTPMPSSIDI--DNLSKQSSLGILAGIVFTDDFQYVTPQNATFLNYQIRMPASRIDSTKNFKVLDRFWTPIPRVNTLTNFNYYTSGFLFLQEIIDQAFIELITDNASVNIGSSMQIMPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTXXXXXXXXXXXXXXXXXGKXXXXXXXXXXXXXXXXXXXXXXCQCFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENITIDGFEKEPD-DLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKS----FEIQSETCHNNKASESGTK----------------------------LLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADD------------PSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTIN-------TANINGPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGLFSE 3532
            L++E+L PLF+  ILVAVR  T   + G C    K M S G +P+L+  +C  +  CYN      T   +N+F    NN  S  S +              NV  NL  +L N   Y+       + S  E M++ D    N  +      LCG             SDQ D        N S  NS  S P C    ++    +  +  L+    PL+ GK+ YTP++   + ++  AN+TF  L  ++  +  W     F    + N T   ++N++               +++ +  T +     L+    L+   L C +LNKF  +P+   +  + L    +    AGIVF ++ Q  +     +L Y+IRM    +  T   KV +R W+P    N   N  Y   GF +L++IID A I L T + S  +G  +Q MPYPCY++D  I  +  ++P  L++A+  +V   IK +V EKE RLKE +R +G+ N   W S FT T+++L +P +LM++++K GK+L +S P ++F+ L  + +S I +CF+ISVFF  +N+AA  GG++YF+ YLP ++   ++D +  +   GV LL+ V+F      +   E+   G Q+ N+  S      +     ++M+ +D+  Y ++ WY+E VFPG+YG+P+PWYFLFT  YW  F K +   +I DNF+  + +   + F ++PD +++ G+ I NLVK +   K  A+D L++ FY++QIT FLGHNGAGKTTT+SILTG+  PTSGTA I   DIR DM+ IR  +G+CPQHN+LF  LTVE+HIYFYG LKG+  SE++ ++  ++K+VGL  K K + KNLSGGM+RKLS+A+AFVG S+I+ LDEPTAGVDPF+RRGIWDL++KY+   RTIIL+THHMDEAD L DRIAIIS GK++CCGSS+FLK++FG GYYL L +S       Q     +  A E  T+                            + +F++K +P    ++    + T +L +       F +LF++LD  +D L + SYG+SDT+LEE+FLKVA+D            P    +K+  ++     +      G   +  +    +KK  N       +A++NG           V+++G  LI QQ   LFIKRFHH +R+ KGL ++
Sbjct:   25 LLVEILWPLFLFVILVAVRTTTKPVNKGQCHYPNKAMPSAGLLPWLQGMMCNIDNPCYNDPTPGETPGQVNNF----NN--STASQILI------------NVQ-NLLLELSNGQGYLESKADVLVNSTNEAMKSLD--FQNDPIGSFSMFLCGKKPSSNSTFRFPTSDQQD------TMNSSFQNSQDSDPFCT-TLIDTMVTTPSMQFLWKNFRPLLKGKVLYTPDTPAARLLVEEANATFMALAAIKEFADSWGEDGPFVWGFVENGT--AVVNESSAN---------SNNSSADTPPTSEDAYNDLTQFLKLLSKVLGCFELNKFEAVPTEYQLVTEALEHLKNDTFWAGIVF-ENLQPNSSSIPPYLKYKIRMDVEEVQRTD--KVENRLWSPGANDNPYENLRYIWGGFAYLEDIIDHASIRLQT-STSQPLGVYVQQMPYPCYVDDPFIQSIGAILPMFLILAFMSSVAMTIKGLVLEKELRLKEVLRGVGIRNGALWSSTFTETMILLTVPCVLMSVMVKYGKVLQYSDPSVVFIFLLVFCLSTISECFLISVFFSKANLAAACGGLIYFLLYLPHVLCYAWRDVMGFQAKVGVSLLSCVAFGYGCENLSKFEEQGVGIQWHNIATSPEEGQRYTFIVSILMMLLDAAIYWVLTWYIENVFPGQYGIPRPWYFLFTYSYW--FGKTSVPEDIPDNFKLLKRSSVPNEFLEKPDPNMKAGVSIRNLVKIYKTGKKVAVDGLSVDFYENQITSFLGHNGAGKTTTMSILTGLFPPTSGTALINGYDIRTDMDSIRKYLGMCPQHNVLFDELTVEEHIYFYGRLKGLNPSELQTEMDQMIKDVGLLHKRKDLVKNLSGGMQRKLSVAIAFVGGSKIVILDEPTAGVDPFARRGIWDLLLKYKK-GRTIILSTHHMDEADILGDRIAIISHGKMRCCGSSIFLKKSFGSGYYLTLVRSGTEVMTAQRSGIISGIAEEKPTESDCPSSSSLDEDRGCQSSDNSNPADLKHVTQFVRKHVPEVVFLESIGQEITFILPYARARDGTFATLFQELDKVMDKLGLTSYGVSDTTLEEIFLKVAEDTGVDKELSPTKEPVVKDYKKDSRESKRRSMSRFH--GKAAKGNTKDELKKKLSNKVEDFKKSASVNG--------RGSVVITGWKLIRQQFLALFIKRFHHARRSRKGLIAQ 1165          

HSP 2 Score: 505.753 bits (1301), Expect = 0.000e+0
Identity = 308/895 (34.41%), Postives = 485/895 (54.19%), Query Frame = 1
Query: 3604 PSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMNTSLYQLENFKC-------LYP---------YNTNKWSEKSPIEISLVTPECDCSTTGNQI----CSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMKQYGGLQFILPSFFGQSCQVIGESQIWFDFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNIS---GGDENYNAFEWDITGNKICSL---GILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSV-KLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAK 6207
            PS+ + PW+   +T      TFY  +   D    ++ E    + G  G RCM  +   +    C         P         +    WS  +P      +P C CST G  I    C     G      R+  ++D L +L+S N++D+L+K ++    K+YGG+     S  G + QV+            I  +  N   P     +   ++     G + N+ ++W  +KG+ SM ++ ++ +N +LR  +   + L+ YG++V+N+PL  ++  L     A    +V ++I VIF +SFIPASFV+FLI+ERV+ +K  Q+VSGVNP VYW+++F WD   Y I   +V+  F+ F  ++Y+  +N+ A I+LL +Y  A+ P MYP SF  +  STA+VV++  NL +G   ++ TF ++L++  D S+   N+ +K++ LIFP + LGRG++D++ +    N+    G D   +   W++ G  + ++   G +   + L+I     ++K     +L   K++  E    ED+DV +ER R+       NDVL++  LTK+Y                      K   AV  +  GV   ECFGLLG+NGAGKTTTFKML G+  ++ G A +NGYSI       H+NMG+CPQFDA++ LL   E L  Y R+RG+   ++ +  +  ++ L L  + NK     SGGNKRK+ TA+ALIG P ++FLDEPT GMD  ARRFLW  I ++  E + +V+LTSH+MEECE LC R+AIMV+G  + +GS+QHLK++FG  Y + +R+        D   +E  + +E +  + +KE++   ++Y+  S    L+ IF    D +    +++YSVSQ +LD+VF+NFAK
Sbjct: 1190 PSLELQPWMYNSQT------TFYSNDMPEDANVSRVVETLVDNPG-FGTRCMEGN--PIPRLPCSSGASDWFSPSVDQSVADIFLNGNWSMSNP------SPSCQCSTPGRTIIMPDCPPGAGGL-PPPQRVQNTTDTLLNLTSINMTDFLLKTYEHSGKKRYGGI-----SVGGINSQVLLT-------EVEIEEAFANLELPGNGDTIQKAEMVLKKLGTRNNV-KVWFYNKGWHSMVSFLSVVNNGILRGYLPEGQDLRQYGLSVSNHPLNLSKEQLSLSAMASTSSDVVVSICVIFAMSFIPASFVLFLIQERVSKAKHLQFVSGVNPTVYWVASFVWDICNYIIPCFLVVGIFICFQQKAYVSPQNLPALILLLVMYGWAITPMMYPASFIFTVPSTAYVVLTCLNLFIGINGSVATFVMELFE--DESITKINNIVKQVLLIFPHFCLGRGLMDMARNQAMANVFSNFGEDRFEDPLSWNMVGKNLIAMSIQGAVMFAFTLLI-----QYKFFYKPRLSLPKVQSEE---KEDVDVARERHRVHEGR-ANNDVLRICDLTKVY--------------------PRKSTPAVYRLCVGVPAAECFGLLGINGAGKTTTFKMLTGDIPVSSGEAFLNGYSIRTQMGDVHQNMGYCPQFDAINDLLNGREHLELYARLRGVPEEEVAMVAEWGIQKLGLVKYANKSAGTYSGGNKRKLSTAMALIGCPPVIFLDEPTTGMDPKARRFLWDCILSVIKEGR-SVVLTSHSMEECEALCTRMAIMVNGRFQCLGSIQHLKNRFGDGYTLIVRVG---GCPPDLKPVEDFV-EETFPGSVLKEKHHNTLQYQLLSQEGALAKIFTELTDHQQELDLEDYSVSQTTLDQVFVNFAK 2019          

HSP 3 Score: 174.481 bits (441), Expect = 1.725e-39
Identity = 114/350 (32.57%), Postives = 179/350 (51.14%), Query Frame = 2
Query: 2282 IENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNN-KASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNS------TNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLD 3310
            I +L K +P+  TPA+  L +    ++  G LG NGAGKTTT  +LTG +  +SG AF+    IR  M  +   +G CPQ + +   L   +H+  Y  L+G+ + E+       ++++GL K     +   SGG KRKLS AMA +G   +IFLDEPT G+DP +RR +WD I+      R+++LT+H M+E + LC R+AI+  G+ +C GS   LK  FGDGY L       ++   C  + K  E      +F+++  P S L ++          HN+      +       +F +L      L +  Y +S T+L++VF+  A +     H  ++ Q     +D
Sbjct: 1711 ICDLTKVYPRKSTPAVYRLCVGVPAAECFGLLGINGAGKTTTFKMLTGDIPVSSGEAFLNGYSIRTQMGDVHQNMGYCPQFDAINDLLNGREHLELYARLRGVPEEEVAMVAEWGIQKLGLVKYANKSAGTYSGGNKRKLSTAMALIGCPPVIFLDEPTTGMDPKARRFLWDCILSVIKEGRSVVLTSHSMEECEALCTRMAIMVNGRFQCLGSIQHLKNRFGDGYTLI------VRVGGCPPDLKPVE------DFVEETFPGSVLKEK---------HHNTLQYQLLSQEGALAKIFTELTDHQQELDLEDYSVSQTTLDQVFVNFAKE----QHDEEDLQAHDNPVD 2035          

HSP 4 Score: 172.17 bits (435), Expect = 9.092e-39
Identity = 109/354 (30.79%), Postives = 172/354 (48.59%), Query Frame = 1
Query: 5302 RKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLH--------------------------PNRNSL--------------SDRNEIETIINK---EIWSSARMKEENAVIIEYRFDSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRNIS 6234
            +K+AV+ +S    E +    LG NGAGKTTT  +L G    T G A+INGY I  D     K +G CPQ + L   LT EE +YFY R++G+ PS++   +D  +K++ L          +SGG +RK+  AIA +G  KIV LDEPT G+D  ARR +W L+  L  +    +IL++H+M+E ++L  R+AI+  G+M+  GS   LK  FG  YY+ +                             P+ +SL              +D   +   + K   E+     + +E   I+ Y        + +F+  + +     +  Y VS  +L+E+F+  A++  V + +S
Sbjct:  720 KKVAVDGLSVDFYENQITSFLGHNGAGKTTTMSILTGLFPPTSGTALINGYDIRTDMDSIRKYLGMCPQHNVLFDELTVEEHIYFYGRLKGLNPSELQTEMDQMIKDVGLLHKRKDLVKNLSGGMQRKLSVAIAFVGGSKIVILDEPTAGVDPFARRGIWDLL--LKYKKGRTIILSTHHMDEADILGDRIAIISHGKMRCCGSSIFLKKSFGSGYYLTLVRSGTEVMTAQRSGIISGIAEEKPTESDCPSSSSLDEDRGCQSSDNSNPADLKHVTQFVRKHVPEVVFLESIGQEITFILPYARARDGTFATLFQELDKVMDKLGLTSYGVSDTTLEEIFLKVAEDTGVDKELS 1071          
BLAST of ATP binding cassette subfamily A member 1 vs. TrEMBL
Match: A0A3S2MJM9 (Uncharacterized protein OS=Oryzias javanicus OX=123683 GN=OJAV_G00183080 PE=4 SV=1)

HSP 1 Score: 643.654 bits (1659), Expect = 0.000e+0
Identity = 425/1190 (35.71%), Postives = 648/1190 (54.45%), Query Frame = 2
Query:  152 LIIEMLIPLFVIFILVAVRRITSSYSMGTCELREKQMGSMGPIPFLRDFICTFNTSCYNTTQIDWTKNSINDFLTFMNNISSLYSSLYTTNFTVPGFVDWSNVNPNLYTQLLNSINYISPVISSFITSIKEMQTGDQTLINKNLKILGQLLCGSDQNDIDVF-------LQNFNLSLINSTKSIPTCQLAFMNYFTKSNGLSVLYPIIGPLVFGKIYYTPNSAFTQEIIRRANSTFRILDNLRLASVEWRLTFSNWLINNSTNMGLLNDARNYCANSRTLMCQIINNSLSIE-TIQSTIASLSAMFVLIENSLNCTQLNKFTPMPSSIDI-----DNLSKQSSLGILAGIVFTDDFQYVTPQNATFLNYQIRMPASRIDSTKNFKVLDRFWTPIPRVNTLTNFNYYTSGFLFLQEIIDQAFIELITDNASVNIGSSMQIMPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTXXXXXXXXXXXXXXXXXGKXXXXXXXXXXXXXXXXXXXXXXCQCFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQ-REENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSF------------------EIQSETCHNNKASESG--------------TKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADD--------PSQISHKRQEKQITSEMLDTLTDG--GNLPRPVSVLSFRKKTINT-------ANINGPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGLFSE 3532
            L++E++ PLF+  ILV VR  T   + G C    K M S G +P+L+  +C  +  C N      T   +N+F   +  IS +  +L      +P       ++  L+ +  N +N  +  ++S                N  +     LLCG + +    F         N N S  NS  S P C  +F++    +  +  L+    PL+ GKI YTP++   + ++  ANSTF  L  ++  +  W                + N   NY            N+    + T Q    +++ M  LI   L C +LNKF  +P+  D+     D+L+  +     AGIVF ++ Q  + +   +L Y+IRM    +  T   KV  R W+P    N   N  Y   GF +L+++ID A I L T + S  +G  +Q MPYPCY++D  I  +  ++P  L++A+  +V+  IK +V EKE RLKE +R +G+ N   W + F  TI++L +P +LM++++K GK+L +S P +IF+ L  +  + I QCF+ISVFF  +N+AA  GG++YF+ YLP ++   ++D +  +   GV LL+ V+F      +   E+   G Q+ N+  S     ++     ++M+ +D+V Y ++ WY+E VFPG+YG+P+PWYF FT  YW    KN    +  DNF   +  ++  +  EK   +++ G+ I NLVK +   K  A+D L++ FY++QIT FLGHNGAGKTTT+SILTG+  PTSGTA I   DIR DM+ IR  +G+CPQHN+LF  LTVE+HIYFYG LKG+ ++E+K ++  ++K+VGL  K K ++KNLSGGM+RKLS+A+AFVG S+I+ LDEPTAGVDPF+RRGIWDL++KY+   RTIIL+THHMDEAD L DRIAIIS GK++CCGSS+FLK++FG GYYL L +S                   E     C ++ + + G                + +F+++ +P +  ++    + T +L +       F +LF++LD  +D L + SYG+SDT+LEE+FLKVA+D        P++    +  K+ + E       G  G   +       ++K  N        A++NG           V+++G  LI +Q   LFIKRFHH +R+ KGL ++
Sbjct:   25 LLVEIVWPLFLFVILVTVRTTTKPSNKGQCHYPNKAMPSAGVLPWLQSMMCNIDNPCSNYPTPGETPGQVNNFNESI--ISEILINLQKFLLELPEEDPAGPLSKFLFME--NLLNSTAEAVNSL------------DFQNDPINSFSMLLCGKEPSSNSTFKFPTSKQTDNINSSFQNSQDSDPFCT-SFIDTLVNTPSMRFLWNNFRPLLRGKILYTPDTPAARLLVEEANSTFSALAAIKELADSW----------GKQGPVVWNFVENYTVLENDTAANFNNSDGDPQPTSQDVYNTVTQMLSLISKILGCFELNKFEAVPTEYDLVTKALDHLNNDT---FWAGIVF-ENLQPNSSRIPPYLKYKIRMQVEEVQRTD--KVESRLWSPGAGDNPYDNLRYIWGGFAYLEDMIDHAGIRLQT-SKSQPLGVFLQQMPYPCYVDDPFIQSIGAILPMFLILAFMSSVSMTIKGLVLEKELRLKEVLRAVGIQNGALWSATFIETIILLTVPCVLMSVMVKYGKVLQYSDPSVIFVFLLVFCFTTISQCFLISVFFSKANLAAACGGLIYFLLYLPHVLCYAWRDVMGFKAKVGVSLLSCVAFGYGCENLSKYEEQGVGIQWHNIAKSPEEGESYTFIVSILMMLLDAVIYWVLTWYIENVFPGQYGIPRPWYFPFTSSYWC--GKNAVPEDTPDNFDLLKGSSVQNECMEKPDPNMKAGVSIRNLVKVYKTGKKVAVDGLSVDFYENQITSFLGHNGAGKTTTMSILTGLFPPTSGTALINGYDIRTDMDTIRRCLGMCPQHNVLFNELTVEEHIYFYGRLKGLNRNELKTEMDQMIKDVGLLHKRKDLAKNLSGGMQRKLSVAIAFVGGSKIVILDEPTAGVDPFARRGIWDLLLKYKK-GRTIILSTHHMDEADILGDRIAIISHGKMRCCGSSIFLKKSFGSGYYLTLVRSGTEVMTAQRSGIIPGKAEEEPNESDCPSSSSLDEGFGSQSLDDSNPADLNPVTQFVRRHVPEAVFLESIGQEITFILPYARARDGTFATLFQELDRVMDKLGLTSYGVSDTTLEEIFLKVAEDTGVDKEATPTKEPAVKDYKKHSRESKRRTMSGFHGKAAKANGKAELKEKFCNKVEDCRKNASVNG--------RGSVVITGWELIRRQFLALFIKRFHHARRSRKGLIAQ 1169          

HSP 2 Score: 504.597 bits (1298), Expect = 0.000e+0
Identity = 310/898 (34.52%), Postives = 490/898 (54.57%), Query Frame = 1
Query: 3604 PSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMNTSLYQLENFKC-------LYP---------YNTNKWSEKSPIEISLVTPECDCSTTGNQI----CSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMKQYGGLQFILPSFFGQSCQVI-GESQIWFDFRQSIN-SSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNIS---GGDENYNAFEWDITGNKICSL---GILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERI-ELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFD-SSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAK 6207
            P++ + PW+           TFY  +   D  + ++ E    + G  G RCM      +    C         P         + T  WS  +P      +P C CST G  I    C     G      R+  ++D L +L+  N++D+L+K ++    K+YGG+     S  G + QV+  E +I   FR+  N       S PE        ++     G + N+ ++W  +KG+ SM ++ ++ +N +LR  +     ++ YG++++N+PL  ++  L     A    +V ++I VIF +SFIPASFV+FLI+ERV+ +K  Q+VSGVNP VYW+++F WD   Y I   +V++ F+ F  ++Y+   N+ A I+LL +Y  A+ P MYP SF  +  STA+VV++  NL +G   ++ TF ++L+  DD ++   ND +K++ L+FP + LGRG++D++ +     I    G D   +   W++TG  + ++   G++   + L+I     ++K     +L   K++  E    ED+DV +ER+R+ E   D   DVL++  LTK+Y                      K   AV+ +  GV   ECFGLLG+NGAGKTTTFKML G+  ++ G A +NGYSI       H+NMG+CPQFDA++ LL   E L  Y R+RG+   ++ +  +  ++ L L  + NK     SGGNKRK+ TA+ALIG P ++FLDEPT GMD  ARRFLW  I ++  E + +VILTSH+MEECE LC R+AIMV+G  + +GS+QHLK++FG  Y + +R+     +L     +E  + +E +  + +KE++   ++Y+       L+ IF      +    +++YSVSQ +LD+VF+NFAK
Sbjct: 1194 PNLELQPWMYGSSQ-----TTFYSDDTPDDANASRVVETLVDNPG-FGTRCMEGD--PIPRLPCSSGSSDWFSPSVDQSIADIFLTGNWSMSNP------SPPCQCSTPGRAIIMPDCPPGAGGL-PPPQRVQNTTDTLLNLTGMNMTDFLVKTYERSGKKRYGGI-----SVGGINSQVLLTEVEIKDAFRKLRNFLDWREESLPEDT--FQKVEMVLKKLGTRNNV-KVWFYNKGWHSMVSFLSVANNGILRGFLPEGLNVRQYGLSMSNHPLNLSKEQLSLTAMASTSSDVVVSICVIFAMSFIPASFVLFLIQERVSKAKHLQFVSGVNPAVYWVASFVWDICNYIIPCFLVVVIFICFQQKAYVSPPNLPALILLLVMYGWAITPMMYPASFIFTVPSTAYVVLTCVNLFIGINGSVATFVMELF--DDENITYINDIVKQVLLVFPHFCLGRGLMDMARNQAMATIFSRFGEDRFEDPLSWNMTGKNLVAMAIQGLVMFAFTLLI-----QYKFFYKPRLASPKIQSDE---KEDVDVARERQRVYEGRAD--RDVLRIRDLTKVY--------------------PRKSTPAVHRLCVGVPAAECFGLLGINGAGKTTTFKMLTGDIPVSSGEAFLNGYSIRTQMSDVHQNMGYCPQFDAINDLLNGREHLELYARLRGVPEDEVAMVAEWGIQKLGLVKYANKSAGTYSGGNKRKLSTAMALIGCPPVIFLDEPTTGMDPKARRFLWDCILSVIKEGR-SVILTSHSMEECEALCTRMAIMVNGRFQCLGSIQHLKNRFGDGYTLIVRVGGFPPAL---KPVEDFV-EETFPGSVLKEKHHNTLQYQLPYEEGALAKIFNELTQQQQRLDLEDYSVSQTTLDQVFVNFAK 2031          

HSP 3 Score: 177.948 bits (450), Expect = 1.403e-40
Identity = 112/337 (33.23%), Postives = 173/337 (51.34%), Query Frame = 2
Query: 2282 IENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLE-FIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQ 3289
            I +L K +P+  TPA+  L +    ++  G LG NGAGKTTT  +LTG +  +SG AF+    IR  M  +   +G CPQ + +   L   +H+  Y  L+G+ + E+       ++++GL K     +   SGG KRKLS AMA +G   +IFLDEPT G+DP +RR +WD I+      R++ILT+H M+E + LC R+AI+  G+ +C GS   LK  FGDGY L +                     K +E F+++  P S L ++        L +          +F +L      L +  Y +S T+L++VF+  A +     H+ ++ Q
Sbjct: 1723 IRDLTKVYPRKSTPAVHRLCVGVPAAECFGLLGINGAGKTTTFKMLTGDIPVSSGEAFLNGYSIRTQMSDVHQNMGYCPQFDAINDLLNGREHLELYARLRGVPEDEVAMVAEWGIQKLGLVKYANKSAGTYSGGNKRKLSTAMALIGCPPVIFLDEPTTGMDPKARRFLWDCILSVIKEGRSVILTSHSMEECEALCTRMAIMVNGRFQCLGSIQHLKNRFGDGYTLIVRVG------------GFPPALKPVEDFVEETFPGSVLKEKHHNTLQYQLPY---EEGALAKIFNELTQQQQRLDLEDYSVSQTTLDQVFVNFAKE----QHEEEDLQ 2040          

HSP 4 Score: 167.162 bits (422), Expect = 2.894e-37
Identity = 104/354 (29.38%), Postives = 171/354 (48.31%), Query Frame = 1
Query: 5302 RKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYV--------------------KIRLHPNRNSL--------------------SDRNEIETIINKEIWSSARMK---EENAVIIEYRFDSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRNIS 6234
            +K+AV+ +S    E +    LG NGAGKTTT  +L G    T G A+INGY I  D     + +G CPQ + L + LT EE +YFY R++G+  +++   +D  +K++ L          +SGG +RK+  AIA +G  KIV LDEPT G+D  ARR +W L+  L  +    +IL++H+M+E ++L  R+AI+  G+M+  GS   LK  FG  YY+                    K    PN +                      +D N +   + + +  +  ++   +E   I+ Y        + +F+  + +     +  Y VS  +L+E+F+  A++  V +  +
Sbjct:  724 KKVAVDGLSVDFYENQITSFLGHNGAGKTTTMSILTGLFPPTSGTALINGYDIRTDMDTIRRCLGMCPQHNVLFNELTVEEHIYFYGRLKGLNRNELKTEMDQMIKDVGLLHKRKDLAKNLSGGMQRKLSVAIAFVGGSKIVILDEPTAGVDPFARRGIWDLL--LKYKKGRTIILSTHHMDEADILGDRIAIISHGKMRCCGSSIFLKKSFGSGYYLTLVRSGTEVMTAQRSGIIPGKAEEEPNESDCPSSSSLDEGFGSQSLDDSNPADLNPVTQFVRRHVPEAVFLESIGQEITFILPYARARDGTFATLFQELDRVMDKLGLTSYGVSDTTLEEIFLKVAEDTGVDKEAT 1075          
BLAST of ATP binding cassette subfamily A member 1 vs. TrEMBL
Match: N1PB02 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_226736 PE=4 SV=1)

HSP 1 Score: 642.499 bits (1656), Expect = 0.000e+0
Identity = 398/1044 (38.12%), Postives = 597/1044 (57.18%), Query Frame = 2
Query:  563 TLINKNLKILGQLLCGSDQNDIDVFLQNFNLSLINSTKSIPTCQLAFMNYF---TKSNGLS-VLYPIIGPLVFGKIYYTPNSAFTQEIIRRANSTFRILDNLRLASVEWRLTFSNWLINNSTNMGLLNDARNYC-----ANSRTLMCQIINNSL-------SIETIQSTIASLSAMFVLIENSLNCTQLNKFTPMPSSIDIDN--LSKQSSLGILAGIVFTDDFQYVTPQNATFLNYQIRMPASRIDSTKNFKVLDRFWTPIPRVNTLTNFNYYTSGFLFLQEIIDQAFI-ELITDNASVNIGSSMQIMPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTXXXXXXXXXXXXXXXXXGKXXXXXXXXXXXXXXXXXXXXXXCQCFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEK-----------SFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKK----------------------TINTANI--NGPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGLFSE 3532
            TL+  +  +L +LLCG     +           I   K       AF N      +S  L+ + +  I P+V GKI Y P++   + +IR AN TF  L  ++  + +W L  S  +    +N     + R++      +N       ++   L       S    + +I     +  +I   +NC + +KF P  +  D+ N  L+      + AG++F  D     P   T + Y+IRM   R+DST   +VLDRFWTP PR   L +  Y   GF ++Q++++ A I E   D+   +IG ++Q  PYPCY+ND+    +S  +P  ++++W  AV+ L+K+IVYEKE RLKE M+ MG++N VHW +WF +  ++++L + L+ I+LK+G +L  S   +IF+ L  + ++ I QCFMISVFF  +N+AA   GI+YFI ++P+     +++ + T       LL+ VSF    ++I   E+   G Q+SN+  S + + +F +  C+ M+ +D++ Y++IAWYVEAVFPG++G+P+ WYF  T+ YW  +    D +   +     E +    G E EP  L +G+ I+ L K + + +  A+D LNL FY+ QIT FLGHNGAGKTTT+SILTG+  PT GTA I   DIR D+  IR  +G+CPQHN+LF +LTVE+HI+FY  LKGM + +I+ ++  ++ ++GL  K    S  LSGGMKRKLS+A+AF   S+++ LDEPTAGVDP++RR IWDL++KYR+  RTIIL+TH MDEAD L DRIAII+QGKL C GSSLFLK NFG GYYL L K             ++++ T   N    S T    FI + +P + L++    + T  L ++ ++   F  LF  LD+ L  L + SYG+SDT+LEEVFLKVA++  + +H  +E     +  + LTDGG   RPV+ LSFRK+                       ++TA+I  NG   S++       ++GLSLI +Q   +FIKRF++ +R+ K   S+
Sbjct:  321 TLLGNSSILLSELLCGHSGGIVQ----------ITENKGGMFSSAAFCNDLFEQIESQQLTRIFWRQIKPMVRGKIPYAPDTPVVRRLIREANQTFVTLVQVKQLAEDW-LKASPGISEFLSNSDQARNIRDFIDLYMMSNPGDAQIALVQRWLFNGPRDQSAYDWRDSIEYTDYVMTMIVQYMNCFEFDKFEPHKTEEDVVNTGLTYIGDNKLWAGLIFDIDSSENLP---THIKYKIRMDTDRVDSTSKSRVLDRFWTPGPRAKPLPDMKYVVYGFSYIQDMVEHAIIREHTGDSLDEDIGMTVQQFPYPCYINDKFTMAISRSLPLFMILSWIYAVSILVKAIVYEKEQRLKEVMKTMGLTNAVHWCAWFITAFVMMLLSVFLLLIVLKVGTVLEHSDGSVIFVFLLAFTIATIMQCFMISVFFQRANLAAACAGILYFIGHIPYTFCTQWEEYMRTWQKALASLLSSVSFGFGCSYIARYEEQGIGIQWSNIHQSVLQEDDFSMLACIFMMLVDALIYMIIAWYVEAVFPGQFGMPRSWYFFVTKSYWCGYEPGTDGM--PNGRAGYEMDSGQQGQEDEPKHLPLGVSIQKLCKVYKRGQKVAVDGLNLNFYEGQITSFLGHNGAGKTTTMSILTGLFPPTEGTAVIYGQDIRTDINEIRKSLGMCPQHNVLFDHLTVEEHIWFYSSLKGMPEEDIRKEMNAMIMDIGLPHKRNEYSAKLSGGMKRKLSVAIAFTAGSKVVILDEPTAGVDPYARRSIWDLLLKYRA-GRTIILSTHFMDEADILGDRIAIINQGKLCCVGSSLFLKSNFGGGYYLTLVKDERKGDSASTSDVKVENATEDGNAGEISTTA---FIMERVPEAVLVESIGIEMTYQLPNDKSHTASFEKLFRDLDAHLSSLGLLSYGVSDTTLEEVFLKVANESEEANHLSEED--VRQGTERLTDGGMYARPVTRLSFRKRNFFASKDRESNELLDADGNPDSAVSTASISCNGTG-SYK-------VTGLSLIPRQFLAIFIKRFNYLRRSKKAFISQ 1334          

HSP 2 Score: 589.341 bits (1518), Expect = 0.000e+0
Identity = 337/887 (37.99%), Postives = 524/887 (59.08%), Query Frame = 1
Query: 3592 MDNQPSMTISPWLMMP-KTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMNTSLYQLENFKCLYPYNTNKWSEKSPIEISLVTPE-CDCSTTGNQICSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMKQYGGLQFILPSFFGQSCQVIGESQIWFD--FRQ-SINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNI--SGGDENYNA-FEWDITGNKICSLGILFVGWCLIIVFMESKH--KKTLCIK-LKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIIN--KEIWSSARMKEENAVIIEYRFDSSV--KLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAK 6207
            +  +P+M I PWLM P K +  +L TF+  +  S+  +  + +      G  GVRCM+  +Y L+ F+C+   ++ +WS    +E     PE C C + G Q C    + G E+S  ++ ++D +Y+++  NISD+++K  + +I ++YGGL F      G+   ++  +    D  F Q +  ++ D+ +N      +   +    +   K N ++IW N+KGY+SM AY NI +NL+LR+ +        YGI++ N+P+  T S L+++      ++V +++ VIF +  IPASFV+FLIEERV+GSK  Q+VSGVNP VYW++NF WD + Y +S ++ IL F+AF   +Y+   N    + LL LY  A  P MYP S F +  S+AFV++   N+ +G ++T++TF L+ +   +  L   N  + K+FL+ P Y LGRG+ID++ + L  +I  + G+  + + F WDI G  + SL IL V +  + + +E K       CI   K+      E   +ED+DV +ERER+ L      D+L + GLTK+Y   +                ++K   AV+ +S GV  GECFGLLGVNGAGKTTTFKML G    T G+A + G+SI  +    H+N+G+CPQFDAL  LLT  E L  Y R+RG+   D+    +  ++ L L  H  K ++ +SGGNKRK+ TAIAL+G P ++FLDEPT GMD  ARRFLW  I  +  + + +V+LTSH+MEECE LC+R+ IMV+G+ K IGS+QHLK++FG  Y + +++    +S + + +I+ + +  +  +    +KE++  +++Y+  SSV   L+DIF   E +R    +++YSVSQ +LD+VFINFAK
Sbjct: 1332 ISQEPAMEIHPWLMSPSKLQDSHLFTFFSNDLPSEAWTQAIEDLLTQKPGL-GVRCMDPDVYSLKGFRCVDAEDS-QWSN---VEEDFDEPEECSCES-GYQRCPKG-AAGAEASKYLLPTTDEMYNMTGRNISDWILKTSQEYIKRRYGGLTF------GERNDLLRANDTEVDSIFAQLATAAAGDDTNNVTLPGLILDLENLIKNIATKRN-AKIWFNNKGYVSMVAYMNIMNNLVLRAHLPPDTDPSRYGISLINHPMNRTSSQLYAYTLKASIVDVMISVSVIFAMCLIPASFVLFLIEERVSGSKHLQFVSGVNPVVYWVANFTWDMLNYLVSGILCILIFVAFQQNAYVSQTNAPCLVSLLLLYGWAATPMMYPASHFFNVPSSAFVILGCMNIFLGIISTLSTFILEAFM--EQELDEINAIIMKVFLVLPHYCLGRGLIDMTRNQLVADIFENLGETFFQSPFTWDIVGRNLLSLSILGVFFFFLNICIEYKFWIYSMKCISPCKEQIPVNVEETDEEDIDVVRERERVTLGA-ASGDILTLEGLTKVYKSPL----------------KNKGHRAVDRLSVGVHSGECFGLLGVNGAGKTTTFKMLTGNIKSTDGDAHLAGHSIRSEMTAIHQNLGYCPQFDALCPLLTPREHLQMYARLRGVPAEDVDTVAEWGIEKLGLVNHAAKLSHQLSGGNKRKLSTAIALVGNPPVIFLDEPTTGMDPKARRFLWNCISGIIKDGR-SVVLTSHSMEECEALCNRIVIMVNGQFKCIGSIQHLKNRFGDGYMITLKV--TSSSDASQCQIQAVASNMESTFPGIVLKEQHHNMLQYQVPSSVHTSLADIFGHIERVREEMSIEDYSVSQTTLDQVFINFAK 2182          

HSP 3 Score: 174.481 bits (441), Expect = 1.697e-39
Identity = 119/371 (32.08%), Postives = 188/371 (50.67%), Query Frame = 2
Query: 2162 IPFSKNNDNIEISDNFRQREENITIDGFEKEPDDLEIGILIENLVKKFPKSKTP-------ALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHN--STNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVA 3247
            IP +    + E  D  R+RE  +T+     +       + +E L K +   K+P       A+D L++  +  +  G LG NGAGKTTT  +LTG +  T G A +  + IR +M  I   +G CPQ + L   LT  +H+  Y  L+G+   ++       ++++GL      +S  LSGG KRKLS A+A VGN  +IFLDEPT G+DP +RR +W+ I       R+++LT+H M+E + LC+RI I+  G+ KC GS   LK  FGDGY + L+ +    +  C     + +       ++   P   L    K Q   +L +   S+       +F  ++   + + I  Y +S T+L++VF+  A
Sbjct: 1832 IPVNVEETDEEDIDVVRERER-VTLGAASGDI------LTLEGLTKVY---KSPLKNKGHRAVDRLSVGVHSGECFGLLGVNGAGKTTTFKMLTGNIKSTDGDAHLAGHSIRSEMTAIHQNLGYCPQFDALCPLLTPREHLQMYARLRGVPAEDVDTVAEWGIEKLGLVNHAAKLSHQLSGGNKRKLSTAIALVGNPPVIFLDEPTTGMDPKARRFLWNCISGIIKDGRSVVLTSHSMEECEALCNRIVIMVNGQFKCIGSIQHLKNRFGDGYMITLKVTSSSDASQCQIQAVASN-------MESTFPGIVL----KEQHHNMLQYQVPSSVHTSLADIFGHIERVREEMSIEDYSVSQTTLDQVFINFA 2181          

HSP 4 Score: 162.155 bits (409), Expect = 8.865e-36
Identity = 110/330 (33.33%), Postives = 171/330 (51.82%), Query Frame = 1
Query: 5302 RKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYY---VKIRLHPNRNSLSD---RNEIETIINKEIWSSARMKEE--NAVIIE-------YRFDS----SVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRNIS 6234
            +K+AV+ ++    EG+    LG NGAGKTTT  +L G    T G A+I G  I  D  +  K++G CPQ + L   LT EE ++FY+ ++G+   DI   ++  + ++ L    N+ +  +SGG KRK+  AIA     K+V LDEPT G+D  ARR +W L+  L       +IL++H M+E ++L  R+AI+  G++  +GS   LKS FG  YY   VK     +  S SD    N  E     EI ++A + E    AV++E       Y+  +    +     +FR  +   ++  +  Y VS  +L+EVF+  A       ++S
Sbjct:  908 QKVAVDGLNLNFYEGQITSFLGHNGAGKTTTMSILTGLFPPTEGTAVIYGQDIRTDINEIRKSLGMCPQHNVLFDHLTVEEHIWFYSSLKGMPEEDIRKEMNAMIMDIGLPHKRNEYSAKLSGGMKRKLSVAIAFTAGSKVVILDEPTAGVDPYARRSIWDLL--LKYRAGRTIILSTHFMDEADILGDRIAIINQGKLCCVGSSLFLKSNFGGGYYLTLVKDERKGDSASTSDVKVENATEDGNAGEISTTAFIMERVPEAVLVESIGIEMTYQLPNDKSHTASFEKLFRDLDAHLSSLGLLSYGVSDTTLEEVFLKVANESEEANHLS 1235          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Cavefish
Match: ENSAMXT00000016919.2 (pep primary_assembly:Astyanax_mexicanus-2.0:8:9912642:9956080:1 gene:ENSAMXG00000016432.2 transcript:ENSAMXT00000016919.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 623.239 bits (1606), Expect = 0.000e+0
Identity = 422/1252 (33.71%), Postives = 655/1252 (52.32%), Query Frame = 2
Query:  146 FSLIIEMLIPLFVIFILVAVRRITSSYSMGTCELREKQMGSMGPIPFLRDFICTFNTSCYNTTQIDWTKNSINDFLTFMNNISSLYSS-----LYTTN-FTVPGFVDW----SNVNPNLYTQLLNSINYIS-------PVISSFITSIKEMQT-----GDQTLINKNL--------KILGQLLCGS--------------DQNDIDVFLQNFN------LSLINSTKSIPTCQLAFMNYFTKSNGLS-VLYPIIGPLVFGKIYYTPNSAFTQEIIRRANSTFRILDNLRLASVEWRLTFSN-W-LINNSTNMGLLNDARNYCANSRTLMCQIINNSLSIETIQSTIASLSA--------------------MFVLIENSLNCTQLNKFTPMPSSIDIDNLSKQSSLGIL------AGIVFTDDFQYVTPQNATFLNYQIRMPASRIDSTKNFKVLDRFWTPIPRVNTLTNFNYYTSGFLFLQEIIDQAFIELITDNASVNIGSSMQIMPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTXXXXXXXXXXXXXXXXXGKXXXXXXXXXXXXXXXXXXXXXXCQCFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKS------------FEIQSETCHNNKASESGTK-------------------LLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPS-----------QISHKRQEK--QITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANINGPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGLFSE 3532
              L+IE++ PLF+ FIL+AVR     Y    C    K M S G +P+++  +C  N  C+       +   + +F   +  IS L+S      LY+ N  ++ GF +       +  N   +    + + S       P+ S     +  M++      +   + +N         + + +++CG               + ++      N+N      +S+ ++T S P C     N   ++N +S +++  + PL+ GKI YTP++  T +II+  N TF+ L  LR     W  T    W  + +S  M LL         +     Q+     S++ + S +   S                       + I   + C  L+K  P+ +   + N     SLG+L      AGI+F D  Q  + +    +NY+IRM    ++ T   K+ D +W P PR +   +  Y   GF +LQ++I+Q+ I  +T       G  +Q MPYPCY++D  +  +S  MP  + +AW  +V  +IK +VYEKE RLKE MR+MG+ N + W SWF S+++ L++   L+ ++LK+G +L +S P ++FL L  + V  I QCF+IS  F  +N+AA  GGI+YF  YLP+++ + +QD +         LL+ V+F     +    E+   G Q+ NLF+S +   ++ +   +I++++D+  Y ++ WY+EAVFPG+YG+P+PWYF FT+ YW        +   +   + R+ N      E+EP  L++G+ IENLVK +   K  A+D+L L FY+ QIT FLGHNGAGKTTT+SILTG+  PTSGTA+I+  DIR ++  IR  +G+CPQHN+LF+ LTVE+H++FY  LKG+++ E+K ++  I+ + GL  K K  +  LSGGM+RKLS+A+AFVG S+++ LDEPTAGVDP++RRGIWDL++KYR+  RTIIL+THHMDEAD L DRIAIIS GKL C GSSLFLK + G GYYL L K                 S    +++ASES +                    +   I K +PN++++++   + T +L + S     F  LF  +D  L  L I+SYG+SDT+LEE+FLKVA+D              I  +R+          L  LT+        S +    +  +  + +  K S++ +       G SL  QQ   L  KRF + +R+ KG F++
Sbjct:   23 LQLLIEIVWPLFIFFILIAVRLNYPPYEQHECHFPNKAMPSAGTLPWIQGIVCNANNPCFRHPTPGESPGVVGNFNDSI--ISRLFSDAKKILLYSQNDKSLDGFKELIHAVKALQNNTSGKQAVGVTFKSLGKLLEMPLTSLMFPQLASMRSWSDLRNEILFLTRNATGSPSQMYQAVSRIVCGHPEGGGLKIKSLNWYEDSNYKALFGNYNSSDEEPVSVYDNT-STPFCNNLMKN--METNPISRMIWRALKPLLMGKILYTPHTPATHKIIKEVNRTFQELGVLRDLGGMWEETRPKAWNFMEHSEEMDLLRTLLQNNVTAAFFSAQLTGTQWSVQDVISFLTKQSEDTRPHGTAFTWRDVFNETDQAIMSISRFMECVNLDKLEPVSTEEKLIN----DSLGLLDNRKFWAGIIFPD-IQSNSSELPPHVNYKIRMDIDNVERTN--KIKDAYWDPGPRADPFEDLRYVWGGFSYLQDVIEQSIIRAVTGTKE-KTGVYIQQMPYPCYVDDIFLRVMSRSMPLFMTLAWMYSVAIIIKGVVYEKEARLKETMRIMGLDNGILWFSWFISSLIPLLMSAGLLVLLLKMGNLLPYSDPGVVFLFLGSFAVVTIMQCFLISTVFARANLAAACGGIIYFTLYLPYVLCVAWQDYIGLPAKVIASLLSPVAFGFGCEYFALFEEQGVGIQWKNLFSSPMEKDDYSLTTSIIIMYVDAFIYGVMTWYIEAVFPGQYGIPRPWYFPFTKSYWF----GEGDQRPTPILKGRKANSGAVCIEEEPTHLDMGVYIENLVKVYRHGKKLAVDDLTLGFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYIMGKDIRSELSAIRQSLGVCPQHNVLFSMLTVEEHVWFYARLKGLSEEEVKAEIDQILYDTGLPHKRKSRTCELSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYARRGIWDLLLKYRT-GRTIILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKTHLGTGYYLTLVKKEPEASLSSCRNSSSTVSYVKKDDEASESSSDAGLGSDHESDAATAIDISLISGLIIKHVPNARMVEDLGHEITYILPYESAKDGAFVELFHDMDDHLADLGISSYGVSDTTLEEIFLKVAEDSGVDTEILSDGTFPIRRRRRHAFGADHQSCLKPLTEDDRYDGNESEVDPESRETDYLSGSDGKGSYQIQ-------GWSLKRQQFLALLWKRFLYARRSRKGFFAQ 1249          

HSP 2 Score: 506.908 bits (1304), Expect = 0.000e+0
Identity = 317/905 (35.03%), Postives = 493/905 (54.48%), Query Frame = 1
Query: 3604 PSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMNTSLYQLENFKCLYPYNTNKWS----EKSPIEISL--------VTPECDCSTTGNQI----CSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMK-----------QYGGLQFILPSFFGQSCQVIGESQIWFDFRQSINSSRD--NNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNIS---GGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLH-PNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSV-KLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDS 6216
            PS+ + PW+   +       TF   +   D  + +L        G  G RCM      + +  C      + WS     +S +E+ +         +P C+CS+ G +     C +   G P    +I +  D L +L+  NISDYL+K +   I K           +YGG      S   +S QV+  ++   +   +I   R   N       +FL     F N    K N+ +IW N+KG+ S+ A+ N+ +N +LR+ +   K    YGI   N+PL  T+  L         ++V ++I VIF +SF+PASFV+FLI+ERV  +K  Q++SGV P++YW++NF WD   Y +   +VIL F+ F  ++Y+ + N+    +LL LY  ++ P MYP SF     STA+VV+++ N+L+G   +++TF L+L+  ++  +   ND LK + LIFP + LGRG+ID+  +    +     G +   + FEWD+ G  + ++ +  V + +I V ++ +          + KL P   I +ED DV +ER+RI ++     D+L++  LTK+Y                    + K+K AV+ +  G+  GECFGLLGVNGAGKTTTFKML G+  +T G A +   SI+ +  + H+NMG+CPQFDA++ LLT  E L FY  +RG+   ++    +  ++ L L  + +K     SGGN RK+ TA+ALIG P +VFLDEPT GMD  ARR LW  I ++  E + +V+LTSH+MEECE LC R+AIMV+G  + +GSVQHLK++FG  Y + +R+  P+     D   +   I  E+  S  +KE++  +++Y+  SSV  L+ IF +    +    +++YSVSQ +LD+VF+NFAK+ S
Sbjct: 1274 PSLALQPWMYEDQV------TFISDDAPEDASTQRLLAALMEGPG-FGTRCMEGE--PIPDAPCTI--GDDDWSIPEVPESVLEVLMSQNWTMDNPSPACECSSDGKKKMLPECPASAGGLPPPQIKI-SERDTLQNLTGRNISDYLVKTYAQIIGKSLKNKVWVNEFRYGGF-----SLGARSTQVLPPAE---EIDDAIARVRVIFNLEKVTADRFLKSLSAFINGLDTKNNV-KIWFNNKGWHSIGAFLNVMNNGILRANLPPEKDPSKYGITAFNHPLNLTKEQLSQVALVTTSVDVLVSICVIFAMSFVPASFVVFLIQERVNKAKHMQFISGVQPFLYWLANFIWDMCNYVVPATLVILIFVCFQQKAYVSATNLPVLALLLLLYGWSITPLMYPASFLFEIPSTAYVVLTSVNILIGINGSVSTFVLELFGNNE--IGGINDILKNVLLIFPHFCLGRGLIDMVKNQAMADALERFGENRFRSPFEWDMVGKNLFAMAVEGVVFFIITVLIQYRF-----FFKPNAKLSP---IGEEDEDVARERQRI-VSGAGQGDILELRELTKVY--------------------KRKQKPAVDRLCVGIPPGECFGLLGVNGAGKTTTFKMLTGDTVVTSGEAFLARKSILREIDQVHQNMGYCPQFDAINDLLTGREHLEFYAILRGVPEREVCEVAEWGIRKLGLVKYSDKAAGSYSGGNMRKLSTAMALIGGPPVVFLDEPTTGMDPKARRALWNCIHSVIKEGR-SVVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGYTIILRVAGPD----PDLQPVMKFIESELPGST-LKEKHRNMLQYQLPSSVSSLAHIFSILAKHKDFLRIEDYSVSQTTLDQVFVNFAKDQS 2120          

HSP 3 Score: 188.348 bits (477), Expect = 3.756e-47
Identity = 121/368 (32.88%), Postives = 194/368 (52.72%), Query Frame = 2
Query: 2192 EISDNFRQREENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVA----DDPSQISHKRQE 3283
            E  D  R+R+  ++  G   + D LE+      L K + + + PA+D L +     +  G LG NGAGKTTT  +LTG    TSG AF+    I  +++ +   +G CPQ + +   LT  +H+ FY +L+G+ + E+       ++++GL K     + + SGG  RKLS AMA +G   ++FLDEPT G+DP +RR +W+ I       R+++LT+H M+E + LC R+AI+  G+ +C GS   LK  FGDGY + L  +                   +++FI+  +P S L ++ +      L  + ++      +F  L    DFL+I  Y +S T+L++VF+  A    DD S  S +R+E
Sbjct: 1786 EDEDVARERQRIVSGAG---QGDILEL----RELTKVYKRKQKPAVDRLCVGIPPGECFGLLGVNGAGKTTTFKMLTGDTVVTSGEAFLARKSILREIDQVHQNMGYCPQFDAINDLLTGREHLEFYAILRGVPEREVCEVAEWGIRKLGLVKYSDKAAGSYSGGNMRKLSTAMALIGGPPVVFLDEPTTGMDPKARRALWNCIHSVIKEGRSVVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGYTIILRVA-----------GPDPDLQPVMKFIESELPGSTLKEKHRNMLQYQLPSSVSS---LAHIFSILAKHKDFLRIEDYSVSQTTLDQVFVNFAKDQSDDHSDHSIRRKE 2132          

HSP 4 Score: 165.622 bits (418), Expect = 3.550e-40
Identity = 114/363 (31.40%), Postives = 181/363 (49.86%), Query Frame = 1
Query: 5302 RKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKP-TYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVK-IRLHPN----------------------RNSLSD-------RNEIETIINKEIWSS--------ARMKE----ENAVIIEYRFDSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSV-TRNISNGNALIQK 6258
            +KLAV++++ G  EG+    LG NGAGKTTT  +L G    T G A I G  I  +     +++G CPQ + L S+LT EE ++FY R++G+   ++   +D  L +  L PH  K  T  +SGG +RK+  A+A +G  K+V LDEPT G+D  ARR +W L+  L       +IL++H+M+E ++L  R+AI+  G++  +GS   LK+  G  YY+  ++  P                         S SD        ++  T I+  + S         ARM E    E   I+ Y         ++F   +D   +  +  Y VS  +L+E+F+  A++  V T  +S+G   I++
Sbjct:  808 KKLAVDDLTLGFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYIMGKDIRSELSAIRQSLGVCPQHNVLFSMLTVEEHVWFYARLKGLSEEEVKAEIDQILYDTGL-PHKRKSRTCELSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYARRGIWDLL--LKYRTGRTIILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKTHLGTGYYLTLVKKEPEASLSSCRNSSSTVSYVKKDDEASESSSDAGLGSDHESDAATAIDISLISGLIIKHVPNARMVEDLGHEITYILPYESAKDGAFVELFHDMDDHLADLGISSYGVSDTTLEEIFLKVAEDSGVDTEILSDGTFPIRR 1167          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Cavefish
Match: ENSAMXT00000022236.2 (pep primary_assembly:Astyanax_mexicanus-2.0:21:13397857:13560117:1 gene:ENSAMXG00000021540.2 transcript:ENSAMXT00000022236.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 581.637 bits (1498), Expect = 0.000e+0
Identity = 364/997 (36.51%), Postives = 554/997 (55.57%), Query Frame = 2
Query:  644 NFNLSLINSTKSIPTCQLAFMNYFTKSNGLSVLYPIIGPLVFGKIYYTPNSAFTQEIIRRANSTFRILDNLRLASVEWRLTFSNWLINNSTNMGLLNDARNYCANSRTLMCQIINNSLSIETIQSTIASLSAMFVLIENSLNCTQLNKFTPMPSSIDIDNLSKQSSLGIL------AGIVFTDDFQYVTPQNATFLNYQIRMPASRIDSTKNFKVLDRFWTPIPRVNTLTNFNYYTSGFLFLQEIIDQAFIELITDNASVNIGSSMQIMPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTXXXXXXXXXXXXXXXXXGKXXXXXXXXXXXXXXXXXXXXXXCQCFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAI-NFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENITIDG----FEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASE-------------SGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQIS----------HKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANINGPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGLFSE 3532
             F L+L+N+ K  P+              L + +  + PL+ G++ YTP++ FT+ I+ +ANSTF  L  + L +         WL N         +   +    R                      +     +    L C  L+KF      +  ++L  Q +L +L      AG+VFTD    +     + + Y+IRM     D+ +  K+ DR W+P  R N   +  Y   GF++LQ+++D+  +   T      +G  +Q MPYPCY++D  +S +S ++P  LV+A+  +V  +IK +V EKE RLKE +RV+G+ N   W++WFT  +++L +P  L+++++K GK+L +S P +IF+ L  + ++ + QCF ISVFF  +N+AA  GG++YF+ YLP ++   ++D ++        LL+ V+F     NF  Y EQ   G Q+SN+F S+  D  +     ++M+ +D++ Y ++ WY+E VFPG+YG+PKPWYF FT  YW      +D            E   +DG     EK P  L+ G+ I NLVK +      A+D L+L FYQ  IT FLGHNGAGKTTT+SILTG+  PTSGTA++   DIR DM+ IR K+G+CPQHN+LF  LTVE+HIYFY  LKG +  E+K ++  ++K+VGL  K K ++KNLSGGM+RKLS+A+AFVG S ++ LDEPTAGVDP++RRGIW+L++KY+   RTIIL+THHMDEAD L DRIAIIS G++ CCGSSLFLK+ +G GYYL L ++ + +    H ++  +             +   L   +++ +P +  ++    +   +L +  +    F SLF++LD   + L I+SYG+SDTSLEEV          +S           KR  ++  +  +             S +  ++K  +  +     V    + + V +SG  LI  Q   LFIKRFHH +R+ KG+ ++
Sbjct:  165 EFCLNLVNTLKGTPS--------------LRLFWTALRPLLQGRVLYTPDTPFTRRIMEQANSTFDALSKVELLA-------DAWLENEDEIWKFFQNISCFTPPLREAF---------------VCTCVCVCVCVCVCVLQCFDLDKF----EGVSSESLLVQQALKLLDEERFWAGVVFTD----LDSGEPSLVRYKIRMDVE--DTERTDKIKDRSWSPSARDNPFNDLRYVRGGFVYLQDMLDRGIVRAQT-GIRETLGVFVQQMPYPCYVDDAFVSSISTILPMFLVLAFMNSVGQIIKGLVLEKELRLKEVLRVVGVQNGPLWLAWFTENMVLLSVPCALISVMVKYGKVLRYSDPSVIFVFLLVFCMATVMQCFFISVFFSRANLAAACGGLIYFLLYLPHVLCQAWRDVITFRAKLATSLLSCVAFGYGCENFARYEEQGV-GIQWSNIFVSSQEDDPYSFFVSIVMMLVDTLMYWILTWYIENVFPGQYGIPKPWYFPFTSSYWCGTPVGSDT-----------EPDALDGSSRYLEKPPPGLKAGVSIRNLVKVYKTGNKLAVDKLSLDFYQDHITSFLGHNGAGKTTTMSILTGLFAPTSGTAYVNGFDIRRDMDTIRKKLGMCPQHNVLFNELTVEEHIYFYARLKGRSSGEVKQEIEQMIKDVGLPHKRKELAKNLSGGMQRKLSVAIAFVGGSSVVILDEPTAGVDPYARRGIWELLLKYKQ-GRTIILSTHHMDEADILGDRIAIISHGRVCCCGSSLFLKKTYGSGYYLTLVQANQERGARKHQSQCDDFSLDEGIGSSSLSNVADLSALVRRHVPEAVFLEVLGQELVYILPYTGSKDGSFASLFKELDLEKERLGISSYGISDTSLEEVHTLAQTHTHTLSIQYKDTLVRDWKRSSRESRTHSIS------------SAMEQKEKESSKCDDQRQSVCLNGKGSSV-MSGWPLIRHQFLALFIKRFHHARRSRKGIIAQ 1088          

HSP 2 Score: 438.728 bits (1127), Expect = 0.000e+0
Identity = 297/905 (32.82%), Postives = 471/905 (52.04%), Query Frame = 1
Query: 3604 PSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMNTSLYQLENFKCLYPYNTNKWSEKS--PIEISLV----------TPECDCSTTGNQI----CSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMKQYGGLQFILPSFFGQSCQVIGESQIWFDFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIK----TNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLS--------FSYLRYNISGGDENYNAFEWDITGNKICSL---GILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKI----YNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFD-SSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKN 6210
            PS+ + PW M  K +    NTFY  +  ++     +  +  ++ G  G RCM ++   +  + C+ P     WS  +  P  + +           +P+C CST    I    C     G P    R  +++D L++L+SYN++D+L+K +      +YGG+     S  G + QV+            +N S       E +  ++ F+  FNS+ +     T+LS +W  ++G+ ++ ++ N+ SN +LR+++ +    + YGI+  N+PL  T+  +     A    +V ++I VIF +SFIPASFV+FLI+ERV+ +K  Q+VSGVNP  YW++NF WD   Y +  LIVI+ FL F  +SY+   N+ A I+LL LY  ++ P MYP SF  S  STA+VV++  NL +G   ++ TF ++L  +DD ++   ND +K++ LIFP + LGRG+ID++        FS L     G D   +   WD+ G  + ++   G++  G+ L+I +         C K   VK  P   +  ED DV +ERER+       ND+L++  LTK+    ++P +        K+ +++ +                   CFGLLG+NGAGKTTTFKML G+   + G A +NGYS+  +  + H+NMG+CPQFDA+  LLT  E L FY R+RG+   ++    +  ++ L L  + NK     SGGNKRK+ TA++LIG P +VFLDEPT GMD  ARRFLW              IL   ++         LA +                +FG  Y V +R+   +   +D + +E  +++    S  +KE++   ++Y+   +   LS +F  F   +    V++YSVSQ +LD+VF+NFA+ 
Sbjct: 1113 PSLELQPW-MYGKPQ----NTFYSTDRPTEAAVTSVTRSLLNEPG-FGTRCMESN--PIPKYPCV-PAGATDWSTPAVDPAILKIFQDGNWTMQNPSPDCQCSTPERNIMLPDCQPGAGGLPPP--RTQSTTDTLHNLTSYNMTDFLLKTYAKSGKIRYGGI-----SVGGVNSQVM------------LNES-------EIIAAVSDFKALFNSTQVSQTLCTSLSLVWFYNQGWHAIASFLNVASNAILRASLPSRLQPKLYGISAFNHPLNLTKQQM----SAAFSTDVVVSICVIFAMSFIPASFVLFLIQERVSKAKHLQFVSGVNPAGYWVANFTWDMCNYIVPCLIVIIIFLCFQQKSYVSPPNLPALILLLILYGWSITPMMYPASFLFSVPSTAYVVLTCINLFIGINGSVATFVMEL--FDDPNITRINDIMKQVLLIFPHFCLGRGLIDMAKNQAMATLFSSL-----GEDRFKDPLGWDMVGKNLFAMAVEGVVMFGFTLLIQY-------KFCWKPGLVKGLPVS-LGQEDEDVARERERVH-KGGAENDLLRICDLTKVLLLSFSPHVS-------KSCLSLPA-------------------CFGLLGINGAGKTTTFKMLTGDITASGGEAFLNGYSMRTEMGQVHQNMGYCPQFDAIDDLLTGREHLEFYARLRGVPEQEVASVAEWGIQKLGLVKYSNKSAGTYSGGNKRKLSTAMSLIGCPPVVFLDEPTTGMDPKARRFLWD------------CILIKSSITHFPTTPLALAFLY---------------RFGDGYTVIVRV---QGGATDLSAVEDFVSRSFPGSV-LKEKHHNTLQYQIPYTEGALSHMFNQFSKNQHALGVEDYSVSQTTLDQVFVNFARQ 1905          

HSP 3 Score: 160.614 bits (405), Expect = 9.146e-39
Identity = 103/342 (30.12%), Postives = 173/342 (50.58%), Query Frame = 1
Query: 5305 KLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYM-ISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKI---------RLHPNR------------NSLSDRNEIETIINKEIWSSARMK---EENAVIIEYRFDSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRNISNGNALIQ 6255
            KLAV+ +S    +      LG NGAGKTTT  +L G    T G A +NG+ I  D     K +G CPQ + L + LT EE +YFY R++G    ++   ++  +K++ L PH  K     +SGG +RK+  AIA +G   +V LDEPT G+D  ARR +W L+  L  +    +IL++H+M+E ++L  R+AI+  G +   GS   LK  +G  YY+ +         R H ++            +SLS+  ++  ++ + +  +  ++   +E   I+ Y        + +F+  +  +    +  Y +S  SL+EV    A+  + T +I   + L++
Sbjct:  675 KLAVDKLSLDFYQDHITSFLGHNGAGKTTTMSILTGLFAPTSGTAYVNGFDIRRDMDTIRKKLGMCPQHNVLFNELTVEEHIYFYARLKGRSSGEVKQEIEQMIKDVGL-PHKRKELAKNLSGGMQRKLSVAIAFVGGSSVVILDEPTAGVDPYARRGIWELL--LKYKQGRTIILSTHHMDEADILGDRIAIISHGRVCCCGSSLFLKKTYGSGYYLTLVQANQERGARKHQSQCDDFSLDEGIGSSSLSNVADLSALVRRHVPEAVFLEVLGQELVYILPYTGSKDGSFASLFKELDLEKERLGISSYGISDTSLEEVH-TLAQTHTHTLSIQYKDTLVR 1012          

HSP 4 Score: 110.923 bits (276), Expect = 1.261e-23
Identity = 99/352 (28.12%), Postives = 158/352 (44.89%), Query Frame = 2
Query: 2192 EISDNFRQREENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVA 3247
            E  D  R+RE    +     E D L I  L + L+  F    + +  +L   F      G LG NGAGKTTT  +LTG +T + G AF+    +R +M  +   +G CPQ + +   LT  +H+ FY  L+G+ + E+       ++++GL K     +   SGG KRKLS AM+ +G   ++FLDEPT G+DP +RR +WD I+   SI       TH                         +L     FGDGY + +     +Q         +   + + +F+ +  P S L ++        + +        + +F Q   +   L +  Y +S T+L++VF+  A
Sbjct: 1601 EDEDVARERER---VHKGGAENDLLRICDLTKVLLLSFSPHVSKSCLSLPACF------GLLGINGAGKTTTFKMLTGDITASGGEAFLNGYSMRTEMGQVHQNMGYCPQFDAIDDLLTGREHLEFYARLRGVPEQEVASVAEWGIQKLGLVKYSNKSAGTYSGGNKRKLSTAMSLIGCPPVVFLDEPTTGMDPKARRFLWDCILIKSSI-------TH-------------------FPTTPLALAFLYRFGDGYTVIV----RVQG-------GATDLSAVEDFVSRSFPGSVLKEKHHNTLQYQIPY---TEGALSHMFNQFSKNQHALGVEDYSVSQTTLDQVFVNFA 1903          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Cavefish
Match: abca4a (retinal-specific ATP-binding cassette transporter-like [Source:NCBI gene;Acc:103024609])

HSP 1 Score: 561.222 bits (1445), Expect = 0.000e+0
Identity = 358/1027 (34.86%), Postives = 559/1027 (54.43%), Query Frame = 2
Query:  614 DQNDIDVFLQNFNLSLINSTKSIPTCQLAFMNYFTK----SNGLSVLYPIIGPLVFGKIYYTPNSAFTQEIIRRANSTFRILDNLRLASVEWRLTFSN-W-LINNSTNMGLLNDARNYCANSRTLMCQIINNSLSIETIQSTIASLSA--------------MFVLIENSL-------NCTQLNKFTPMPSSIDIDNLSKQSSLGILA------GIVFTDDFQYVTPQNATFLNYQIRMPASRIDSTKNFKVLDRFWTPIPRVNTLTNFNYYTSGFLFLQEIIDQAFIELITDNASVNIGSSMQIMPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTXXXXXXXXXXXXXXXXXGKXXXXXXXXXXXXXXXXXXXXXXCQCFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFE-------------------IQSETCHNNKASESG--TKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANINGPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGLFSE 3532
            + N+   FL   N S   +  +  +   AF N   K    S    +++  + P + GKI Y P+S   +++I+ ANSTF  L+ LR     W       W    ++  + +L D     +    +   + N  L+I  I + + + S               +F L + +L        C  L+KF  +P    +     Q +L ++A      G+VF D F + T +    + ++IRM    ++ T   K+ DR+W P PR + + +  Y   GF +LQ++++ A I+  T      +G  +Q MPYPCY++D  +  LS   P  +V+AW  +V+ ++KS+V EKE RLKE ++ MG++N V W +WF  + L++     L+T I+  GK+L +S+PII+F+ L  +  + I QCF+++VFF+ +N+AA   GI+YF FYLP L    +QD ++ +M     L++QV+F     ++   E+   G Q+ N+  S +    F     +IM+ +D+V Y ++AWY+++VFPG+YG+ +P+YF     Y         +  +S    ++        FE EP  L +G+ +ENLVK F  S  PA+D L++ FY+ QIT FLGHNGAGKTTT+SILTG+  PTSGTAFI   DIR DM+ IR  +G+CPQHNI+F ++TV +HI FY LLKG   +E + ++ +++++ GL  K    ++NLSGG++RKLS+AMAFVG ++++FLDEPT+GVDP+SRR IWDL++KYR   RT+IL+THHMDEAD L DR+AIISQG+L CCGS LFLK   G G+YL L +  +                    +   C   K S  G    +   +   +P ++L++    + T +L         + SLF +L+ +L  + ++S+G+SDTSLEEV           S +   +Q++S       +G    +P +  S   +   +  +                 G+SL+ +Q   L IKRFHHT R+ K  F++
Sbjct:  338 EDNNYKAFL-GINNSRAQAQHTYDSSTTAFCNDVMKDLESSPATRLMWNTLKPFLMGKILYAPDSPAIRQLIKNANSTFEELERLRNIIRSWEEVGPQLWDFFQSNIQLDVLRDILRNPSVMDYMDRGLKNTGLTIRHILNFLHTGSEEERERDMVQFDWRNIFNLTDRTLRMINQYGECLVLDKFVGLPDETQL----TQKALDLIAEKKFWAGLVFVDTFSWTT-KIPPHIKFKIRMDIDTVERTN--KIKDRYWDPGPRADPMDDLRYVWGGFAYLQDMVEHAVIKTHT-GKEWPLGVYLQQMPYPCYVDDLFMLTLSRCFPIFIVLAWVYSVSMMVKSVVLEKEMRLKETLKAMGVTNEVLWCAWFIDSFLVMAASTALLTAIIMGGKVLNYSNPIILFIFLLTFTTATIMQCFLMTVFFNKANLAAACSGILYFSFYLPHLACFTWQDRITKDMKIMASLMSQVAFGFGTEYLSRYEEQGLGLQWDNIHTSPLEGDEFSFHTSIIMMLLDTVLYAVLAWYLDSVFPGQYGIGRPFYFPIQPSY----CSLKPHALVSSPPTEKV------FFEAEPSGLVVGVHVENLVKVFSGSSKPAVDGLSITFYEGQITAFLGHNGAGKTTTMSILTGLFPPTSGTAFIYGKDIRTDMDTIRHSLGMCPQHNIIFHHMTVAEHILFYSLLKGRPLAEAQQEVENMLEDFGLPHKRNEQTQNLSGGLQRKLSVAMAFVGGAKVVFLDEPTSGVDPYSRRSIWDLLLKYRP-GRTVILSTHHMDEADLLSDRVAIISQGRLHCCGSPLFLKSMLGAGFYLTLVRRMKDDTPPTRKEGQCDCKDDCSCKCSICTEYKESTCGDVETITNLVHHHVPEARLVEAVGQELTFLLPSRGFKHRAYASLFRELEETLADIGLSSFGVSDTSLEEV---------STSKELPNRQVSSLYKKACANG----QPTAGGSSSGEGQGSRQVK----------------GVSLVVKQFLALLIKRFHHTTRSGKDFFAQ 1315          

HSP 2 Score: 520.005 bits (1338), Expect = 0.000e+0
Identity = 333/911 (36.55%), Postives = 487/911 (53.46%), Query Frame = 1
Query: 3604 PSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMNTSLYQLENFKC-----------LYP-----YNTNKWSEKSPIEISLVTPECDCST----TGNQICSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMK----------QYGGLQFILPSFFGQSCQVIGESQIWFDFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNIS---GGDENYNAFEWDITG-NKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPH--YNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNR-NSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLSDIFRVFEDLRTNEM---VKEYSVSQMSLDEVFINFAKNDS 6216
            PS+T+SPW+   +       TF+  E  S+    K   +   +    G RCM      LE + C           + P      N ++W+E  P      +P+C CST    T   +C    +GG     RI ++ D L DL+  NISDYL+K + T I            +YGG+        G    V+G S                                      KT    +W N+KG+ +MPA+ N+ +N +LR+ +  +     YG+ V N+PL  T+  L         ++  +A+ VIF +SF+PASFV++LI+ERVT +K  Q+VSGV+P VYW +NF WD I YS+S  +V+  F+ F+ + Y    N+ A I LL LY  +V P MYP S+  S  STA+V +S  NL +G  ++  TF LDL+     +L   N  LK++ LIFP + LGRG+ID++ +    ++    G D + + F W+  G N +C     F+ + L I+    +++  L   + D K KP  +I DEDLDV KERERI       +D+L +  L+K Y+                       K AV+ I  GV  GECFGLLGVNGAGKTTTFKML G+ +++ G A I GYSI+ + L  + NMG+CPQFDA+  LLT  E L+ Y R+RG+  S+I    +  ++ L L+ +  Y   TY  SGGNKRK+ TAIA+IG P +V LDEPT GMD  +RRFLW+ I ++  + + AV+LTSH+MEECE LC RLAIMV+G  K +G++QHLK KFG  Y V +++   +  ++ D N  E  + +  +     +E++   ++Y   S    S + R+F+ + TN+    +++YSV+Q +LD+VF+NFAK  S
Sbjct: 1340 PSLTLSPWIYGRQF------TFFSNEQ-SEMEGMKYFADVLLNRPGFGTRCMVDE--PLEEYPCNNITTEWEKPLVNPALVDVLNKSQWTELRP------SPDCQCSTPTKLTMLPVCPEG-AGGLPLPQRIQSTGDVLIDLTGRNISDYLVKTYPTLIRTSSLISECLFYRYGGISV------GGRLPVVGLSP-------------------------------------KTIQDTVWYNNKGWHAMPAFLNVANNAILRAHLPTNANPSEYGVTVINHPLNLTKEQLSEVNVLTTSVDAVVAMCVIFAMSFVPASFVLYLIQERVTQAKHLQFVSGVSPLVYWTANFLWDMISYSVSAALVVQIFINFDKKCYTSPANLHALIALLMLYGWSVTPMMYPMSYVFSVPSTAYVSLSCLNLFIGINSSAITFILDLFD-SSTTLYMFNQVLKRVLLIFPHFCLGRGLIDMAINQAVMDVYAQFGEDYSLDPFSWNFVGKNVVCMAAEGFIYFILNILI---QYRFFLEHWMPDSK-KP--LIVDEDLDVAKERERIYRGGSS-SDILHIRDLSKTYS--------------------GGTKPAVDRICVGVSPGECFGLLGVNGAGKTTTFKMLTGDIDVSSGEAAITGYSILTNILDVYHNMGYCPQFDAIDDLLTGREHLHLYARLRGVPESEISRVAEWGIQKLGLSQYAGYGAGTY--SGGNKRKLSTAIAMIGCPALVLLDEPTTGMDPHSRRFLWKSIMSVIQDGR-AVVLTSHSMEECEALCTRLAIMVNGIFKCLGTIQHLKYKFGDGYVVTMKIRSAKAGTVPDLNPAEAFM-ENTFPGCVQREKHYNTLQYEVAS----SSLARIFQLVLTNKEKLNIEDYSVTQTTLDQVFVNFAKQQS 2155          

HSP 3 Score: 159.458 bits (402), Expect = 2.713e-38
Identity = 114/379 (30.08%), Postives = 190/379 (50.13%), Query Frame = 2
Query: 2138 FLFTRRYWIPFSKNNDNIEISDNFRQREENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTS-----LFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPS 3259
            + F   +W+P SK    ++   +  +  E I   G     D L I     +L K +     PA+D + +     +  G LG NGAGKTTT  +LTG +  +SG A I    I  ++  +   +G CPQ + +   LT  +H++ Y  L+G+ +SEI       ++++GLS+     +   SGG KRKLS A+A +G   ++ LDEPT G+DP SRR +W  I+      R ++LT+H M+E + LC R+AI+  G  KC G+   LK  FGDGY + ++             +++++GT     +  + P    ++ T         H +T + +  S     +F+ + ++ + L I  Y ++ T+L++VF+  A   S
Sbjct: 1800 YRFFLEHWMPDSKKPLIVDEDLDVAKERERIYRGG--SSSDILHI----RDLSKTYSGGTKPAVDRICVGVSPGECFGLLGVNGAGKTTTFKMLTGDIDVSSGEAAITGYSILTNILDVYHNMGYCPQFDAIDDLLTGREHLHLYARLRGVPESEISRVAEWGIQKLGLSQYAGYGAGTYSGGNKRKLSTAIAMIGCPALVLLDEPTTGMDPHSRRFLWKSIMSVIQDGRAVVLTSHSMEECEALCTRLAIMVNGIFKCLGTIQHLKYKFGDGYVVTMKI------------RSAKAGT-----VPDLNPAEAFMENTFPGCVQREKHYNTLQYEVASSSLARIFQLVLTNKEKLNIEDYSVTQTTLDQVFVNFAKQQS 2155          

HSP 4 Score: 142.51 bits (358), Expect = 3.271e-33
Identity = 100/327 (30.58%), Postives = 154/327 (47.09%), Query Frame = 1
Query: 5305 KLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNE--------------------------IETIIN--KEIWSSARMKE----ENAVIIEYRFDSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEV 6189
            K AV+ +S    EG+    LG NGAGKTTT  +L G    T G A I G  I  D      ++G CPQ + +   +T  E + FY+ ++G   ++    V+  L++  L    N+ T  +SGG +RK+  A+A +G  K+VFLDEPT G+D  +RR +W L+  L       VIL++H+M+E ++L  R+AI+  G +   GS   LKS  G  +Y+ +      ++   R E                          +ETI N        AR+ E    E   ++  R       + +FR  E+   +  +  + VS  SL+EV
Sbjct:  920 KPAVDGLSITFYEGQITAFLGHNGAGKTTTMSILTGLFPPTSGTAFIYGKDIRTDMDTIRHSLGMCPQHNIIFHHMTVAEHILFYSLLKGRPLAEAQQEVENMLEDFGLPHKRNEQTQNLSGGLQRKLSVAMAFVGGAKVVFLDEPTSGVDPYSRRSIWDLL--LKYRPGRTVILSTHHMDEADLLSDRVAIISQGRLHCCGSPLFLKSMLGAGFYLTLVRRMKDDTPPTRKEGQCDCKDDCSCKCSICTEYKESTCGDVETITNLVHHHVPEARLVEAVGQELTFLLPSRGFKHRAYASLFRELEETLADIGLSSFGVSDTSLEEV 1244          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Cavefish
Match: zgc:172302 (zgc:172302 [Source:ZFIN;Acc:ZDB-GENE-081205-5])

HSP 1 Score: 541.576 bits (1394), Expect = 0.000e+0
Identity = 352/1035 (34.01%), Postives = 570/1035 (55.07%), Query Frame = 2
Query:  545 MQTGDQTLINKNLKILGQLLCGS--------------DQNDIDVFL---QNFNLSLINSTKSIPTCQLAFMNYFTKSNGLS-VLYPIIGPLVFGKIYYTPNSAFTQEIIRRANSTFRILDNLRLASVEWRLTFS--NWLINNSTNMGLLNDARNYCANSRTLMCQIINNSLSIETIQSTIASLSAMFVLIENSLNCTQLNKFTPMP------SSIDIDNLSKQSSLGILAGIVFTDDFQYVTPQNAT-----FLNYQIRMPASRIDSTKNFKVLDRFWTPIPRVNTLTNFNYYTSGFLFLQEIIDQAFIELITDNASVNIGSSMQIMP----YPCYLND--RLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTXXXXXXXXXXXXXXXXXGKXXXXXXXXXXXXXXXXXXXXXXCQCFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKT--INTANINGPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGLFSE 3532
            +Q     L  K  +   +++CG               +  DI  FL   ++    L N T S P C+    N   + N +S + +  I PL  GKI Y P++  T+ I++  N TF+ LD L      W          + N     L +  +++            +     +T +   A  + + +  + + + + L++ T +P        +D ++   + +L +L    F     ++ P  ++      + Y+IRM     D T+  ++ D+FW P P  +  ++  Y   GF+++Q+++++A  +++        G  +++ P    + C+++     +  L+  +P  L +AW  +V  +IK +VYEKE RLKE MR+MG+S+   W+SWF S+ LI ++  +L+  +LK+G IL +S P ++F  L  +  + I  CF+IS FF  +N+AA  G + YF  YLP+++ +++++ L++        L+ V+F     ++   E+   G Q+SN+++S      + +   +IM+++D+  Y +  WY+EAVFPG+YG+P+PWYF+F  +YW       D IE                   EP DL +G+ I NLVK + K    A+++L++KF++ QIT FLGHNGAGKTTT+SILTG+  PT+G+ +I   DIR DM  IR  +G+CPQHN+LF  LTVE+H++FYG +KGM+ SE+K ++  ++++VGL+ K    +KNLSGGM+RKLS+A+AF+G S+++ LDEPTAGVDP+SRRGIWDL++KYR  +RTIIL+TH+MDEAD L DRIAIISQGKL CCGSSLFLK + G GYYL   K  E+QS T      S SG  L+   +  +  ++L+++   +  + L H ++          +LD       I SYGLSDT+LEE+FLKVA++ + +  +  E      +  + +  G  P     + F ++   + T       +S +   + V L+G  L +QQ+  LF KR  +  R+ KG  ++
Sbjct:  226 LQENSSALPQKRFQAFSRIMCGHPEQDGESIPSFNWYEDQDIKSFLGRSRSEETDLENDTTS-PFCKSMIQNL--EMNPVSRIFWRGIKPLFIGKILYAPDTPATRRIMKEVNRTFQTLDVLEEVYGAWEEVGPRIKRFMENKNICFLFSVHQDFLRRPEVAFLSTPDP----DTPRRKGAPPTWLDLYQDLNSSLSTLSQVTKVPFLINKMEGLDTEDEMVERALELLEDRQFWAGIVFLLPDPSSSNLPPHVKYKIRMDVD--DVTRTNEIKDKFWDPGPAADPFSDMRYIRGGFVYVQDLVERAITQVL--------GVFIKVTPENKFFFCWVSFPFSFLRVLNRSLPLFLTLAWTYSVAMIIKCVVYEKEARLKETMRIMGLSSGTLWLSWFVSSYLIFLISSLLLVTVLKVGDILPYSDPAVVFFFLSAFATATIMLCFLISTFFSRANLAAACGDLAYFSLYLPYVLCVSWREYLTSVHRILASFLSPVAFGFGCEYLSQYEEQGLGIQWSNMWSSPTEGDKYSLSTSIIMLYVDAFIYGVATWYIEAVFPGQYGIPRPWYFVFQLKYWGGALMEADRIE------------------AEPSDLILGVAIHNLVKIYKKGAKLAVNHLSVKFFEGQITSFLGHNGAGKTTTLSILTGLFPPTAGSVYIKGMDIRTDMNEIRRTLGVCPQHNVLFDMLTVEEHVWFYGHMKGMSSSEVKEEMASLLEDVGLTHKRHEQTKNLSGGMQRKLSVAIAFIGGSKVVILDEPTAGVDPYSRRGIWDLLLKYRK-DRTIILSTHYMDEADLLGDRIAIISQGKLCCCGSSLFLKSHLGTGYYLTAVKK-ELQSRT----PTSASGNGLVALAQHYVSGARLVEDVGREVVINLPHAASEDGTLALFLAELDKRQAEFGIISYGLSDTTLEEIFLKVAEE-TGVDAEPDEAATPPAV--SPSQQGEPPEDRDAVLFNQQVSLLYTEAQETDPLSGDGRGS-VSLTGWGLTWQQLRALFTKRLLYATRSRKGFIAQ 1215          

HSP 2 Score: 486.878 bits (1252), Expect = 0.000e+0
Identity = 309/892 (34.64%), Postives = 484/892 (54.26%), Query Frame = 1
Query: 3592 MDNQPSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCM-NTSLYQLENFKCLYPYNTNKWSEKSPIEISLVTPECDCST--TGNQICSSPLSGG---PESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMK-----------QYGGLQFILPSFFGQSCQVIGESQIWFDFRQSINSSRDN-----NSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNI---SGGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDS-SVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEV 6189
            M   P++ + PW+   +       TF+  +   D     L        G  G +C+ N+       +K    +N+  W+ + P      +P+C CST      +   P   G   P    R+  + D L +L+  NISDYLMK +   + K           +YGG  F L +   Q+  +IG  Q+     +S+ + R       NS+ +Q+  L+     F     + N+ ++W N+KG+ +M ++ NI +N LLR+++      Q +GI   N+PL  T+  L   +     ++V L+I VIF +S +PASFV+FLIEERV+ +K  Q+VSGV P +YW +NF WD + Y++   +V+L F+ F  Q+Y+  KN+ A ++LL LY  A+ P MYP SF  S  STA+V +++ NL +G   +I TF L+L+   +  L+  N  LKK+FLIFP + LGRG+ID++ +    +     G     +   WD  G  + ++ +  V + +  + ++ K      +   +  L P   +  ED DV +ER+R++ N    +D+L +  L+K+Y                    +  +K AVN +  G+  GECFGLLGVNGAGKT+TF ML G+ ++T G A +  +S++ +  + H+ MG+CPQFDA++ LLT  E L FY R+RG+  + +       +K L LT + ++     SGGNKRK+ TAI+LIG P ++FLDEPT GMD  A+RFLW  I ++  E + AVILTSH+MEECE LC R+AIMV+G  + +GSVQHLK++FG  Y + +RL        D   ++  I K  ++   +KE +  +++Y+  S S  L+ +F V  +      V +YS+SQ +LD+V
Sbjct: 1236 MGKYPALELQPWMYGEQF------TFFSNDAPQDPAMQNLLSALLDPPG-FGTKCLFNSPQIPFSTWKL---FNSPNWTMEHP------SPDCMCSTEEVRRMLPDCPEGAGGLPPPQIKRL--TGDILQNLTGRNISDYLMKTYPQILKKSMKTKKWVNEFRYGG--FSLGAKGSQT--LIGSLQL----EESVMAIRKQYKIAENSSLDQL--LDRLPDLFTDLNSQNNV-KVWYNNKGWHAMVSFVNIMNNGLLRASLPPGPERQKHGITAYNHPLNLTKEQLSDMVLMTTSVDVLLSISVIFAMSLVPASFVLFLIEERVSKAKHLQFVSGVKPILYWTANFVWDMLNYTVPATLVVLIFIGFQQQAYVSEKNLPALVLLLLLYGWAITPLMYPASFVFSVPSTAYVTLTSINLFIGINGSIATFVLELFT--NEHLREVNRILKKVFLIFPHFCLGRGLIDMAKNQAMADALQRLGKCHMPSPIVWDFVGKNLFAMAVEGVVFFIFTILLQYKFFIRCRLPWFEPVLPP---LCAEDEDVGRERDRVK-NGRTQDDILTLIDLSKVY--------------------KSGKKPAVNRLCLGIPRGECFGLLGVNGAGKTSTFLMLTGDTSVTCGEAFLCNHSVLTEMDRVHQLMGYCPQFDAINELLTGREHLEFYARLRGVPEAYVAKVAQWGVKKLGLTHYADREAGGYSGGNKRKLSTAISLIGAPPVIFLDEPTTGMDPKAKRFLWNCIHSVIKEGR-AVILTSHSMEECEALCTRMAIMVNGRFQCLGSVQHLKNRFGDGYTIILRLS---APPKDPCPVDAYI-KNSFTGIVLKERHHNVLQYQLPSNSCSLARVFDVLSNNYEELGVTDYSISQTTLDQV 2067          

HSP 3 Score: 165.236 bits (417), Expect = 4.282e-40
Identity = 112/328 (34.15%), Postives = 173/328 (52.74%), Query Frame = 1
Query: 5263 FGKAIINVSSEDKR--KLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYY---VKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEE--NAVIIEYRFDSSVKLS-DIFRVFEDLRTNEM-VKEYSVSQMSLDEVFINFAKNDSV 6219
             G AI N+    K+  KLAVN++S    EG+    LG NGAGKTTT  +L G    T G+  I G  I  D  +  + +G CPQ + L  +LT EE ++FY  ++G+  S++   +   L+++ LT   ++ T  +SGG +RK+  AIA IG  K+V LDEPT G+D  +RR +W L+  L       +IL++H M+E ++L  R+AI+  G++   GS   LKS  G  YY   VK  L     + +  N +  +    + S AR+ E+    V+I     +S   +  +F    D R  E  +  Y +S  +L+E+F+  A+   V
Sbjct:  803 LGVAIHNLVKIYKKGAKLAVNHLSVKFFEGQITSFLGHNGAGKTTTLSILTGLFPPTAGSVYIKGMDIRTDMNEIRRTLGVCPQHNVLFDMLTVEEHVWFYGHMKGMSSSEVKEEMASLLEDVGLTHKRHEQTKNLSGGMQRKLSVAIAFIGGSKVVILDEPTAGVDPYSRRGIWDLL--LKYRKDRTIILSTHYMDEADLLGDRIAIISQGKLCCCGSSLFLKSHLGTGYYLTAVKKELQSRTPTSASGNGLVALAQHYV-SGARLVEDVGREVVINLPHAASEDGTLALFLAELDKRQAEFGIISYGLSDTTLEEIFLKVAEETGV 1127          

HSP 4 Score: 163.31 bits (412), Expect = 1.580e-39
Identity = 109/340 (32.06%), Postives = 179/340 (52.65%), Query Frame = 2
Query: 2216 REENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHN-STNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEV 3232
            RE +   +G  +  DD+   + + +L K +   K PA++ L L   + +  G LG NGAGKT+T  +LTG  + T G AF+ ++ +  +M+ +   +G CPQ + +   LT  +H+ FY  L+G+ ++ +       VK++GL+      +   SGG KRKLS A++ +G   +IFLDEPT G+DP ++R +W+ I       R +ILT+H M+E + LC R+AI+  G+ +C GS   LK  FGDGY + L  S   + + C               +   I NS      K +   VL +   +N      +F+ L ++ + L +  Y +S T+L++V
Sbjct: 1748 RERDRVKNG--RTQDDI---LTLIDLSKVYKSGKKPAVNRLCLGIPRGECFGLLGVNGAGKTSTFLMLTGDTSVTCGEAFLCNHSVLTEMDRVHQLMGYCPQFDAINELLTGREHLEFYARLRGVPEAYVAKVAQWGVKKLGLTHYADREAGGYSGGNKRKLSTAISLIGAPPVIFLDEPTTGMDPKAKRFLWNCIHSVIKEGRAVILTSHSMEECEALCTRMAIMVNGRFQCLGSVQHLKNRFGDGYTIILRLSAPPK-DPCP--------------VDAYIKNSFTGIVLKERHHNVLQYQLPSNSCSLARVFDVLSNNYEELGVTDYSISQTTLDQV 2067          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Cavefish
Match: abca4a (retinal-specific ATP-binding cassette transporter-like [Source:NCBI gene;Acc:103024609])

HSP 1 Score: 528.094 bits (1359), Expect = 0.000e+0
Identity = 337/915 (36.83%), Postives = 502/915 (54.86%), Query Frame = 1
Query: 3604 PSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMNTSLYQLENFKC-----------LYP-----YNTNKWSEKSPIEISLVTPECDCST----TGNQICSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIM-----------KQYGGLQF--ILPSFFGQSCQVIGESQIWFDFRQSINSSRD-NNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNIS---GGDENYNAFEWDITG-NKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPH--YNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNR-NSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLSDIFRVFEDLRTNEM---VKEYSVSQMSLDEVFINFAKNDS 6216
            PS+T+SPW+   +       TF+  E  S+    K   +   +    G RCM      LE + C           + P      N ++W+E  P      +P+C CST    T   +C    +GG     RI ++ D L DL+  NISDYL+K + T I            ++YGG+     LP   G S + I ++        +I + +    +  +   FL Y +  +N         ++W N+KG+ +MPA+ N+ +N +LR+ +  +     YG+ V N+PL  T+  L         ++  +A+ VIF +SF+PASFV++LI+ERVT +K  Q+VSGV+P VYW +NF WD I YS+S  +V+  F+ F+ + Y    N+ A I LL LY  +V P MYP S+  S  STA+V +S  NL +G  ++  TF LDL+     +L   N  LK++ LIFP + LGRG+ID++ +    ++    G D + + F W+  G N +C     F+ + L I+    +++  L   + D K KP  +I DEDLDV KERERI       +D+L +  L+K Y+                       K AV+ I  GV  GECFGLLGVNGAGKTTTFKML G+ +++ G A I GYSI+ + L  + NMG+CPQFDA+  LLT  E L+ Y R+RG+  S+I    +  ++ L L+ +  Y   TY  SGGNKRK+ TAIA+IG P +V LDEPT GMD  +RRFLW+ I ++  + + AV+LTSH+MEECE LC RLAIMV+G  K +G++QHLK KFG  Y V +++   +  ++ D N  E  + +  +     +E++   ++Y   S    S + R+F+ + TN+    +++YSV+Q +LD+VF+NFAK  S
Sbjct: 1454 PSLTLSPWIYGRQF------TFFSNEQ-SEMEGMKYFADVLLNRPGFGTRCMVDE--PLEEYPCNNITTEWEKPLVNPALVDVLNKSQWTELRP------SPDCQCSTPTKLTMLPVCPEG-AGGLPLPQRIQSTGDVLIDLTGRNISDYLVKTYPTLIRTSLKSKYWVNEQRYGGISVGGRLP-VVGLSPKTIQDTAEQLGGIFNITAGKHVKRALRDTGTFLRYMETEYNV--------KVWYNNKGWHAMPAFLNVANNAILRAHLPTNANPSEYGVTVINHPLNLTKEQLSEVNVLTTSVDAVVAMCVIFAMSFVPASFVLYLIQERVTQAKHLQFVSGVSPLVYWTANFLWDMISYSVSAALVVQIFINFDKKCYTSPANLHALIALLMLYGWSVTPMMYPMSYVFSVPSTAYVSLSCLNLFIGINSSAITFILDLFD-SSTTLYMFNQVLKRVLLIFPHFCLGRGLIDMAINQAVMDVYAQFGEDYSLDPFSWNFVGKNVVCMAAEGFIYFILNILI---QYRFFLEHWMPDSK-KP--LIVDEDLDVAKERERIYRGGSS-SDILHIRDLSKTYSGGT--------------------KPAVDRICVGVSPGECFGLLGVNGAGKTTTFKMLTGDIDVSSGEAAITGYSILTNILDVYHNMGYCPQFDAIDDLLTGREHLHLYARLRGVPESEISRVAEWGIQKLGLSQYAGYGAGTY--SGGNKRKLSTAIAMIGCPALVLLDEPTTGMDPHSRRFLWKSIMSVIQDGR-AVVLTSHSMEECEALCTRLAIMVNGIFKCLGTIQHLKYKFGDGYVVTMKIRSAKAGTVPDLNPAEAFM-ENTFPGCVQREKHYNTLQYEVAS----SSLARIFQLVLTNKEKLNIEDYSVTQTTLDQVFVNFAKQQS 2307          

HSP 2 Score: 347.821 bits (891), Expect = 0.000e+0
Identity = 200/469 (42.64%), Postives = 274/469 (58.42%), Query Frame = 2
Query: 2243 FEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSF---------------------------EIQSETCHNNKASESGTK-----LLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKR-------QEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANINGPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGLFSE 3532
            FE EP  L +G+ +ENLVK F  S  PA+D L++ FY+ QIT FLGHNGAGKTTT+SILTG+  PTSGTAFI   DIR DM+ IR  +G+CPQHNI+F ++TV +HI FY LLKG   +E + ++ +++++ GL  K    ++NLSGG++RKLS+AMAFVG ++++FLDEPT+GVDP+SRR IWDL++KYR   RT+IL+THHMDEAD L DR+AIISQG+L CCGS LFLK   G G+YL L +                             E +  TC   K++          +   +   +P ++L++    + T +L         + SLF +L+ +L  + ++S+G+SDTSLEE+FLKV  D      K        QE   +S   DT T   N   P       KK            S         + G+SL+ +Q   L IKRFHHT R+ K  F++
Sbjct:  968 FEAEPSGLVVGVHVENLVKVFSGSSKPAVDGLSITFYEGQITAFLGHNGAGKTTTMSILTGLFPPTSGTAFIYGKDIRTDMDTIRHSLGMCPQHNIIFHHMTVAEHILFYSLLKGRPLAEAQQEVENMLEDFGLPHKRNEQTQNLSGGLQRKLSVAMAFVGGAKVVFLDEPTSGVDPYSRRSIWDLLLKYRP-GRTVILSTHHMDEADLLSDRVAIISQGRLHCCGSPLFLKSMLGAGFYLTLVRRMKDDTPPTRKEGQCDCKDDCSCKCSICTEYKESTCGQTKSAGRQMDGDVETITNLVHHHVPEARLVEAVGQELTFLLPSRGFKHRAYASLFRELEETLADIGLSSFGVSDTSLEEIFLKVTADGETSLGKSAADLRALQETSRSSVFRDT-TVTVNTEEPED-----KKACANGQPTAGGSSSGEGQGSRQVKGVSLVVKQFLALLIKRFHHTTRSGKDFFAQ 1429          

HSP 3 Score: 246.514 bits (628), Expect = 8.812e-65
Identity = 168/550 (30.55%), Postives = 286/550 (52.00%), Query Frame = 2
Query:  614 DQNDIDVFLQNFNLSLINSTKSIPTCQLAFMNYFTK----SNGLSVLYPIIGPLVFGKIYYTPNSAFTQEIIRRANSTFRILDNLRLASVEWRLTFSN-W-LINNSTNMGLLNDARNYCANSRTLMCQIINNSLSIETIQSTIASLSA--------------MFVLIENSL-------NCTQLNKFTPMPSSIDIDNLSKQSSLGILA------GIVFTDDFQYVTPQNATFLNYQIRMPASRIDSTKNFKVLDRFWTPIPRVNTLTNFNYYTSGFLFLQEIIDQAFIELITDNASVNIGSSMQIMPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTXXXXXXXXXXXXXXXXXGKXXXXXXXXXXXXXXXXXXXXXXCQCFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWI 2164
            + N+   FL   N S   +  +  +   AF N   K    S    +++  + P + GKI Y P+S   +++I+ ANSTF  L+ LR     W       W    ++  + +L D     +    +   + N  L+I  I + + + S               +F L + +L        C  L+KF  +P    +     Q +L ++A      G+VF D F + T +    + ++IRM    ++ T   K+ DR+W P PR + + +  Y   GF +LQ++++ A I+  T      +G  +Q MPYPCY++D  +  LS   P  +V+AW  +V+ ++KS+V EKE RLKE ++ MG++N V W +WF  + L++     L+T I+  GK+L +S+PII+F+ L  +  + I QCF+++VFF+ +N+AA   GI+YF FYLP L    +QD ++ +M     L++QV+F     ++   E+   G Q+ N+  S +    F     +IM+ +D+V Y ++AWY+++VFPG+YG+ +P+YF     YW+
Sbjct:  341 EDNNYKAFL-GINNSRAQAQHTYDSSTTAFCNDVMKDLESSPATRLMWNTLKPFLMGKILYAPDSPAIRQLIKNANSTFEELERLRNIIRSWEEVGPQLWDFFQSNIQLDVLRDILRNPSVMDYMDRGLKNTGLTIRHILNFLHTGSEEERERDMVQFDWRNIFNLTDRTLRMINQYGECLVLDKFVGLPDETQL----TQKALDLIAEKKFWAGLVFVDTFSWTT-KIPPHIKFKIRMDIDTVERTN--KIKDRYWDPGPRADPMDDLRYVWGGFAYLQDMVEHAVIKTHT-GKEWPLGVYLQQMPYPCYVDDLFMLTLSRCFPIFIVLAWVYSVSMMVKSVVLEKEMRLKETLKAMGVTNEVLWCAWFIDSFLVMAASTALLTAIIMGGKVLNYSNPIILFIFLLTFTTATIMQCFLMTVFFNKANLAAACSGILYFSFYLPHLACFTWQDRITKDMKIMASLMSQVAFGFGTEYLSRYEEQGLGLQWDNIHTSPLEGDEFSFHTSIIMMLLDTVLYAVLAWYLDSVFPGQYGIGRPFYFPIQPSYWL 881          

HSP 4 Score: 158.688 bits (400), Expect = 3.922e-38
Identity = 114/379 (30.08%), Postives = 190/379 (50.13%), Query Frame = 2
Query: 2138 FLFTRRYWIPFSKNNDNIEISDNFRQREENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTS-----LFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPS 3259
            + F   +W+P SK    ++   +  +  E I   G     D L I     +L K +     PA+D + +     +  G LG NGAGKTTT  +LTG +  +SG A I    I  ++  +   +G CPQ + +   LT  +H++ Y  L+G+ +SEI       ++++GLS+     +   SGG KRKLS A+A +G   ++ LDEPT G+DP SRR +W  I+      R ++LT+H M+E + LC R+AI+  G  KC G+   LK  FGDGY + ++             +++++GT     +  + P    ++ T         H +T + +  S     +F+ + ++ + L I  Y ++ T+L++VF+  A   S
Sbjct: 1952 YRFFLEHWMPDSKKPLIVDEDLDVAKERERIYRGG--SSSDILHI----RDLSKTYSGGTKPAVDRICVGVSPGECFGLLGVNGAGKTTTFKMLTGDIDVSSGEAAITGYSILTNILDVYHNMGYCPQFDAIDDLLTGREHLHLYARLRGVPESEISRVAEWGIQKLGLSQYAGYGAGTYSGGNKRKLSTAIAMIGCPALVLLDEPTTGMDPHSRRFLWKSIMSVIQDGRAVVLTSHSMEECEALCTRLAIMVNGIFKCLGTIQHLKYKFGDGYVVTMKI------------RSAKAGT-----VPDLNPAEAFMENTFPGCVQREKHYNTLQYEVASSSLARIFQLVLTNKEKLNIEDYSVTQTTLDQVFVNFAKQQS 2307          

HSP 5 Score: 141.739 bits (356), Expect = 5.711e-33
Identity = 82/233 (35.19%), Postives = 125/233 (53.65%), Query Frame = 1
Query: 5305 KLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNE 6003
            K AV+ +S    EG+    LG NGAGKTTT  +L G    T G A I G  I  D      ++G CPQ + +   +T  E + FY+ ++G   ++    V+  L++  L    N+ T  +SGG +RK+  A+A +G  K+VFLDEPT G+D  +RR +W L+  L       VIL++H+M+E ++L  R+AI+  G +   GS   LKS  G  +Y+ +      ++   R E
Sbjct:  993 KPAVDGLSITFYEGQITAFLGHNGAGKTTTMSILTGLFPPTSGTAFIYGKDIRTDMDTIRHSLGMCPQHNIIFHHMTVAEHILFYSLLKGRPLAEAQQEVENMLEDFGLPHKRNEQTQNLSGGLQRKLSVAMAFVGGAKVVFLDEPTSGVDPYSRRSIWDLL--LKYRPGRTVILSTHHMDEADLLSDRVAIISQGRLHCCGSPLFLKSMLGAGFYLTLVRRMKDDTPPTRKE 1223          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002495.1 (pep scaffold:Pmarinus_7.0:GL480265:53:27909:1 gene:ENSPMAG00000002218.1 transcript:ENSPMAT00000002495.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 564.303 bits (1453), Expect = 9.538e-175
Identity = 326/809 (40.30%), Postives = 486/809 (60.07%), Query Frame = 2
Query: 1211 LNYQIRMPASRIDSTKNFKVLDRFWTPIPRVNTLTNFNYYTSGFLFLQEIIDQAFIELITDNASVNIGSSMQIMPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTXX----XXXXXXXXXXXXXXXGKXXXXXXXXXXXXXXXXXXXXXXCQCFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENITIDGF------EKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEI--------------------QSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANINGPKVSFEFENNL-----VLLSGLSLIFQQISGLFIKRFHHTKRNIKGLFSE 3532
            + Y+IRM    +  T   K+ DR+W P PR +   +  Y   GF +LQ+ ++Q  I   T N S+++G  +Q MPYPCY++D  +  ++  +P  L +AW  +V  ++K +V+EKE RLKE MR+MG+S  + W+SWF S ++      +L  +L+ +  +LG IL +S P I++L L  + ++ + QCF+IS FF  +N+AA  GGIVYF FYLP+++ + +Q++++  +     + + V+F     F    E+   G Q+ N+F+S +   ++     + M+  D+  Y L+  Y+E VFPG+YGVPKPWYF  TR YW     +    E+ +   Q++    I G       E EP DL +G+ I+ LVK +   K  A+D L+L FYQ QIT FLGHNGAGKTTT+SILTG+  PT+GTA+IL  DIR D++ IR  +G+CPQ+N+LF  LTVE+HI+FY  LKG ++ E K ++  ++++V L+ K   +SK+LSGGM+RKLSI +AFVG S+++FLDEPTAGVDP++RRGIW+L++KYR   RTIIL+THHMDEAD L DRIAIIS G+L+CCGSSLFLK  FG GYYL + K                          E+  ++ A+   + +   +++ +P+++LI+    + T +L  +      F  LF++LD  L  L ++SYG+SDT+LEE+FLKVA++P+  SH     ++++             +PV      K               E  N L       +SG+ LI  Q   LFIKRFHH +R+ KG  ++
Sbjct:    5 VRYKIRMDIDSVQRTN--KIKDRYWDPGPRADPFDDLRYIWGGFAYLQDSVEQGIIRAQT-NGSLSVGVYVQQMPYPCYVDDIFLRIMNRSLPMFLTLAWMYSVAMILKEVVHEKEARLKETMRIMGLSTSMLWLSWFISILIPLLISAMLLTVLLKVREQLGNILYYSDPTIVYLYLCVFAIATVMQCFLISTFFSRANLAAATGGIVYFSFYLPYVLCVAWQNQITYSVKISTSIFSTVAFSFGSEFFSLYEEQGVGMQWENVFSSPVEGEDYTFISSIFMMLFDAFVYGLLTVYIENVFPGQYGVPKPWYFPCTRAYW---RGDTMEKELYETIAQKQPQ-AITGVPDNIYVEDEPGDLPVGVSIQGLVKIYNAGKKLAVDGLSLNFYQGQITSFLGHNGAGKTTTMSILTGLFPPTAGTAYILGRDIRTDIDKIRKNLGVCPQYNVLFDRLTVEEHIWFYARLKGRSEQEAKQEIEQMIQDVDLAHKRSDISKSLSGGMQRKLSIGIAFVGGSKVVFLDEPTAGVDPYARRGIWNLLLKYRH-GRTIILSTHHMDEADLLGDRIAIISHGRLRCCGSSLFLKNAFGAGYYLTMVKRSGSGGSNSSCLAGLASSSDEGFGSDESNPDSIAANHVSSVTRLLQQHVPDARLIENFGQELTYLLPSHGAKDGTFALLFKELDEKLAELGVSSYGVSDTTLEEIFLKVAEEPAANSHFTNGVKLSAR-----NSKYTYLQPVHAGCICKNYSTCKKAPAELGELEKLNELDGKGTQQISGVQLILLQFKALFIKRFHHARRSRKGFVAQ 800          

HSP 2 Score: 169.474 bits (428), Expect = 2.207e-42
Identity = 116/380 (30.53%), Postives = 185/380 (48.68%), Query Frame = 1
Query: 5203 LQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVK-----------------IRLHPNRNSLSDRNEIETIINKEIWSSARMKEE---NAVIIE-------YRFDSSVKLSDIFR-VFEDL--RTNEM-VKEYSVSQMSLDEVFINFAKNDSVTRNISNGNAL 6249
            + + GL KIYN                      +KLAV+ +S    +G+    LG NGAGKTTT  +L G    T G A I G  I  D  K  KN+G CPQ++ L   LT EE ++FY R++G    +    ++  ++++ L    +  +  +SGG +RK+   IA +G  K+VFLDEPT G+D  ARR +W L+  L   H   +IL++H+M+E ++L  R+AI+  G ++  GS   LK+ FG  YY+                  +    +    SD +  ++I    + S  R+ ++   +A +IE       Y   S       F  +F++L  +  E+ V  Y VS  +L+E+F+  A+  +   + +NG  L
Sbjct:  363 VSIQGLVKIYNAG--------------------KKLAVDGLSLNFYQGQITSFLGHNGAGKTTTMSILTGLFPPTAGTAYILGRDIRTDIDKIRKNLGVCPQYNVLFDRLTVEEHIWFYARLKGRSEQEAKQEIEQMIQDVDLAHKRSDISKSLSGGMQRKLSIGIAFVGGSKVVFLDEPTAGVDPYARRGIWNLL--LKYRHGRTIILSTHHMDEADLLGDRIAIISHGRLRCCGSSLFLKNAFGAGYYLTMVKRSGSGGSNSSCLAGLASSSDEGFGSDESNPDSIAANHVSSVTRLLQQHVPDARLIENFGQELTYLLPSHGAKDGTFALLFKELDEKLAELGVSSYGVSDTTLEEIFLKVAEEPAANSHFTNGVKL 720          

HSP 3 Score: 76.6406 bits (187), Expect = 5.918e-14
Identity = 60/223 (26.91%), Postives = 97/223 (43.50%), Query Frame = 1
Query: 3808 NTNKWSEKSPIEISLVTPECDCSTTGNQI----CSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMK-----------QYGGLQFILPSFFGQSCQVIGESQIWFDFRQSINSSRDNNSNPEQVKFLNYFQLFFNS--------SGIKTNLS--------RIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDL 4383
             +  WS + P      +PEC CS  G ++    C    +GGP    R+  ++D L DLS  NISDYL+K +   I K           +YGGL              +G+ ++          S   +     + F N  ++F           SG+K  +S        ++W N+KG+ ++ A+ N+ +N +LRS++ A     +YGI   N+PL  T+  L
Sbjct:  900 QSRNWSMEDP------SPECRCSGEGRRVILPDCPEG-AGGPPPMQRVQNTTDTLEDLSGRNISDYLVKTYPQAIRKSLKHKYWVNEIRYGGLS-------------VGKKKL----------SHSASPKDMDIVFTNVKRVFHIENKAVDVLYSGVKDMVSFLGPKETIKVWFNNKGWHAIVAFMNMANNAVLRSSLPAGTDPSDYGITAYNHPLNLTKEQL 1092          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Sea Lamprey
Match: abca12 (ATP-binding cassette, sub-family A (ABC1), member 12 [Source:ZFIN;Acc:ZDB-GENE-030131-9790])

HSP 1 Score: 412.92 bits (1060), Expect = 1.357e-117
Identity = 275/792 (34.72%), Postives = 426/792 (53.79%), Query Frame = 1
Query: 3955 RLYDLSSYNISDYLMKNFKTFIMKQYGGLQFILPSFFGQSCQVIGESQIWFDFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNY-GIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLD-LY-QYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNIS---GGD-ENYNAFEWDITGNKICSLGI-LFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVL-----NDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAII---NGYSIIDDTLKAHKN---MGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHK--VAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSV-KLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKND-SVTRNISNGNALIQKP 6261
            ++++LS  ++ +YLM     +++K+YGG  F LP       +V+ +++                                  + +  N  ++W N +GY ++PAY N F+NLLL   +   +   +Y GI+V + P  Y    L   +  Q   +  +AI ++ G S +  SF   ++ ER+TGSK  Q +SGV+P  YW  NF +D + Y+++  + I    AF+  +Y  + N+ A  +LL L+  A +P MY  S   S+   AFV   + N+++G  T I+TF ++ LY   D  SL +A + ++ +FL+FPQ+ LG G++ LS   L  +I    G D +  ++F  DITG    +L +   V + L +V  +S  +     + K V+    E+    D DV  ER R+E    V+     +D LQ+ GL K Y       N+ F               AV+ +  GV   +CFGLLGVNGAGKTTTFKML G+   + G+AII   NG+S +    KA +    +G+CPQFDAL  LLT  E LY Y RIRGI    I       +  L L+ H +K     SGG KRK+ TA+ALIG P+++ LDEP+ GMD  ++R+LW+   T+T E +   +VILTSH+MEECE LC +LAIMV+G+ K +G++QHLK++FG+ + +K+RL    + +++  E  T      +  A +KE++   +E++  S+  KLS+IF   E  + +  ++ YS+SQ +LD+VFINFA+    +    SN +A    P
Sbjct: 1056 QIFNLSGEDVEEYLMGTTCQYLLKRYGGWSFGLPHSTTSDLEVVPDNR--------------------------------TLTKVWRNHMKVWYNPEGYHALPAYVNSFNNLLLWDNLPDGEHPGDYKGISVNSKP--YAGQQLSQDMILQNLGDTGVAICILLGFSILTGSFATAVVRERITGSKRLQQISGVSPTFYWAVNFTYDMVSYTVTTGLCIAVIAAFHLPAYTDNSNLGAVSLLLILFGFASLPWMYLISGVFSEEEMAFVTYISINIILGVSTIISTFLVNFLYLSSDSQSLYNAYNIMRWLFLVFPQFCLGWGLVSLSKQRLMEDIMKLLGSDPQESSSFAMDITGWPFVALAVNGIVCFTLRLVLTDSFIR---WWRRKAVEPGQPEL----DTDVQAERSRVEEQSRVVDAATPDDTLQLVGLRKRYR----LLNRSF--------------TAVDGLHLGVSPNQCFGLLGVNGAGKTTTFKMLTGDIQPSGGDAIIRTQNGHSALLKMEKARRTGTLIGYCPQFDALDDLLTGWEHLYCYARIRGIPSHHIEQVSQELVTRLHLSLHADKLVKTYSGGTKRKLSTALALIGKPQLLLLDEPSSGMDPKSKRYLWK---TITREVRGGCSVILTSHSMEECEALCDKLAIMVNGQFKCLGTLQHLKNRFGNGHMIKLRLSSGNSKVTEVTEFIT----SHFPGAYLKEQHISQLEFQVPSNAGKLSEIFIALEKEKESLSIQHYSISQTTLDQVFINFARQQIDMEEESSNADARPPVP 1781          

HSP 2 Score: 370.548 bits (950), Expect = 4.030e-104
Identity = 267/864 (30.90%), Postives = 437/864 (50.58%), Query Frame = 2
Query: 1202 ATFLNYQIRMPASRIDSTKNFKVLDRFWTPIPRVNTLTNFNYYTSGFLFLQEIIDQAFIELITDNASVNIGSSMQIMPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTXXXXXXXXXXXXXXXXXGKXXXXXXXXXXXXXXXXXXXXXXCQCFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELS--------------TEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTR----RYWIPFSKNNDNI--EISDNFRQREENIT----------IDG-----FEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGM--TKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEI----QSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWT-------VVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFL---KVADDP-----------------SQISHKRQ-------EKQITSEMLDT-LTDGGNLPRPVSVLSFRKKTINTANINGPKVS--------FEFENNLV---LLSGLSLIFQQISGLFIKRFHHTKRNIKGLFSE 3532
            AT LNY +R+    +  T   +  D  W P P  N   N+ YYT  FL  + ++++A I L            +Q MPYPCY +D  +  +  + P L +IAW   + + +K +V EKE   +E+M +MG+    H++SW   + ++L+L +IL+T+ILK    L   +  ++  +   + +S +   +M+S  F ++NVA++    +Y + + PFL   +   +L+              T   Y   L+TQ   C  +  +          Q+SN+++S +   +    +   M+ ID+  Y ++ WY+  V+PG YG+ +P+YFLFTR     + IP  K+   +   + D  +     +T           DG      E  P DL  G+ + +L K++ K K  AL +L+L FYQ QIT  LGHNGAGKTTT+S+L G+  P+SG+  +  +D R DM  +R ++G+C Q ++LF  L V +H+  YG LK +  ++  ++ ++   + ++GL      +   LSGGMKRKLSIA+AF+G S  + LDEPT+GVDP SRR IW+LI+K+R+  RTIIL+THH+DEA+ L DRIA++  GKL+CCGS  +LK+ +G G  L L K   +    QS T   ++      +++  ++  +  + L     +          ++ +H+     Q  S    L+ +++ L ++ Y +SDT+LEEV L   +V  +P                 S ++   Q         Q+  E  D  L D  N        S   +T    +   P  S        +  E +LV    ++G+ L+ ++   L  KRFHH +R++KG  ++
Sbjct:    2 ATHLNYTLRLSIQNVMRTDYLR--DLVWVPGPHTNQ--NYMYYTHAFLS-RTMLERAAISLYIGRNISEPALQVQPMPYPCYTDDSFLHSVGLMFPILFMIAWILTIASTVKFLVQEKELCQQEYMNIMGVRPASHFLSWLLQSCVLLLLMVILLTVILKASGTLPSINWALLLALFLCFGISVLAMGYMLSACFTHTNVASLTACFIYLLSFFPFLALSSLTLKLTRWQKSLIVRCLLSPTAFSYATNLITQHCTCIPMRAL---------VQWSNMYHSPLFGDDVSFAYLCWMLIIDTAIYFILGWYIRNVYPGTYGLARPFYFLFTRISSKAHGIPGQKHGSRVIRGLQDGRKGVLRGVTECSCTSPLGAPDGSMRPQLEAVPADLTAGVSLRSLTKQYSKGKKAALQDLSLDFYQDQITTLLGHNGAGKTTTMSLLMGLYEPSSGSVHVGGHDARTDMAEVRRQLGVCLQRDVLFPALNVHEHLLLYGRLKALDWSRQRLQQEVDTFLNDLGLYNHKDKLVGTLSGGMKRKLSIAIAFIGGSTTVILDEPTSGVDPCSRRSIWNLILKHRA-GRTIILSTHHLDEAEVLSDRIAVLEHGKLRCCGSPQYLKEIYGQGLTLTLTKKVRVLCLSQSVTL-GSRPPFDPERVVSLVRSGVAGAALKSGEDSSGNRNADMVFLLPAHSQNVLGQ--SFLVTLEENMEELGLSGYAISDTTLEEVCLRQQRVMSEPALGCSASARYFTPTSAASLLTKATQCGPGLYSCSQLVQEAEDQRLKDITNKSPEAESGSINSETAAPPDHTSPAASSILCLSSLWRTEKHLVKKERVTGIHLLVRKTQALIYKRFHHWRRDVKGAAAQ 847          

HSP 3 Score: 165.236 bits (417), Expect = 6.652e-41
Identity = 146/533 (27.39%), Postives = 251/533 (47.09%), Query Frame = 2
Query: 1766 FMISVFFDNSNVAAIVGGIVYFIFY-LPFLVFIN---FQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNST----IIDLNFGVGHCLIMI-----------------------WIDSVFYILIAWYVEAV--FPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFIL---DNDIRYDMEIIRSK---IGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVA 3247
            F +  + DNSN+ A+   ++ F F  LP++  I+    ++E++   Y  + ++  VS   +   + +L  +SD     N +N      ++   F +G  L+ +                        +D   +  +A  V  +  F  +  +   +   + R+   P     D    ++  R  E++  +D     PDD    + +    +   +S T A+D L+L    +Q  G LG NGAGKTTT  +LTG + P+ G A I     +     ME  R     IG CPQ + L   LT  +H+Y Y  ++G+    I+    ++V  + LS     + K  SGG KRKLS A+A +G  +++ LDEP++G+DP S+R +W  I +      ++ILT+H M+E + LCD++AI+  G+ KC G+   LK  FG+G+ + L  S         N+K +E    + EFI    P + L ++  +Q    +    +N  + + +F  L+   + L I  Y +S T+L++VF+  A
Sbjct: 1246 FHLPAYTDNSNLGAVSLLLILFGFASLPWMYLISGVFSEEEMAFVTYISINIILGVSTIISTFLVNFLYLSSDSQSLYNAYNIMRWLFLVFPQFCLGWGLVSLSKQRLMEDIMKLLGSDPQESSSFAMDITGWPFVALAVNGIVCFTLRLVLTDSFIRWWRRKAVEPGQPELDTDVQAERSRVEEQSRVVDA--ATPDDTLQLVGLRKRYRLLNRSFT-AVDGLHLGVSPNQCFGLLGVNGAGKTTTFKMLTGDIQPSGGDAIIRTQNGHSALLKMEKARRTGTLIGYCPQFDALDDLLTGWEHLYCYARIRGIPSHHIEQVSQELVTRLHLSLHADKLVKTYSGGTKRKLSTALALIGKPQLLLLDEPSSGMDPKSKRYLWKTITREVRGGCSVILTSHSMEECEALCDKLAIMVNGQFKCLGTLQHLKNRFGNGHMIKLRLS-------SGNSKVTE----VTEFITSHFPGAYLKEQHISQLEFQV---PSNAGKLSEIFIALEKEKESLSIQHYSISQTTLDQVFINFA 1761          

HSP 4 Score: 139.043 bits (349), Expect = 7.234e-33
Identity = 78/216 (36.11%), Postives = 119/216 (55.09%), Query Frame = 1
Query: 5302 RKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSD--IPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGH 5943
            +K A+ ++S    + +   LLG NGAGKTTT  +L+G    + G+  + G+    D  +  + +G C Q D L   L   E L  Y R++ +  S   +   VD  L +L L  H +K    +SGG KRK+  AIA IG    V LDEPT G+D  +RR +W LI  L +     +IL++H+++E EVL  R+A++  G+++  GS Q+LK  +G 
Sbjct:  394 KKAALQDLSLDFYQDQITTLLGHNGAGKTTTMSLLMGLYEPSSGSVHVGGHDARTDMAEVRRQLGVCLQRDVLFPALNVHEHLLLYGRLKALDWSRQRLQQEVDTFLNDLGLYNHKDKLVGTLSGGMKRKLSIAIAFIGGSTTVILDEPTSGVDPCSRRSIWNLI--LKHRAGRTIILSTHHLDEAEVLSDRIAVLEHGKLRCCGSPQYLKEIYGQ 607          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006855.1 (pep scaffold:Pmarinus_7.0:GL486953:391:4596:1 gene:ENSPMAG00000006189.1 transcript:ENSPMAT00000006855.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 283.878 bits (725), Expect = 3.218e-86
Identity = 151/312 (48.40%), Postives = 207/312 (66.35%), Query Frame = 1
Query: 5302 RKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSD---IPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDS-SVKLSDIFRVFEDLRTNEMVKEYSVSQMSLD---EVFINFAKNDS 6216
            R LAV+ +  GV+ GECFGLLGVNGAGKTTTFKML G+ ++T G A +NG+S++ D  K  + +G+CPQFDAL   LT  E L  Y R+RGI   D   +   V+ +L+ L LT + +KP    SGGNKRK+ TAIALIGYP ++FLDEPT GMD  ARRFLW LI  +    + +V+LTSH+MEECE LC RLAIMV+G  K +GS+QHLK++FG  Y + IR    R++L  + E+    ++  +  A +KE +   ++Y+  S ++ L+ +F   E +     V++YSVSQ +LD   +VF+NFAK  S
Sbjct:    1 RILAVDRLCVGVRPGECFGLLGVNGAGKTTTFKMLTGDASVTGGEAFLNGHSVLRDQHKVQQTIGYCPQFDALFDELTAREHLELYTRLRGIPWRDEKRVRQVVNWALQKLGLTSYADKPAGTYSGGNKRKLSTAIALIGYPPLIFLDEPTTGMDPKARRFLWNLILDIIKTGR-SVVLTSHSMEECEALCTRLAIMVNGHFKCLGSIQHLKNRFGDGYMITIR---TRSTLHVK-EVLRFFSRS-FPDAVLKERHHTKVQYQLKSETLSLAAVFTKMEQVLDVLGVEDYSVSQTTLDNDPQVFVNFAKKQS 306          

HSP 2 Score: 164.081 bits (414), Expect = 1.447e-44
Identity = 104/318 (32.70%), Postives = 169/318 (53.14%), Query Frame = 2
Query: 2324 ALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMT---KSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLE---EVFLKVADDPS 3259
            A+D L +     +  G LG NGAGKTTT  +LTG  + T G AF+  + +  D   ++  IG CPQ + LF  LT  +H+  Y  L+G+    +  ++  +   ++++GL+      +   SGG KRKLS A+A +G   +IFLDEPT G+DP +RR +W+LI+      R+++LT+H M+E + LC R+AI+  G  KC GS   LK  FGDGY + +     +  +            ++L F  +  P++ L +   T+    L   + +     ++F +++  LD L +  Y +S T+L+   +VF+  A   S
Sbjct:    4 AVDRLCVGVRPGECFGLLGVNGAGKTTTFKMLTGDASVTGGEAFLNGHSVLRDQHKVQQTIGYCPQFDALFDELTAREHLELYTRLRGIPWRDEKRVRQVVNWALQKLGLTSYADKPAGTYSGGNKRKLSTAIALIGYPPLIFLDEPTTGMDPKARRFLWNLILDIIKTGRSVVLTSHSMEECEALCTRLAIMVNGHFKCLGSIQHLKNRFGDGYMITIRTRSTLHVK------------EVLRFFSRSFPDAVLKERHHTKVQYQLKSETLS---LAAVFTKMEQVLDVLGVEDYSVSQTTLDNDPQVFVNFAKKQS 306          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010397.1 (pep scaffold:Pmarinus_7.0:GL480213:155963:163950:1 gene:ENSPMAG00000009413.1 transcript:ENSPMAT00000010397.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 256.914 bits (655), Expect = 5.343e-77
Identity = 128/302 (42.38%), Postives = 189/302 (62.58%), Query Frame = 1
Query: 5308 LAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNR-NSLSDRNEIETIINKEIWSSARMKEENAVIIEYRF-DSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAK 6207
            +AV+ IS G+  GECFGLLG NGAGKTTTFKML GEE  T G+A+I GYSI+ D  K  + +G+CPQFD L   +T  E L+ Y R+RG+    IP             PH        SGG KRK+ TA+AL+G P +VFLDEP+ GMD  ARR LW  +  +  E + A+++TSH+MEECE LC R+AIMV+G+ + +GS QHLKS++G  Y +  R+   + ++   ++ +ET     I     +K+++  ++ Y   D ++  + +F + E  + +  + +YS+SQ+SL++VF+ FA+
Sbjct:    4 VAVDGISVGIPAGECFGLLGFNGAGKTTTFKMLTGEETATSGDAVIGGYSILTDIRKVQQRIGYCPQFDGLLEHMTGRETLWMYARLRGVPERLIPWATRTGRVPRVAPPHRR------SGGTKRKLSTAVALMGSPPVVFLDEPSTGMDPVARRLLWDALSRVREEGR-ALVITSHSMEECEALCTRIAIMVNGQFRCLGSQQHLKSRYGSGYTLLARIRAEQADTQPFKHFVETTFPGSI-----LKDQHQGLVHYHLTDMNMSWAQVFGMLEKAKRDYCLDDYSISQISLEQVFLGFAR 293          

HSP 2 Score: 155.221 bits (391), Expect = 1.098e-41
Identity = 102/308 (33.12%), Postives = 160/308 (51.95%), Query Frame = 2
Query: 2324 ALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVA 3247
            A+D +++     +  G LG NGAGKTTT  +LTG  T TSG A I    I  D+  ++ +IG CPQ + L  ++T  + ++ Y  L+G     +  +L       G   ++    +  SGG KRKLS A+A +G+  ++FLDEP+ G+DP +RR +WD + + R   R +++T+H M+E + LC RIAI+  G+ +C GS   LK  +G GY L      E Q++T               F++   P S L D+ +    +V  H +     +  +F  L+ +     +  Y +S  SLE+VFL  A
Sbjct:    5 AVDGISVGIPAGECFGLLGFNGAGKTTTFKMLTGEETATSGDAVIGGYSILTDIRKVQQRIGYCPQFDGLLEHMTGRETLWMYARLRG-----VPERLIPWATRTGRVPRVAPPHRR-SGGTKRKLSTAVALMGSPPVVFLDEPSTGMDPVARRLLWDALSRVREEGRALVITSHSMEECEALCTRIAIMVNGQFRCLGSQQHLKSRYGSGYTLLARIRAE-QADT----------QPFKHFVETTFPGSILKDQHQ---GLVHYHLTDMNMSWAQVFGMLEKAKRDYCLDDYSISQISLEQVFLGFA 292          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004117.1 (pep scaffold:Pmarinus_7.0:GL489716:190:6182:-1 gene:ENSPMAG00000003765.1 transcript:ENSPMAT00000004117.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 262.307 bits (669), Expect = 1.631e-76
Identity = 178/471 (37.79%), Postives = 275/471 (58.39%), Query Frame = 2
Query: 1217 YQIRMPASRIDSTKNFKVLDRFWTPIPRVNTLTNFNYYTSGFLFLQEIIDQAFIELITDNASVNIGSSMQIMPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTXXXXXXXXXXXXXXXXXGKXXXXXXXXXXXXXXXXXXXXXXCQCFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYG-----VGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXX--XXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIK 2608
            Y+IR  +S  + T   +    +W P P       F Y   GF+++Q++I++A I     +  V  G+ +Q+ PYPCY  D  +  + ++MP  +VI+W  +V  +I+ IV EKE+RLKE M++MG+SN V WV+WF +  L L + + ++T+ILK G++L  S   II+L L  Y ++ +  CF++SV +  + +AA  GGI+YF+ Y+P++ ++  ++E++ +           L++  +F     +    E A  G Q+     S +   +F +   L+M+ +DSV Y ++ WY+EAV PG YG+P+PWYF   R YW+  S   D  E S  +  R       G EKEP  L + + IE L K +   K  AL+NL+L  Y++QI  FLGHNGAGKTTT+          PTSG+A I  +DIR +M+ IR  +G+CPQHN+LF  LTVE+H++FY  LKGM   +I+
Sbjct:    7 YKIRQNSSFTEKTNEIR--RAYWRPGPNSGGQYYFFY---GFVWIQDMIERAIINTFVGHDVVEPGNYVQLFPYPCYTRDDFLFVIEHMMPLCMVISWVYSVAMMIQHIVAEKEHRLKEVMKMMGLSNAV-WVAWFITGFLQLSITVAVLTVILKYGQVLMHSDIFIIWLFLTIYALATVMFCFLVSVLYSKARMAAACGGIMYFLSYVPYM-YVAIREEVAHDKITAFEKCIASLMSTTAFGLGAKYFALYEVAGVGIQWHTFRQSPVEGDDFNLSLALLMLLLDSVVYGVLTWYIEAVHPGTYGLPRPWYFPLQRSYWLG-SGRADAWEWS-GYEAR-------GMEKEPTHLPLVVCIERLTKVYKTGKKLALNNLSLNLYENQIVSFLGHNGAGKTTTMYDTRTTGLFPPTSGSARIYGHDIRSEMDAIRKSLGMCPQHNVLFDQLTVEEHLWFYSRLKGMQAHDIR 461          

HSP 2 Score: 65.0846 bits (157), Expect = 1.035e-10
Identity = 42/102 (41.18%), Postives = 56/102 (54.90%), Query Frame = 1
Query: 5341 EGECFGLLGVNGAGKTTTFKMLI--GEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPH 5640
            E +    LG NGAGKTTT       G    T G+A I G+ I  +     K++G CPQ + L   LT EE L+FY+R++G+Q  DI I  D   K +S +PH
Sbjct:  375 ENQIVSFLGHNGAGKTTTMYDTRTTGLFPPTSGSARIYGHDIRSEMDAIRKSLGMCPQHNVLFDQLTVEEHLWFYSRLKGMQAHDIRIETD---KRVSHSPH 473          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Yeast
Match: PDR5 (Plasma membrane ATP-binding cassette (ABC) transporter; multidrug transporter actively regulated by Pdr1p; also involved in steroid transport, cation resistance, and cellular detoxification during exponential growth; PDR5 has a paralog, PDR15, that arose from the whole genome duplication [Source:SGD;Acc:S000005679])

HSP 1 Score: 77.0258 bits (188), Expect = 3.317e-14
Identity = 68/249 (27.31%), Postives = 119/249 (47.79%), Query Frame = 1
Query: 5137 EDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITL----GNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPIN-----VDLSLKNLSLTPHYNKPTYMISGG----NKRKMQTAIALIGYPK-IVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHN 5841
            E  D+  +R+ ++ + +  +D     GL+K       +RN C+    + + +E +R L  NN+   VK G    L+G +GAGKTT    L   E +T+    G+ ++NG   I       +++G+C Q D      T  E L F   +R  QP+++ I      V+  +K L +  + +    +   G     ++++   + L   PK +VFLDEPT G+D+     + +L++ L N H  A++ T H 
Sbjct:  835 ERSDLSSDRKMLQESSEEESDTYGEIGLSK-SEAIFHWRNLCYE---VQIKAETRRIL--NNVDGWVKPGTLTALMGASGAGKTTLLDCL--AERVTMGVITGDILVNG---IPRDKSFPRSIGYCQQQDLHLKTATVRESLRFSAYLR--QPAEVSIEEKNRYVEEVIKILEMEKYADAVVGVAGEGLNVEQRKRLTIGVELTAKPKLLVFLDEPTSGLDSQTAWSICQLMKKLAN-HGQAILCTIHQ 1069          

HSP 2 Score: 55.4546 bits (132), Expect = 9.968e-8
Identity = 52/195 (26.67%), Postives = 92/195 (47.18%), Query Frame = 2
Query: 2327 LDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQ---LPDIVKEVGLSKKLKCM----SKNLSGGMKRKLSIAMAFVGNSRI-IFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHH-----MDEADYL 2872
            L+N++       +T  +G +GAGKTT +  L   +T    T  IL N I  D    RS IG C Q ++     TV + + F   L+   +  I+ +   + +++K + + K    +     + L+   +++L+I +      ++ +FLDEPT+G+D  +   I  L+ K  +  + I+ T H      M E D L
Sbjct:  888 LNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGDILVNGIPRDKSFPRS-IGYCQQQDLHLKTATVRESLRFSAYLRQPAEVSIEEKNRYVEEVIKILEMEKYADAVVGVAGEGLNVEQRKRLTIGVELTAKPKLLVFLDEPTSGLDSQTAWSICQLMKKLANHGQAILCTIHQPSAILMQEFDRL 1081          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Yeast
Match: ADP1 (Putative ATP-dependent permease of the ABC transporter family [Source:SGD;Acc:S000000604])

HSP 1 Score: 72.0182 bits (175), Expect = 9.332e-13
Identity = 65/247 (26.32%), Postives = 116/247 (46.96%), Query Frame = 2
Query: 2231 TIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLK-----FYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLL---KGMTKSEIKHQLPDIVKEVGLSKKLKCMSKN-----LSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRS-INRTIILTTHH-MDEADYLCDRIAIISQGKLKCCGSS 2926
             ++ F +  DD    +  EN+    P   +  ++   L          QI   +G +GAGKTT + IL         +  I  N I  D +     IG   Q + L   LTV + +    LL   K ++    K ++  +++E+ +      +  N     +SGG KR++SIA   V +  ++FLDEPT+G+D  +   + + +V+  S  NRT++L+ H       YL D++ ++S+G++   G++
Sbjct:  369 AVNNFLQNEDDTLATLSFENITYSVPSINSDGVEETVLNEISGIVKPGQILAIMGGSGAGKTTLLDILAMKRKTGHVSGSIKVNGISMDRKSFSKIIGFVDQDDFLLPTLTVFETVLNSALLRLPKALSFEAKKARVYKVLEELRIIDIKDRIIGNEFDRGISGGEKRRVSIACELVTSPLVLFLDEPTSGLDASNANNVIECLVRLSSDYNRTLVLSIHQPRSNIFYLFDKLVLLSKGEMVYSGNA 615          

HSP 2 Score: 65.0846 bits (157), Expect = 1.311e-10
Identity = 61/241 (25.31%), Postives = 111/241 (46.06%), Query Frame = 1
Query: 5272 AIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENI--TLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINV----------DLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEE-CEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYV 5955
            ++ +++S+   +  +N IS  VK G+   ++G +GAGKTT   +L  +       G+  +NG S+  D     K +GF  Q D L   LT  E +     +R   P  +              +L + ++      N+    ISGG KR++  A  L+  P ++FLDEPT G+DA     +   +  L++++   ++L+ H        L  +L ++  GEM   G+ + +     ++ Y+
Sbjct:  392 SVPSINSDGVEETVLNEISGIVKPGQILAIMGGSGAGKTTLLDILAMKRKTGHVSGSIKVNGISM--DRKSFSKIIGFVDQDDFLLPTLTVFETVLNSALLR--LPKALSFEAKKARVYKVLEELRIIDIKDRIIGNEFDRGISGGEKRRVSIACELVTSPLVLFLDEPTSGLDASNANNVIECLVRLSSDYNRTLVLSIHQPRSNIFYLFDKLVLLSKGEMVYSGNAKKVSEFLRNEGYI 628          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Yeast
Match: PDR15 (Plasma membrane ATP binding cassette (ABC) transporter; multidrug transporter and general stress response factor implicated in cellular detoxification; regulated by Pdr1p, Pdr3p and Pdr8p; promoter contains a PDR responsive element; PDR15 has a paralog, PDR5, that arose from the whole genome duplication [Source:SGD;Acc:S000002814])

HSP 1 Score: 70.4774 bits (171), Expect = 3.067e-12
Identity = 60/212 (28.30%), Postives = 101/212 (47.64%), Query Frame = 1
Query: 5248 FRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAH---KNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPIN-----VDLSLKNLSLTPHYNKPTYMISG-----GNKRKMQTAIALIGYPK-IVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHN 5841
            +R+ C+     +V  +  ++  +NN+   VK G    L+G +GAGKTT    L   E +T+G  +I G   +D  L+     +++G+C Q D      T  E L F   +R  QPS + I      V+  +K L +   Y+     ++G       ++++   + L   PK +VFLDEPT G+D+       +L++ L   H  A++ T H 
Sbjct:  886 WRDLCY-----DVPIKGGQRRILNNVDGWVKPGTLTALMGASGAGKTTLLDCL--AERVTMG--VITGNIFVDGRLRDESFPRSIGYCQQQDLHLKTATVRESLRFSAYLR--QPSSVSIEEKNRYVEEVIKILEMQ-QYSDAVVGVAGEGLNVEQRKRLTIGVELAARPKLLVFLDEPTSGLDSQTAWDTCQLMRKLAT-HGQAILCTIHQ 1084          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Yeast
Match: ATM1 (Mitochondrial inner membrane ATP-binding cassette (ABC) transporter; exports mitochondrially synthesized precursors of iron-sulfur (Fe/S) clusters to the cytosol; human homolog ABCB7 can complement yeast null mutant [Source:SGD;Acc:S000004916])

HSP 1 Score: 68.9366 bits (167), Expect = 6.050e-12
Identity = 73/270 (27.04%), Postives = 130/270 (48.15%), Query Frame = 2
Query: 2189 IEISDNFRQREENITIDGFEKE---PDDLEIGILIENLVKKF-PKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIR-YDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEI----KHQLPDIVKEV--GLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIV-KYRSINRTIILTTHHMDE-ADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGY 2959
            I++   F+ R+  + I   E+    P+++   I  EN+   + P  K   L N +        T  +G +G+GK+T + ++     P SG   I   DI+ YD++ +R  IG+ PQ   LF   T+ +++ F G +    +  I    K QL  ++K++  G    +      +SGG K++L+IA   + N+RI+F DE T+ +D  + + +   I   + S +RT +   H +   AD   D+I ++  G+++  G  L L    G  Y
Sbjct:  404 IDMETLFKLRKNEVKIKNAERPLMLPENVPYDITFENVTFGYHPDRKI--LKNASFTIPAGWKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIKEYDIDALRKVIGVVPQDTPLFND-TIWENVKF-GRIDATDEEVITVVEKAQLAPLIKKLPQGFDTIVGERGLMISGGEKQRLAIARVLLKNARIMFFDEATSALDTHTEQALLRTIRDNFTSGSRTSVYIAHRLRTIAD--ADKIIVLDNGRVREEGKHLELLAMPGSLY 667          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Yeast
Match: YOL075C_mRNA (Putative ABC transporter [Source:SGD;Acc:S000005435])

HSP 1 Score: 68.9366 bits (167), Expect = 7.605e-12
Identity = 54/200 (27.00%), Postives = 93/200 (46.50%), Query Frame = 2
Query: 2342 LKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPD-IVKEVGLSKKLKCM-----SKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKY-RSINRTIILTTHH-MDEADYLCDRIAIISQGKLKCC 2917
            L    S+I+G L HNG+ +       +         A +   D      +I + +   PQ ++L   LT  + + F   LK  +    K  + + +++E+GL      +      + LSGG KR+LSI    + N  I+FLDEPT G+D +S   +   + K  +   RT I++ H    +  +L D++ I+S+G +  C
Sbjct:   72 LNVLASKISGGLTHNGSIRYVLEDTGSEPNETEPKRAHLDGQDHPIQKHVIMAYL---PQQDVLSPRLTCRETLKFAADLKLNSSERTKKLMVEQLIEELGLKDCADTLVGDNSHRGLSGGEKRRLSIGTQMISNPSIMFLDEPTTGLDAYSAFLVIKTLKKLAKEDGRTFIMSIHQPRSDILFLLDQVCILSKGNVVYC 268          

HSP 2 Score: 66.6254 bits (161), Expect = 3.940e-11
Identity = 55/212 (25.94%), Postives = 89/212 (41.98%), Query Frame = 1
Query: 5314 VNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIING--YSIIDDT--------------------LKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINV--------------DLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHN 5841
            VN  S  +  G    ++G +G+GKTT   +L  + +   G    NG    +++DT                    ++ H  M + PQ D L   LTC E L F         +D+ +N               +L LK+ + T   +     +SGG KR++     +I  P I+FLDEPT G+DA +   + + ++ L  E     I++ H 
Sbjct:   45 VNTFSMDLPSGSVMAVMGGSGSGKTTLLNVLASKIS---GGLTHNGSIRYVLEDTGSEPNETEPKRAHLDGQDHPIQKHVIMAYLPQQDVLSPRLTCRETLKF--------AADLKLNSSERTKKLMVEQLIEELGLKDCADTLVGDNSHRGLSGGEKRRLSIGTQMISNPSIMFLDEPTTGLDAYSAFLVIKTLKKLAKEDGRTFIMSIHQ 245          

HSP 3 Score: 59.6918 bits (143), Expect = 5.894e-9
Identity = 50/192 (26.04%), Postives = 101/192 (52.60%), Query Frame = 2
Query: 2327 LDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAF-----ILDNDIRYDMEIIRSKIGLCPQHN-ILFAYLTVEDHIYFYGLLK--GMTKSEIKHQLPDIVKEVGLSKKLKCMS--------KNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKY-RSINRTIILTTHH 2851
            L ++N  F    I   +G +G+GK++ +++++G L  +    F     I+ NDI+    + ++      Q +  L A LTV++ + +   L+   +T++E   +  ++++ +GL     C +        K +SGG KR++++ +  + +  I+ LDEPT+G+D F+   I +++ K  R   +TII+T H 
Sbjct:  710 LQSVNAIFKPGMINAIMGPSGSGKSSLLNLISGRLKSSVFAKFDTSGSIMFNDIQVSELMFKNVCSYVSQDDDHLLAALTVKETLKYAAALRLHHLTEAERMERTDNLIRSLGLKH---CENNIIGNEFVKGISGGEKRRVTMGVQLLNDPPILLLDEPTSGLDSFTSATILEILEKLCREQGKTIIITIHQ 898          

HSP 4 Score: 50.0618 bits (118), Expect = 4.086e-6
Identity = 51/201 (25.37%), Postives = 88/201 (43.78%), Query Frame = 1
Query: 5281 NVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNM--GFCPQF----DALHSLLTCEEELYFYNRIR--------GIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHN 5841
            N   E K  L   N  F  K G    ++G +G+GK++   ++ G    ++        SI+ + ++  + M    C       D L + LT +E L +   +R         ++ +D  I   L LK+       N+    ISGG KR++   + L+  P I+ LDEPT G+D+     +  +++ L  E    +I+T H 
Sbjct:  701 NFHHETKEILQSVNAIF--KPGMINAIMGPSGSGKSSLLNLISGRLKSSVFAKFDTSGSIMFNDIQVSELMFKNVCSYVSQDDDHLLAALTVKETLKYAAALRLHHLTEAERMERTDNLIR-SLGLKHCENNIIGNEFVKGISGGEKRRVTMGVQLLNDPPILLLDEPTSGLDSFTSATILEILEKLCREQGKTIIITIHQ 898          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Nematostella
Match: EDO46878 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNL9])

HSP 1 Score: 575.859 bits (1483), Expect = 1.810e-173
Identity = 339/827 (40.99%), Postives = 495/827 (59.85%), Query Frame = 2
Query: 1148 ILAGIVFTD-DFQYVTPQNATFLNYQIRMPASRIDSTKNFKVLDRFWTPIPRVNTLTNFNYYTSGFLFLQEIIDQAFIELITDNASVNIGSSMQIMPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTXXXXXXXXXXXXXXXXXGKXXXXXXXXXXXXXXXXXXXXXXCQCFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIP---FSKNNDNIEISDNFRQREENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGT---------------------------KLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTAN-INGPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGLFSE 3532
            I AG+VF + D     P++   + Y+IR        T   ++ D +W P P     +   Y   GF+FLQ++ID+A + +  +      G+  Q+ PYPCY+ DR + ++   MP  + +AW      +IKSIVYEKE RLKE M+VMG+   VHWV+WF ++   +++ II + I LK G+IL  S P IIFL L  ++ + I  CF+ISVFF  +NV+A  GGI++F+ YLP+ +   F+  +++       L +  +F  A N++   E+   GAQ++NL+ S I    F +G+ + M+ ID V Y L  +Y+EAV PG+YG+P+PWYF   + YW P    S + D++  S +     +       E EP  L +G+ I NLVK + + K  A+D LNL  Y+ QI  FLGHNGAGKTTT+S+LTG+  PT GTA I   DIR D++++R  +G+CPQHN+LF  LTVE+H++FY  LKGM KS I  ++   +K+VGL+ K   +S NLSGGMKRKLS+AMAFV  SR++ LDEPTAGVDP++RR IWDL++KY+  +RT++L+THHMDEAD L DRIAIISQGKL+CCG+SLFLK ++G+GYYL L K  +       +  ASE  +                            +  FIK  IP++ L++   T+ T VL  ++    +F  +FE+LD +L  L + SYG+SDT+LEEVFLKVA++      + +E   ++E+    +       PV  L    +  +  + ++G   S EF++     SGL+L+ +Q   L +KRFHH +RN K   ++
Sbjct:    1 IFAGLVFENVDSGAELPKH---IKYKIRQDVDFTPRTD--RIRDWYWRPGPN-GWFSKQGYMNFGFVFLQDMIDRALLTISFNETVFEPGTYAQMFPYPCYIRDRFVFYIGGTMPLFMTLAWIYTAAMIIKSIVYEKEKRLKEVMKVMGLGRTVHWVAWFINSASTMLITIIFLVITLKAGRILQHSDPFIIFLFLVVFMFATIMMCFLISVFFSRANVSAACGGIIFFVTYLPYTMVRWFEAFMNSSQIAAACLSSTTAFGVACNYLARYEEQGVGAQWNNLYASPIAGDEFSLGYAMGMMMIDGVLYALATFYIEAVMPGQYGIPRPWYFPLQKSYWFPQKPASPDMDDVAFSPDGATNNDV----AMETEPSHLSMGVSIRNLVKIYKEGKKLAVDGLNLNLYEGQILSFLGHNGAGKTTTMSVLTGLFPPTHGTALISGYDIRTDIDMVRRNLGMCPQHNVLFDCLTVEEHLWFYASLKGMEKSRIPGEIEKFLKDVGLTNKRHELSANLSGGMKRKLSVAMAFVAESRVVILDEPTAGVDPYARRSIWDLLLKYKK-DRTVLLSTHHMDEADVLGDRIAIISQGKLQCCGTSLFLKSHYGNGYYLTLTK--KTPGLGLDSVDASERDSLGSRSSDSDPISDSVLGDYSDVYCNEKSVTSFIKSHIPSASLVEHVGTELTYVLPSHAAKEGKFQDMFEELDRNLHKLHVGSYGVSDTTLEEVFLKVAEEA-----QSEEAGTSAEVPVRRSTFTFSSHPVKCLQPPAQGDSKNDSVDG---SLEFDDR---ESGLALLLRQFFALLVKRFHHCRRNRKAFIAQ 803          

HSP 2 Score: 520.005 bits (1338), Expect = 6.892e-154
Identity = 317/820 (38.66%), Postives = 459/820 (55.98%), Query Frame = 1
Query: 3832 SPIEISLVTPECDCSTTGNQICSSPLSGGPESSNRIMASSDR--LYDLSSYNISDYLMKNFKTF------------IMKQYGGLQFILPSFFGQSCQVIGESQIWFDFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKA-LQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLS-------FSYLRYNISGGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVK--LKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFD-SSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDS 6216
            SP+     +P+CDCS   N +C +              S D   +  +S  NISDYL+K +  F            I+++YGGL F                    D   ++ ++  N+S+P   +             I     +IW N+KGY ++PA+ N  SN +LR+   A       YGI   N+P+ YT+  L    + +  ++V +AI V+F LSF+PASFV+FL+ ERV+ +K    VSGV PY+YW++N+ WD   Y I  ++ +  FLAF  +SY  + N      LL LY  ++ P MYP S F S SSTA++V+ + NL VG   T+ TF L+L++ DD  L   N  LK +FL+FP Y LGRG+IDL+       FS    N++      + F WDITG  I ++ I    +  + V +E +      IKL+ VK  LKP E   +ED DV +ER+R+        D L++  LTK+Y                   S  KR +AV+ +  GV +GECFGLLGVNGAGKTTTFKML G+  +T G   ++G+SI+ D   AH++MG+CPQFDAL  LLT ++ L  Y R+RG+    IP  V+  ++ ++L  + +      SGGNKRK+ TAIAL+G P IVF+DEPT GMD  ARRFLW +I  +  E +  VILTSH+MEECE LC+R+AIMV+G+MK +GS QHLK+KFG  Y V +R+     S  D  ++   I  + + +A +K+++  ++EY+     + +S +F   E  R    +++YSV+Q +LD+VFINFAK+ +
Sbjct:  892 SPVPTP--SPDCDCSEAMN-VCPAGAG---GPPPPTWTSYDGNIIQKMSGRNISDYLLKTYMKFVKKRYINKIEIMIVREYGGLSF-------------------GDNYNNLPANVRNSSDPAIRRL------------ISPRNVKIWYNNKGYHALPAFLNTLSNTVLRAKAKARGLDPSQYGITAYNHPMNYTKEQLDDETFVKRAVDVLVAICVVFALSFVPASFVVFLVSERVSKAKHLHLVSGVKPYIYWLANYVWDMCNYFIPAMLCVFIFLAFGDESYTTAMNFPPTFCLLLLYGWSITPLMYPASHFFSVSSTAYIVLISINLFVGINCTLATFILELFE-DDKELTDINTVLKSVFLVFPNYCLGRGLIDLAKNQFLGIFSRFGVNLT-----RDPFSWDITGRNIFAMIIEGFVFFTLTVLIEYR----FFIKLRPVKVVLKPVE---EEDDDVQRERQRVNSGLGHATDALRLMNLTKVYR------------------SRRKRIVAVDRLCVGVPKGECFGLLGVNGAGKTTTFKMLTGDIPVTSGEGFVDGHSILSDINGAHQSMGYCPQFDALDDLLTAKDHLRLYARLRGVPERYIPKVVNSLIQRMNLVQYQDVCAGKYSGGNKRKLSTAIALVGNPAIVFMDEPTTGMDPKARRFLWNIITGIMKEGR-TVILTSHSMEECEALCNRVAIMVNGQMKCLGSPQHLKNKFGDGYTVILRV---AGSNPDTEQVCQFI-IQCFPNAVLKDKHHNMVEYQIPCQGLSVSRLFGHLEANRKMFDIEDYSVTQTTLDQVFINFAKDQT 1638          

HSP 3 Score: 184.496 bits (467), Expect = 1.555e-46
Identity = 120/357 (33.61%), Postives = 189/357 (52.94%), Query Frame = 2
Query: 2189 IEISDNFRQREENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETK--TQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADD 3253
            +E  D+  QRE      G     D L +  L +  V +  + +  A+D L +   + +  G LG NGAGKTTT  +LTG +  TSG  F+  + I  D+      +G CPQ + L   LT +DH+  Y  L+G+ +  I   +  +++ + L +     +   SGG KRKLS A+A VGN  I+F+DEPT G+DP +RR +W++I       RT+ILT+H M+E + LC+R+AI+  G++KC GS   LK  FGDGY + L            +N  +E   ++ +FI +  PN+ L D+     ++ +     S +R     LF  L+++     I  Y ++ T+L++VF+  A D
Sbjct: 1298 VEEEDDDVQRERQRVNSGLGHATDALRLMNLTK--VYRSRRKRIVAVDRLCVGVPKGECFGLLGVNGAGKTTTFKMLTGDIPVTSGEGFVDGHSILSDINGAHQSMGYCPQFDALDDLLTAKDHLRLYARLRGVPERYIPKVVNSLIQRMNLVQYQDVCAGKYSGGNKRKLSTAIALVGNPAIVFMDEPTTGMDPKARRFLWNIITGIMKEGRTVILTSHSMEECEALCNRVAIMVNGQMKCLGSPQHLKNKFGDGYTVIL--------RVAGSNPDTE---QVCQFIIQCFPNAVLKDKHHNMVEYQIPCQGLSVSR-----LFGHLEANRKMFDIEDYSVTQTTLDQVFINFAKD 1636          

HSP 4 Score: 175.252 bits (443), Expect = 1.032e-43
Identity = 113/363 (31.13%), Postives = 184/363 (50.69%), Query Frame = 1
Query: 5293 EDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKI-RLHPN----------RNSLS----------------------DRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLSDIFR-VFEDLRTN---EMVKEYSVSQMSLDEVFINFAKNDSVTRNISNGNALIQKPNFN 6270
            ++ +KLAV+ ++  + EG+    LG NGAGKTTT  +L G    T G A+I+GY I  D     +N+G CPQ + L   LT EE L+FY  ++G++ S IP  ++  LK++ LT   ++ +  +SGG KRK+  A+A +   ++V LDEPT G+D  ARR +W L+  L  +    V+L++H+M+E +VL  R+AI+  G+++  G+   LKS +G+ YY+ + +  P           R+SL                       +   + + I   I  SA + E     + Y   S       F+ +FE+L  N     V  Y VS  +L+EVF+  A+        ++    +++  F 
Sbjct:  381 KEGKKLAVDGLNLNLYEGQILSFLGHNGAGKTTTMSVLTGLFPPTHGTALISGYDIRTDIDMVRRNLGMCPQHNVLFDCLTVEEHLWFYASLKGMEKSRIPGEIEKFLKDVGLTNKRHELSANLSGGMKRKLSVAMAFVAESRVVILDEPTAGVDPYARRSIWDLL--LKYKKDRTVLLSTHHMDEADVLGDRIAIISQGKLQCCGTSLFLKSHYGNGYYLTLTKKTPGLGLDSVDASERDSLGSRSSDSDPISDSVLGDYSDVYCNEKSVTSFIKSHI-PSASLVEHVGTELTYVLPSHAAKEGKFQDMFEELDRNLHKLHVGSYGVSDTTLEEVFLKVAEEAQSEEAGTSAEVPVRRSTFT 740          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Nematostella
Match: EDO38879 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBQ0])

HSP 1 Score: 560.066 bits (1442), Expect = 8.975e-167
Identity = 380/1091 (34.83%), Postives = 570/1091 (52.25%), Query Frame = 2
Query:  557 DQTLINKNLKILGQLLCGSDQNDIDVFLQNFNLSLINSTKSIPTCQLAFMNYFTKSNGLSVLYPIIGPLVFGKIYYTPNSAFTQEIIRRANSTFRILDNLRLASVEWRLTFSN---WLINNSTN--MGLLN--------------------DARNYCANSRTLMCQIINNSLSIETIQSTIASLSAMFVLIENSLNCTQLNKFTPMPS-------SIDIDNLSKQSSLGILAGIVFTDDFQYVTPQNA--TFLNYQIRMPASRIDSTKNFKVLDRFWTPIPRVNTLTNFNYYTSGFLFLQEIIDQAFIELITDNASVNIGSSMQIMPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTXXXXXXXXXXXXXXXXXGKXXXXXXXXXXXXXXXXXXXXXXCQCFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQD-------ELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIP--------FSKNNDNIEISDNFRQREENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSF---------EIQSETCHNNKAS-ESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVAD----DPSQISHKRQEKQITS------------------------------EMLDTLTDGGNLP------RPVSVLSFRKKTINTANINGPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGLFSE 3532
            ++  I    K LG +LCGSD ++    +          TKS  T  L  M Y    N               KI Y PN+    ++I+ AN TF  ++ L+  + +W  T S     L+ N T   +GL++                    D   +    + +   +   +  +  I   +  + A+  +        +L+ F            + +   +    S  I+AGIVFT+    + P       + Y+IRM A+      + ++ D +W P P+       +YY  GF++LQ+ I++A + L      +     +  MPYPCY  DR +  + ++MP  L ++W   V  +++SIVYEKE RLKE M++MG+SN VHWV+WF +++ ++ + ++L+T+ILK GK+L FS P+II+L L  + +  I  CF+IS FF  + +AA  GGI+YF+ Y+PF VF++ ++       E S +M   + LL+  +F     +    E+  +G Q+SN+  S I   +F +   L  +  D+  Y+++ WY+EAV PG YG+P+PWYF     YW            K N  +  SD      +   +  +E+EP  L +G+ I+NL K + KS T A+D LNL  Y+ QI  FLGHNGAGKTTT+SILTG+  PT+GT +I  +DIR+DM+ IR  +G+CPQHN+LF  LTV++H++FY  +KGM    +K ++  +V+++GL  K  C  + LSGGMKRKLS+AMAFV  SR + LDEPTAGVDP++RR IWDL++KY+   RTI+L+TH M+EAD L DRIAIIS GKL+C GS L+LK+ FG+GY L L K             +  T  N +AS  S  KL  FI   I +++L  +T  ++T +L  NS  R  F  LF  L+ ++D L I SYG++ T LEEVFLKV D    +   + H RQ+K  T                               EM D + + G         +P+S     +  +     NG             L+G +L +QQ   L +KRFH+ +RN KG+ S+
Sbjct:    7 NKAYIQGMWKNLGPVLCGSDPDEQPDRVVKHMFDYRCLTKSCQTRALRLMFYLLTHNP--------------KILYAPNNTAADDVIKDANRTFSDIEYLQDLAHDWLNTSSQIRRALLQNETQFYLGLVSNYIRAYPDSYWELISGISEKDPTTHAPYFKNIHSLLTKKNGGVNPIIEQLDRIDAVLKIWIEQTKAFKLDIFVGFKDEESLVRYAFNTSGVRGDDSSKIVAGIVFTN----IEPNKTLPVHVTYKIRMNATYFTPATD-RIRDSYWRPGPQS---WGQSYYDLGFVWLQDKIERAVVNLHAMREVIKPAVYLHEMPYPCYSKDRFMLVIQHMMPLCLTVSWIYTVAIVVRSIVYEKEQRLKEVMKMMGLSNVVHWVAWFITSVSVMSITVMLLTVILKYGKVLAFSDPLIIWLSLMLFAIVTIVFCFLISAFFSKAKLAAACGGIIYFLTYMPF-VFVSIREGAAHATIESSEKM--AISLLSTSAFGLGARYFALYEEQGEGVQWSNIGKSPIRGDDFNLLKVLYFLVFDTFLYVILVWYIEAVHPGSYGLPRPWYFPIQPTYWFGHNTNACPNLRKKNYRMMTSDEMEDSPQTPGLLAYEREPVHLPLGVTIDNLQKVY-KSGTKAVDGLNLNLYEGQIMSFLGHNGAGKTTTMSILTGLFPPTAGTGYIYGHDIRFDMDKIRHNLGMCPQHNVLFDGLTVDEHLWFYARMKGMAAHAVKTEMNQLVEDIGLPNKRNCAVETLSGGMKRKLSVAMAFVAGSRTVILDEPTAGVDPYARRAIWDLLIKYKK-GRTILLSTHFMEEADILGDRIAIISSGKLRCVGSPLYLKRRFGEGYNLTLVKKSISSPHGSIGSFRRSTSSNLEASRRSEEKLTSFITSHISSAQLKHKTNQEFTFILPDNSIKRGAFKKLFADLEQNIDVLGIDSYGITHTLLEEVFLKVTDVSLNETGNMPHHRQDKLPTQLLQFPADKPGHLGHVLLSPPLPTLPTNEGLEMSDVVRNRGEDTERLLGYQPLSDSGTHQGNLYNEASNGHAAGLFEGVGSHTLTGSALQWQQFYALMLKRFHYARRNFKGVISQ 1070          

HSP 2 Score: 375.555 bits (963), Expect = 1.983e-105
Identity = 230/634 (36.28%), Postives = 337/634 (53.15%), Query Frame = 1
Query: 3859 PECDCSTTGNQICSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMKQYGGLQFILPSFFGQSCQVIGESQIWFDFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKA-LQNYGIAVANYPLKY--TQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFS-----YLRYNISGGDENYNAFEWDITG-NKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFL 5733
            P C CS  G        + G +    +  + D L +++  N+S+YL+   +TF M +YG L F      G   Q +               SR ++ + + V+ L   +            S+ W N+KGY ++P Y N+ +N +LR+++  SK     YGI   N+P  +  T +   S  Y +   ++ +AIFVI  +SF+PASFV+FL+ ER T +K  Q+VSGV+P VYW+SN+ WD   Y I  L  I     F   +Y    N  A + L  LY  ++ P MYP +F  S++S+A+V +   NL VG   T+TTF L L+  DD  L   ND +K I L FP Y LGRG++DL+++     Y R  I   D   + FEW I   N +C   +L  G+   I+ +  + K  L  +   V   P E    ED DV  ER+R+ L  D  +D++++  LTKIY                  S +  + LAV+ +  GV +GECFGLLGVNGAGKT+TFKML G+  +T G+A++N Y I  D  + H+ +G+CPQFDAL   +T EE +  Y R+RG+   +I   +  +++ ++LT +   P    SGGNKRK+ TAIALIG P I+FL
Sbjct: 1211 PGCRCSANGTWYLCDQGAAGKQPKELVTITRDTLQNVTGRNMSEYLLYTTQTFRMHRYGALSF------GNVVQFV--------------PSRLDSVHIDAVRRLAIREA-----------SKSWYNNKGYHALPTYLNVMNNAILRASIPKSKGNPAAYGITAYNHPFPFNSTSAVHLSADYLRQGTDLVIAIFVIIAMSFVPASFVVFLVTERSTKAKHLQFVSGVDPVVYWLSNYLWDMCNYLIPALACITLLYLFGVPAYASETNFPAVVGLFMLYGWSITPMMYPSAFCFSEASSAYVAMIVLNLFVGVTATVTTFILQLFP-DDEVLTDVNDVIKLISLGFPNYCLGRGLMDLAYNQYLSEYYR-QIGEEDSIKSPFEWMIVSRNLVC---MLMEGFAFFILTILIEFKFFLKRRRIPVSQLPIET---EDEDVAAERDRV-LRGDADDDLVKIENLTKIY-----------------YSRKRGKHLAVDRLCVGVPQGECFGLLGVNGAGKTSTFKMLTGDTAMTAGDAVLNSYRIATDIHRVHRCIGYCPQFDALIDEMTSEEHILLYARLRGVPEKEIKQVMKWAIRKMNLTQYAKTPCKTYSGGNKRKLSTAIALIGDPPIIFL 1787          

HSP 3 Score: 157.147 bits (396), Expect = 4.037e-38
Identity = 165/671 (24.59%), Postives = 304/671 (45.31%), Query Frame = 1
Query: 4297 RSTVN--ASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNISG-GDENYNAFEWDITGNKICSLGILFVG------WCLIIVFMESKHKKTLCI-KLKDVKLKP---YEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKL-AVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDY---YVKIRLHPNRNSL-------------SDRNE--IETIINKEIWSSARMKEENAVIIEYRF---DSSVKLSDIFRVFEDLRTNEMV---KEYSVSQMSLDEVFI 6195
            R+ VN  A + +    + +   P      D F  +   M + + L +  I+ ++ +  S +++  E+R+   K    + G++  V+W++   W     S+  + V+L  +   Y   +   + L   + L L+++  I   +  S F SK+  A    +A   ++  LT +   ++ + +    +   +++ +    L    + LG     L      Y   G G +  N  +  I G+    L +L+        + +++ ++E+ H  +  + +     ++P   +   T+   ++ K+  R+ +  D + D  Q  GL       +       G  I N+    K    AV+ ++  + EG+    LG NGAGKTTT  +L G    T G   I G+ I  D  K   N+G CPQ + L   LT +E L+FY R++G+    +   ++  ++++ L    N     +SGG KRK+  A+A +   + V LDEPT G+D  ARR +W L+  +  +    ++L++H MEE ++L  R+AI+  G+++ +GS  +LK +FG  Y    VK  +     S+             S R+E  + + I   I SSA++K +     E+ F   D+S+K     ++F DL  N  V     Y ++   L+EVF+
Sbjct:  289 RAVVNLHAMREVIKPAVYLHEMPYPCYSKDRFMLVIQHM-MPLCLTVSWIYTVAIVVRS-IVYEKEQRL---KEVMKMMGLSNVVHWVA---WFITSVSVMSITVMLLTVILKYGKVLAFSDPLIIWLSLMLFAIVTIVFCFLISAFFSKAKLA----AACGGIIYFLTYMPFVFVSIREGAAHATIESSEKMAISLLSTSAFGLGARYFAL------YEEQGEGVQWSNIGKSPIRGDDFNLLKVLYFLVFDTFLYVILVWYIEAVHPGSYGLPRPWYFPIQPTYWFGHNTNACPNLRKKNYRM-MTSDEMEDSPQTPGLLAYEREPVHLP---LGVTIDNLQKVYKSGTKAVDGLNLNLYEGQIMSFLGHNGAGKTTTMSILTGLFPPTAGTGYIYGHDIRFDMDKIRHNLGMCPQHNVLFDGLTVDEHLWFYARMKGMAAHAVKTEMNQLVEDIGLPNKRNCAVETLSGGMKRKLSVAMAFVAGSRTVILDEPTAGVDPYARRAIWDLL--IKYKKGRTILLSTHFMEEADILGDRIAIISSGKLRCVGSPLYLKRRFGEGYNLTLVKKSISSPHGSIGSFRRSTSSNLEASRRSEEKLTSFITSHI-SSAQLKHKTNQ--EFTFILPDNSIKRGAFKKLFADLEQNIDVLGIDSYGITHTLLEEVFL 932          

HSP 4 Score: 99.7525 bits (247), Expect = 1.113e-20
Identity = 74/204 (36.27%), Postives = 107/204 (52.45%), Query Frame = 2
Query: 2144 FTRRYWIPFSKNNDNIEISDNFRQREENITIDGFEKEPDDLEIGILIENLVKKF---PKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFL 2746
            F +R  IP S+     E  D   +R+  +  D      DDL   + IENL K +    + K  A+D L +   Q +  G LG NGAGKT+T  +LTG    T+G A +    I  D+  +   IG CPQ + L   +T E+HI  Y  L+G+ + EIK  +   ++++ L++  K   K  SGG KRKLS A+A +G+  IIFL
Sbjct: 1591 FLKRRRIPVSQLPIETEDEDVAAERDRVLRGDA----DDDL---VKIENLTKIYYSRKRGKHLAVDRLCVGVPQGECFGLLGVNGAGKTSTFKMLTGDTAMTAGDAVLNSYRIATDIHRVHRCIGYCPQFDALIDEMTSEEHILLYARLRGVPEKEIKQVMKWAIRKMNLTQYAKTPCKTYSGGNKRKLSTAIALIGDPPIIFL 1787          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Nematostella
Match: EDO48951 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI12])

HSP 1 Score: 434.876 bits (1117), Expect = 1.502e-124
Identity = 304/801 (37.95%), Postives = 467/801 (58.30%), Query Frame = 2
Query: 1151 LAGIVFTDDFQYVTPQNATFLNYQIRMPASRIDSTKNFKVLDRFWTPIPRVNTLTNFNYYT-SGFLFLQEIIDQAFIELITDNASVNIGSSMQI--MPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTXXXXXXXXXXXXXXXXXGKXXXXXXXXXXXXXXXXXXXXXXCQCFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQ--DELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENITIDGFEKEPDDLEIGILIENLVKKFPKSKTP--ALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANINGPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGLFSE 3532
            LA +VF  D +         + Y +RMP S     K ++  +R +     +   T  N+YT SGF  LQ  ID A I+    +        M I  +PYP Y+ D  +  ++NL+P LL +A+  +  ++IK +V+EK+ RLKE M++MG+SN++HW +WF   +L L   II++TI +K+ KI  FS+ I++FL    Y++S I  CF ISVFF N  ++ + G ++++   LP+ +    +  D LS      + LL           I  LE    GA FSNL +S   D +F +   L M+ I S+ Y+++ WY+  VFPG+YG+PKP+YF F + YW  FS ++D +E      + + N  I   E EP DL IG+ I++L K F  S     A+DNL+L  Y+ QIT  LGHNGAGKTTT+SILTG+ TPTSG+A I +  I  D++ IR  +GLCPQHN+LF  LTVE+H+ F+  LKG      K ++  ++ ++ L  K K  S  LSGGMKRKL+ A+A VG S  +FLDEPT+G+DP++RR  WDL++K+++  +T+ILTTH MDEAD+L DRIAI++ G+L+CCGSSLFLK  +G GY+L L     ++ E C +N        ++  +++ +P+++++     +   VL  N      F SLF +L+++ +   IASYG+S T++EEVF+KV +       ++  + I + +L  L+         S+L ++   I        K+    ++N  L +G +L +Q    + +KRF ++KR+ K + ++
Sbjct:  130 LAAVVF--DVEKDKLSLPKVVKYTLRMPHSSAGERKTWRT-ERTYPNFQGIGARTT-NFYTFSGFAILQYAIDMAIIQ-AKASLPFPFAYPMNIKQLPYPGYVQDFFVQTVANLLPLLLTLAFIYSAVSIIKELVFEKQQRLKESMKMMGLSNWIHWSAWFIKCLLFLGFTIIIITIFVKVLKIFEFSNGIVVFLFFLCYIISMISYCFFISVFFSNPTLSMLFGSVLWYAALLPYQLLAQNENYDTLSQSAKASMCLLPNTCLGIGATLIARLEGFKTGASFSNLASSPSADDHFSLAWVLGMMIISSLVYLILTWYISTVFPGQYGIPKPFYFPFMKSYWCGFS-HDDVVEA--GLERVKNNPAI---EDEPTDLAIGVQIKDLRKVFKGSTGSKVAVDNLSLNMYKGQITALLGHNGAGKTTTMSILTGLFTPTSGSAMIDNKSILTDIDGIRESLGLCPQHNVLFDRLTVEEHLEFFINLKGKYGQAAKDEVLQMITDLQLLDKRKAKSSELSGGMKRKLNCAIALVGGSETVFLDEPTSGMDPYARRATWDLLLKHKA-GKTVILTTHFMDEADFLGDRIAIMADGQLRCCGSSLFLKSRYGVGYHLTL-----VKKEDCDDN-------AIINAVRETVPSAQVLSNVGAEIEFVL--NGEASKDFESLFVKLENNKEDYGIASYGVSCTTMEEVFMKVGE-----GSEKTVEDILNLLLRILSSQ-------SLLRYQNIKI--------KILRLLKSNYPLQTGFALQWQHYKAMLVKRFINSKRDKKSVVTQ 884          

HSP 2 Score: 354.369 bits (908), Expect = 8.851e-99
Identity = 231/688 (33.58%), Postives = 374/688 (54.36%), Query Frame = 1
Query: 4237 NSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPL---KYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSF-----FISKSSTAFVV-ISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNI------------SGGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEII-----TDEDLDVFKERERIE-LNHD-VLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHK--VAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSS-VKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAK 6207
            N+ GY  + +  N  SN+LL      S+     GI   N+PL      ++D  +   + +FL    AIF+  G++F+ ASF+ FL++ER + +K  Q+VSGV+ + YW + + WD + Y +  L++++ F AF  + +    ++ +  +LL L+ L V+P +Y  SF      I+ + T FV+ I ++ +L+          + L +    +L    + +  +F++ P Y +   +ID+S +Y    I            +G     ++  WD  G        L++    +++F+      TL I+++    +PY +I     T +D DV  ER R+  LN + +  + + V  LTK+Y+ S                     + AV+++  G+  GECFGLLGVNGAGKTTTF ML G+++I+ G A ++GY I     +  + +G+CPQFDA    +T  E L  + R+RG+QP  IP  V  ++++L+L    +K     SGGNKRK+ TAIAL+G P I+FLDEPT GMD  ARRFLW    +LT+  K   +++LTSH+MEECE LC RLAIMV+G+ K +GS QHLKS+FG  Y + +++      +S+  +  +      +  A++ E +  ++ Y+ +S+ +  S IF   E  R +  + +YSVSQ SL++VF+N AK
Sbjct: 1092 NASGYHIIASSINALSNILLAELSGDSEQ----GIETTNHPLPNNAQNKADNVTSTISVLFL----AIFMSMGMAFMAASFITFLVQERTSKAKHLQFVSGVDAFSYWSATYTWDFLNYLVPCLLILILFAAFQIEEF--ENDMGSVFLLLILFGLVVLPFIYVMSFAFKSQLIAYAMTVFVLSIMSFGMLLA---------VFLCRIPSLNLLDEAEIMHYVFMLLPTYTVSYALIDMSTNYGYRKICSTLQTVESCRDNGIQFTDSSLNWDRPG---VGQHALYMAVEAVVLFI-----LTLLIQVR----RPYRLIPICPWTSQDCDVAGERARVHSLNPEQIKKESVIVKDLTKVYHGS--------------------DRTAVDHLCIGIPRGECFGLLGVNGAGKTTTFSMLTGDQSISEGTAYLDGYDIQTHLKEVQQRIGYCPQFDAFIERMTGREMLTMFARLRGVQPDKIPNVVSTTIEHLNLGKWADKLCGDYSGGNKRKLSTAIALVGNPPIIFLDEPTTGMDPVARRFLW---DSLTHVMKGGRSIVLTSHSMEECEALCTRLAIMVNGQFKCVGSAQHLKSRFGMGYTLMLKVEARLVPVSNTEQFVS----STFPGAQLLESHNGMLTYQINSTELSWSRIFGELERNRASLNIVDYSVSQTSLEQVFLNLAK 1721          

HSP 3 Score: 189.889 bits (481), Expect = 4.619e-48
Identity = 129/428 (30.14%), Postives = 223/428 (52.10%), Query Frame = 2
Query: 2024 GVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEML 3307
            GVG   + + +++V   ++   ++   P +     PW               + + +++   R R  ++  +  +KE       +++++L K +  S   A+D+L +   + +  G LG NGAGKTTT S+LTG  + + GTA++   DI+  ++ ++ +IG CPQ +     +T  + +  +  L+G+   +I + +   ++ + L K    +  + SGG KRKLS A+A VGN  IIFLDEPT G+DP +RR +WD +       R+I+LT+H M+E + LC R+AI+  G+ KC GS+  LK  FG GY L L+   E +     N +         +F+    P ++L++      T  +  NST  + ++ +F +L+ +   L I  Y +S TSLE+VFL +A +  Q S +R + + T   L
Sbjct: 1348 GVGQHALYMAVEAVVLFILTLLIQVRRPYRLIPICPW--------------TSQDCDVAGE-RARVHSLNPEQIKKE------SVIVKDLTKVYHGSDRTAVDHLCIGIPRGECFGLLGVNGAGKTTTFSMLTGDQSISEGTAYLDGYDIQTHLKEVQQRIGYCPQFDAFIERMTGREMLTMFARLRGVQPDKIPNVVSTTIEHLNLGKWADKLCGDYSGGNKRKLSTAIALVGNPPIIFLDEPTTGMDPVARRFLWDSLTHVMKGGRSIVLTSHSMEECEALCTRLAIMVNGQFKCVGSAQHLKSRFGMGYTLMLK--VEARLVPVSNTE---------QFVSSTFPGAQLLESHNGMLTYQI--NSTELS-WSRIFGELERNRASLNIVDYSVSQTSLEQVFLNLAKE--QYSEERTKVKRTCGCL 1738          

HSP 4 Score: 168.703 bits (426), Expect = 1.214e-41
Identity = 107/308 (34.74%), Postives = 165/308 (53.57%), Query Frame = 1
Query: 5305 KLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRF--DSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVT 6222
            K+AV+N+S  + +G+   LLG NGAGKTTT  +L G    T G+A+I+  SI+ D     +++G CPQ + L   LT EE L F+  ++G         V   + +L L       +  +SGG KRK+  AIAL+G  + VFLDEPT GMD  ARR  W L+  L ++    VILT+H M+E + L  R+AIM DG+++  GS   LKS++G  Y++ +     +    D N I   + +E   SA++       IE+    ++S     +F   E+ + +  +  Y VS  +++EVF+   +    T
Sbjct:  515 KVAVDNLSLNMYKGQITALLGHNGAGKTTTMSILTGLFTPTSGSAMIDNKSILTDIDGIRESLGLCPQHNVLFDRLTVEEHLEFFINLKGKYGQAAKDEVLQMITDLQLLDKRKAKSSELSGGMKRKLNCAIALVGGSETVFLDEPTSGMDPYARRATWDLL--LKHKAGKTVILTTHFMDEADFLGDRIAIMADGQLRCCGSSLFLKSRYGVGYHLTLV----KKEDCDDNAIINAV-RETVPSAQVLSNVGAEIEFVLNGEASKDFESLFVKLENNKEDYGIASYGVSCTTMEEVFMKVGEGSEKT 815          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Nematostella
Match: EDO32070 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW56])

HSP 1 Score: 245.743 bits (626), Expect = 4.248e-70
Identity = 172/494 (34.82%), Postives = 287/494 (58.10%), Query Frame = 2
Query: 1418 SMQIMPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTXXXXXXXXXXXXXXXXXGKXXXXXXXXXXXXXXXXXXXXXXCQCFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYW-IPFSKNNDNIEISDNFRQREENITIDGFEKEPDDLEI----GILIENLVKKFP-KSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDI-RY-DMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLC 2875
            ++Q+MP   +     +  +  ++P  +V+A++P +T L+ ++V EK+ + KE MR+MGM +  +W+SWF +  +++++  ++M  +  +      S+ +++ ++ + Y +S I   FM+S  F N   A  +  +   IF +  L+       +     + V + +  +F  A+N      +   GAQFSNL        +F V +C++M+ +D + Y+LIA Y++AV P +YG  +P YF+F   +W   F +   ++E     RQ   +      + EP   E+     I I NL K FP K  T A+D +++  Y+ QIT  LGHNGAGK+T I  LTG++ P+SGTA I   DI R+ D+  +R  IG+CPQ +++F +LTV++H+ FY  LK    S+  +    I+KE+GL +K   ++KNLSGG KRKLS+ ++ VG+ +++FLDEPT+G+DP SRR +W L+ + +   + ++LTTH MDEAD L 
Sbjct:   41 TVQMMPKAQFTPS--LQGIQTIVPIYMVLAFSPYITILVINLVREKQEKHKELMRIMGMVDTAYWLSWFLTYAIVVLIACLIMVTVSVIAGFFGESNYLVLLIVFYLYGLSIIMLSFMMSPLFKNPKTAGFIASLFTAIFAV--LIIPLTGPSIPQYAKWLVSIFSPTAFAFALN---EAVEVHPGAQFSNLATKG----DFPVLNCIVMLIVDILLYLLIALYLDAVVPAEYGRRQPPYFIFQPSFWKTMFQRGGGSLEAHGVRRQLSAHEVYSSEDVEPVAQEMHGREAISIHNLKKVFPGKKPTVAVDGISMDIYEGQITALLGHNGAGKSTLIGALTGMIQPSSGTALIYGKDISRFGDLAELRRNIGVCPQQDVIFEFLTVKEHLEFYFKLKTGGDSQQNNGADAILKEIGLQEKKDDIAKNLSGGQKRKLSVGISLVGDPKVLFLDEPTSGMDPHSRREMWKLL-QGQCKEKCVLLTTHFMDEADILA 522          

HSP 2 Score: 129.413 bits (324), Expect = 6.390e-31
Identity = 74/191 (38.74%), Postives = 106/191 (55.50%), Query Frame = 1
Query: 5299 KRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSI--IDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLC 5865
            K  +AV+ IS  + EG+   LLG NGAGK+T    L G    + G A+I G  I    D  +  +N+G CPQ D +   LT +E L FY +++    S      D  LK + L    +     +SGG KRK+   I+L+G PK++FLDEPT GMD  +RR +W+L+Q    E    V+LT+H M+E ++L 
Sbjct:  334 KPTVAVDGISMDIYEGQITALLGHNGAGKSTLIGALTGMIQPSSGTALIYGKDISRFGDLAELRRNIGVCPQQDVIFEFLTVKEHLEFYFKLKTGGDSQQNNGADAILKEIGLQEKKDDIAKNLSGGQKRKLSVGISLVGDPKVLFLDEPTSGMDPHSRREMWKLLQGQCKEK--CVLLTTHFMDEADILA 522          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Nematostella
Match: EDO32071 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW57])

HSP 1 Score: 205.682 bits (522), Expect = 1.386e-58
Identity = 120/313 (38.34%), Postives = 181/313 (57.83%), Query Frame = 1
Query: 5305 KLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETII---NKEIWSSARMKEENAVIIEYRFDSS--VKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRN 6228
            K+ V ++ FGV  GE FGLLG NGAGKTTT  M+      + G+  + GY +  +T K  ++MGFCPQ DAL   +T EE L  Y  +RG+  + I   V+  +  + +T H NK    +SGG KRK+   +A++G P ++ LDEP+ GMD  ARRFL + +           ILT+H+MEE + LC R+ IMV G++K +GS QHLKSKFG  Y ++I+L P+  S     +++T +    + ++ +A+  E     + Y+   S   KLS  F   E+ + +  ++EYS SQ +L++VF+ FA+     R 
Sbjct:    1 KVVVKDVYFGVTPGEVFGLLGPNGAGKTTTLNMMTAGIPASRGSVSVAGYDLQTETHKVFQHMGFCPQQDALFDDITLEEHLTLYASVRGVPWASIDNVVNHYMSAMKITEHANKRAKELSGGTKRKLSFGMAMLGDPDLLLLDEPSTGMDPSARRFLCKNVTGAR-----GAILTTHSMEEADALCSRVGIMVKGQLKCLGSTQHLKSKFGSGYTLEIKLSPSFQSSDPDVDMQTQLVAFVEGLFPNAKRTESFGDRVIYKVPKSNVSKLSSTFATLEEGKRSIGIEEYSFSQSTLEQVFLEFAREQDDDRT 308          

HSP 2 Score: 156.762 bits (395), Expect = 1.133e-41
Identity = 99/298 (33.22%), Postives = 171/298 (57.38%), Query Frame = 2
Query: 2360 QITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADD 3253
            ++ G LG NGAGKTTT++++T  +  + G+  +   D++ +   +   +G CPQ + LF  +T+E+H+  Y  ++G+  + I + +   +  + +++     +K LSGG KRKLS  MA +G+  ++ LDEP+ G+DP +RR     + K  +  R  ILTTH M+EAD LC R+ I+ +G+LKC GS+  LK  FG GY L ++ S   QS    ++   +  T+L+ F++ + PN+K  +    +  V+     +N ++ +S F  L+     + I  Y  S ++LE+VFL+ A +
Sbjct:   15 EVFGLLGPNGAGKTTTLNMMTAGIPASRGSVSVAGYDLQTETHKVFQHMGFCPQQDALFDDITLEEHLTLYASVRGVPWASIDNVVNHYMSAMKITEHANKRAKELSGGTKRKLSFGMAMLGDPDLLLLDEPSTGMDPSARR----FLCKNVTGARGAILTTHSMEEADALCSRVGIMVKGQLKCLGSTQHLKSKFGSGYTLEIKLSPSFQS----SDPDVDMQTQLVAFVEGLFPNAKRTESFGDR--VIYKVPKSNVSKLSSTFATLEEGKRSIGIEEYSFSQSTLEQVFLEFARE 302          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Medaka
Match: ENSORLT00000045391.1 (ATP-binding cassette sub-family A member 1-like [Source:NCBI gene;Acc:101164844])

HSP 1 Score: 612.838 bits (1579), Expect = 0.000e+0
Identity = 387/1030 (37.57%), Postives = 586/1030 (56.89%), Query Frame = 2
Query:  611 SDQNDIDVFLQNFNLSLINSTKSIPTCQLAFMNYFTKSNGLSVLYPIIGPLVFGKIYYTPNSAFTQEIIRRANSTFRILDNLRLASVEWRL--TFSNWLINNSTNMGLLNDARNYCANSRTLMCQIINNSLSIETIQSTIASLSAMFVLIENSLNCTQLNKFTPMPSSIDI--DNLSKQSSLGILAGIVFTDDFQYVTPQNATFLNYQIRMPASRIDSTKNFKVLDRFWTPIPRVNTLTNFNYYTSGFLFLQEIIDQAFIELITDNASVNIGSSMQIMPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTXXXXXXXXXXXXXXXXXGKXXXXXXXXXXXXXXXXXXXXXXCQCFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENITIDGFEKEPD-DLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKS----FEIQSETCHNNKASESGTK----------------------------LLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADD------------PSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTIN-------TANINGPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGLFSE 3532
            SDQ D        N S  NS  S P C    ++    +  +  L+    PL+ GK+ YTP++   + ++  AN+TF  L  ++  +  W     F    + N T +   + A +  +++ T             T +     L+    L+   L C +LNKF  +P+  ++  + L    +    AGIVF ++ Q  +     +L Y+IRM    +  T   KV +R W+P    N   N  Y   GF +L++IID A I L T + S  +G  +Q MPYPCY++D  +  L+  +P  + IAW  +V  ++K IV +KE+RLKE +R+MG+   V+W +W  + +L + +  +L+TII+K GK+L +S P ++F+ L  + +S I +CF+ISVFF  +N+AA  GG++YF+ YLP ++   ++D +  +   GV LL+ V+F      +   E+   G Q+ N+  S      +     ++M+ +D+  Y ++ WY+E VFPG+YG+P+PWYFLFT  YW  F K +   +I DNF+  + +   + F ++PD +++ G+ I NLVK +   K  A+D L++ FY++QIT FLGHNGAGKTTT+SILTG+  PTSGTA I   DIR DM+ IR  +G+CPQHN+LF  LTVE+HIYFYG LKG+  SE++ ++  ++K+VGL  K K + KNLSGGM+RKLS+A+AFVG S+I+FLDEPTAGVDPF+RRGIWDL++KY+   RTIIL+THHMDEAD L DRIAIIS GK++CCGSS+FLK++FG GYYL L +S       Q     +  A E  T+                            + +F+++ +P +  ++    + T +L +       F +LF++LD  +D L + SYG+SDT+LEE+FLKVA+D            P    +K+  ++     +      G   +  +    +KK  N       +A++NG           V+++G  LI QQ   LFIKRFHH +R+ KGL ++
Sbjct:   19 SDQQD------TMNSSFQNSQDSDPFCT-TLIDTMVTTPSMQFLWKNFRPLLKGKVLYTPDTPAARLLVEEANATFMALAAIKEFADSWGEDGPFVWGFVENGTAVVNESSANSNNSSTDT-----------PPTSEDAYNDLTHFLKLLSKVLGCFELNKFEAVPTEYELVTEALEHLKNDTFWAGIVF-ENLQPNSSSIPPYLKYKIRMDVEEVQRTD--KVENRLWSPGANDNPYENLRYIWGGFAYLEDIIDHASIRLQT-STSQPLGVYVQQMPYPCYVDDPFLRALAGFLPLFMTIAWIFSVALIVKGIVGDKESRLKETVRIMGLRGEVYWSTWLLTCLLPMAISSVLLTIIIKYGKVLQYSDPSVVFIFLLVFCLSTISECFLISVFFSKANLAAACGGLIYFLLYLPHVLCYAWRDVMGFQAKVGVSLLSCVAFGYGCENLSKFEEQGVGIQWHNIATSPEEGQRYTFIVSILMMLLDAAIYWVLTWYIENVFPGQYGIPRPWYFLFTYSYW--FGKTSVPEDIPDNFKLLKRSSVPNEFLEKPDPNMKAGVSIRNLVKIYKTGKKVAVDGLSVDFYENQITSFLGHNGAGKTTTMSILTGLFPPTSGTALINGYDIRTDMDNIRKYLGMCPQHNVLFDELTVEEHIYFYGRLKGLNPSELQTEMDQMIKDVGLLHKRKDLVKNLSGGMQRKLSVAIAFVGGSKIVFLDEPTAGVDPFARRGIWDLLLKYKK-GRTIILSTHHMDEADILGDRIAIISHGKMRCCGSSIFLKKSFGSGYYLTLVRSGTEVMTAQRSGIISGIAEEKPTESDCPSSSSLDEDRGCQSSDNSNPTDLKHVTQFVRRHVPEAVFLESIGQEITFILPYARARDGTFATLFQELDKVMDKLGLTSYGVSDTTLEEIFLKVAEDTGVDKELSPTKEPVVKDYKKDSRESKRRSMSRFH--GKAAKGNTKDELKKKLSNKVEDFKKSASVNG--------RGSVVITGWKLIRQQFLALFIKRFHHARRSRKGLIAQ 1013          

HSP 2 Score: 506.908 bits (1304), Expect = 0.000e+0
Identity = 308/895 (34.41%), Postives = 485/895 (54.19%), Query Frame = 1
Query: 3604 PSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMNTSLYQLENFKC-------LYP---------YNTNKWSEKSPIEISLVTPECDCSTTGNQI----CSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMKQYGGLQFILPSFFGQSCQVIGESQIWFDFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNIS---GGDENYNAFEWDITGNKICSL---GILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSV-KLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAK 6207
            PS+ + PW+   +T      TFY  +   D    ++ E    + G  G RCM  +   +    C         P         +    WS  +P      +P C CST G  I    C     G      R+  ++D L +L+S N++D+L+K ++    K+YGG+     S  G + QV+            I  +  N   P     +   ++     G + N+ ++W  +KG+ SM ++ ++ +N +LR  +   + L+ YG++V+N+PL  ++  L     A    +V ++I VIF +SFIPASFV+FLI+ERV+ +K  Q+VSGVNP VYW+++F WD   Y I   +V+  F+ F  ++Y+  +N+ A I+LL +Y  A+ P MYP SF  +  STA+VV++  NL +G   ++ TF ++L++  D S+   N+ +K++ LIFP + LGRG++D++ +    N+    G D   +   W++ G  + ++   G +   + L+I     ++K     +L   K++  E    ED+DV +ER+R+       NDVL++  LTK+Y                      K   AV  +  GV   ECFGLLG+NGAGKTTTFKML G+  ++ G A +NGYSI       H+NMG+CPQFDA++ LL   E L  Y R+RG+   ++ +  +  ++ L L  + NK     SGGNKRK+ TA+ALIG P ++FLDEPT GMD  ARRFLW  I ++  E + +V+LTSH+MEECE LC R+AIMV+G  + +GS+QHLK++FG  Y + +R+        D   +E  + +E +    +KE++   ++Y+  S    L+ IF    D +    +++YSVSQ +LD+VF+NFAK
Sbjct: 1038 PSLELQPWMYNSQT------TFYSNDMPEDANVSRVVETLVDNPG-FGTRCMEGN--PIPRLPCSSGASDWFSPSVDQSVADIFLNGNWSMSNP------SPSCQCSTPGRTIIMPDCPPGAGGL-PPPQRVQNTTDTLLNLTSINMTDFLLKTYEHSGKKRYGGI-----SVGGINSQVLLT-------EVEIEEAFANLEPPGYGDTIQKAEMVLKKLGTRNNV-KVWFYNKGWHSMVSFLSVVNNGILRGYLPEGQNLRQYGLSVSNHPLNLSKEQLSLSAMASTSSDVVVSICVIFAMSFIPASFVLFLIQERVSKAKHLQFVSGVNPTVYWVASFVWDICNYVIPCFLVVGIFICFQQKAYVSPQNLPALILLLVMYGWAITPMMYPASFIFTVPSTAYVVLTCLNLFIGINGSVATFVMELFE--DESITKINNIVKQVLLIFPHFCLGRGLMDMARNQAMANVFSNFGEDRFEDPLSWNMVGKNLIAMSIQGAVMFAFTLLI-----QYKFFYKPRLSLPKVQSEE---KEDVDVARERQRVHEGR-ANNDVLRICDLTKVY--------------------PRKSTPAVYRLCVGVPAAECFGLLGINGAGKTTTFKMLTGDIPVSSGEAFLNGYSIRTQMGDVHQNMGYCPQFDAINDLLNGREHLELYARLRGVPEEEVAMVAEWGIQKLGLVKYANKSAGTYSGGNKRKLSTAMALIGCPPVIFLDEPTTGMDPKARRFLWDCILSVIKEGR-SVVLTSHSMEECEALCTRMAIMVNGRFQCLGSIQHLKNRFGDGYTLIVRVG---GCPPDLKPVEDFV-EETFPGTVLKEKHHNTLQYQLLSQEGALAKIFTELTDHQQELGLEDYSVSQTTLDQVFVNFAK 1867          

HSP 3 Score: 174.866 bits (442), Expect = 5.129e-43
Identity = 108/354 (30.51%), Postives = 174/354 (49.15%), Query Frame = 1
Query: 5302 RKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLH--------------------------PNRNSL--------------SDRNEIETIINKEIWSSARMK---EENAVIIEYRFDSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRNIS 6234
            +K+AV+ +S    E +    LG NGAGKTTT  +L G    T G A+INGY I  D     K +G CPQ + L   LT EE +YFY R++G+ PS++   +D  +K++ L          +SGG +RK+  AIA +G  KIVFLDEPT G+D  ARR +W L+  L  +    +IL++H+M+E ++L  R+AI+  G+M+  GS   LK  FG  YY+ +                             P+ +SL              +D   +   + + +  +  ++   +E   I+ Y        + +F+  + +     +  Y VS  +L+E+F+  A++  V + +S
Sbjct:  568 KKVAVDGLSVDFYENQITSFLGHNGAGKTTTMSILTGLFPPTSGTALINGYDIRTDMDNIRKYLGMCPQHNVLFDELTVEEHIYFYGRLKGLNPSELQTEMDQMIKDVGLLHKRKDLVKNLSGGMQRKLSVAIAFVGGSKIVFLDEPTAGVDPFARRGIWDLL--LKYKKGRTIILSTHHMDEADILGDRIAIISHGKMRCCGSSIFLKKSFGSGYYLTLVRSGTEVMTAQRSGIISGIAEEKPTESDCPSSSSLDEDRGCQSSDNSNPTDLKHVTQFVRRHVPEAVFLESIGQEITFILPYARARDGTFATLFQELDKVMDKLGLTSYGVSDTTLEEIFLKVAEDTGVDKELS 919          

HSP 4 Score: 172.94 bits (437), Expect = 1.912e-42
Identity = 113/350 (32.29%), Postives = 179/350 (51.14%), Query Frame = 2
Query: 2282 IENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNN-KASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNS------TNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLD 3310
            I +L K +P+  TPA+  L +    ++  G LG NGAGKTTT  +LTG +  +SG AF+    IR  M  +   +G CPQ + +   L   +H+  Y  L+G+ + E+       ++++GL K     +   SGG KRKLS AMA +G   +IFLDEPT G+DP +RR +WD I+      R+++LT+H M+E + LC R+AI+  G+ +C GS   LK  FGDGY L       ++   C  + K  E      +F+++  P + L ++          HN+      +       +F +L      L +  Y +S T+L++VF+  A +     H  ++ Q     +D
Sbjct: 1559 ICDLTKVYPRKSTPAVYRLCVGVPAAECFGLLGINGAGKTTTFKMLTGDIPVSSGEAFLNGYSIRTQMGDVHQNMGYCPQFDAINDLLNGREHLELYARLRGVPEEEVAMVAEWGIQKLGLVKYANKSAGTYSGGNKRKLSTAMALIGCPPVIFLDEPTTGMDPKARRFLWDCILSVIKEGRSVVLTSHSMEECEALCTRMAIMVNGRFQCLGSIQHLKNRFGDGYTLI------VRVGGCPPDLKPVE------DFVEETFPGTVLKEK---------HHNTLQYQLLSQEGALAKIFTELTDHQQELGLEDYSVSQTTLDQVFVNFAKE----QHDEEDLQAHDNPVD 1883          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Medaka
Match: ENSORLT00000046301.1 (ATP-binding cassette sub-family A member 1-like [Source:NCBI gene;Acc:101164844])

HSP 1 Score: 607.446 bits (1565), Expect = 0.000e+0
Identity = 388/1030 (37.67%), Postives = 586/1030 (56.89%), Query Frame = 2
Query:  611 SDQNDIDVFLQNFNLSLINSTKSIPTCQLAFMNYFTKSNGLSVLYPIIGPLVFGKIYYTPNSAFTQEIIRRANSTFRILDNLRLASVEWRL--TFSNWLINNSTNMGLLNDARNYCANSRTLMCQIINNSLSIETIQSTIASLSAMFVLIENSLNCTQLNKFTPMPSSIDI--DNLSKQSSLGILAGIVFTDDFQYVTPQNATFLNYQIRMPASRIDSTKNFKVLDRFWTPIPRVNTLTNFNYYTSGFLFLQEIIDQAFIELITDNASVNIGSSMQIMPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTXXXXXXXXXXXXXXXXXGKXXXXXXXXXXXXXXXXXXXXXXCQCFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENITIDGFEKEPD-DLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKS----FEIQSETCHNNKASESGTK----------------------------LLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADD------------PSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTIN-------TANINGPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGLFSE 3532
            SDQ D        N S  NS  S P C    ++    +  +  L+    PL+ GK+ YTP++   + ++  AN+TF  L  ++  +  W     F    + N T +   + A +  +++ T             T +     L+    L+   L C +LNKF  +P+  ++  + L    +    AGIVF ++ Q  +     +L Y+IRM    +  T   KV +R W+P    N   N  Y   GF +L++IID A I L T + S  +G  +Q MPYPCY++D  I  +  ++P  L++A+  +V   IK +V EKE RLKE +R +G+ N   W S FT T+++L +P +LM++++K GK+L +S P ++F+ L  + +S I +CF+ISVFF  +N+AA  GG++YF+ YLP ++   ++D +  +   GV LL+ V+F      +   E+   G Q+ N+  S      +     ++M+ +D+  Y ++ WY+E VFPG+YG+P+PWYFLFT  YW  F K +   +I DNF+  + +   + F ++PD +++ G+ I NLVK +   K  A+D L++ FY++QIT FLGHNGAGKTTT+SILTG+  PTSGTA I   DIR DM+ IR  +G+CPQHN+LF  LTVE+HIYFYG LKG+  SE++ ++  ++K+VGL  K K + KNLSGGM+RKLS+A+AFVG S+I+FLDEPTAGVDPF+RRGIWDL++KY+   RTIIL+THHMDEAD L DRIAIIS GK++CCGSS+FLK++FG GYYL L +S       Q     +  A E  T+                            + +F+++ +P +  ++    + T +L +       F +LF++LD  +D L + SYG+SDT+LEE+FLKVA+D            P    +K+  ++     +      G   +  +    +KK  N       +A++NG           V+++G  LI QQ   LFIKRFHH +R+ KGL ++
Sbjct:   19 SDQQD------TMNSSFQNSQDSDPFCT-TLIDTMVTTPSMQFLWKNFRPLLKGKVLYTPDTPAARLLVEEANATFMALAAIKEFADSWGEDGPFVWGFVENGTAVVNESSANSNNSSTDT-----------PPTSEDAYNDLTHFLKLLSKVLGCFELNKFEAVPTEYELVTEALEHLKNDTFWAGIVF-ENLQPNSSSIPPYLKYKIRMDVEEVQRTD--KVENRLWSPGANDNPYENLRYIWGGFAYLEDIIDHASIRLQT-STSQPLGVYVQQMPYPCYVDDPFIQSIGAILPMFLILAFMSSVAMTIKGLVLEKELRLKEVLRGVGIQNGALWSSTFTETMILLTVPCVLMSVMVKYGKVLQYSDPSVVFIFLLVFCLSTISECFLISVFFSKANLAAACGGLIYFLLYLPHVLCYAWRDVMGFQAKVGVSLLSCVAFGYGCENLSKFEEQGVGIQWHNIATSPEEGQRYTFIVSILMMLLDAAIYWVLTWYIENVFPGQYGIPRPWYFLFTYSYW--FGKTSVPEDIPDNFKLLKRSSVPNEFLEKPDPNMKAGVSIRNLVKIYKTGKKVAVDGLSVDFYENQITSFLGHNGAGKTTTMSILTGLFPPTSGTALINGYDIRTDMDNIRKYLGMCPQHNVLFDELTVEEHIYFYGRLKGLNPSELQTEMDQMIKDVGLLHKRKDLVKNLSGGMQRKLSVAIAFVGGSKIVFLDEPTAGVDPFARRGIWDLLLKYKK-GRTIILSTHHMDEADILGDRIAIISHGKMRCCGSSIFLKKSFGSGYYLTLVRSGTEVMTAQRSGIISGIAEEKPTESDCPSSSSLDEDRGCQSSDNSNPTDLKHVTQFVRRHVPEAVFLESIGQEITFILPYARARDGTFATLFQELDKVMDKLGLTSYGVSDTTLEEIFLKVAEDTGVDKELSPTKEPVVKDYKKDSRESKRRSMSRFH--GKAAKGNTKDELKKKLSNKVEDFKKSASVNG--------RGSVVITGWKLIRQQFLALFIKRFHHARRSRKGLIAQ 1013          

HSP 2 Score: 506.908 bits (1304), Expect = 0.000e+0
Identity = 308/895 (34.41%), Postives = 485/895 (54.19%), Query Frame = 1
Query: 3604 PSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMNTSLYQLENFKC-------LYP---------YNTNKWSEKSPIEISLVTPECDCSTTGNQI----CSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMKQYGGLQFILPSFFGQSCQVIGESQIWFDFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNIS---GGDENYNAFEWDITGNKICSL---GILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSV-KLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAK 6207
            PS+ + PW+   +T      TFY  +   D    ++ E    + G  G RCM  +   +    C         P         +    WS  +P      +P C CST G  I    C     G      R+  ++D L +L+S N++D+L+K ++    K+YGG+     S  G + QV+            I  +  N   P     +   ++     G + N+ ++W  +KG+ SM ++ ++ +N +LR  +   + L+ YG++V+N+PL  ++  L     A    +V ++I VIF +SFIPASFV+FLI+ERV+ +K  Q+VSGVNP VYW+++F WD   Y I   +V+  F+ F  ++Y+  +N+ A I+LL +Y  A+ P MYP SF  +  STA+VV++  NL +G   ++ TF ++L++  D S+   N+ +K++ LIFP + LGRG++D++ +    N+    G D   +   W++ G  + ++   G +   + L+I     ++K     +L   K++  E    ED+DV +ER+R+       NDVL++  LTK+Y                      K   AV  +  GV   ECFGLLG+NGAGKTTTFKML G+  ++ G A +NGYSI       H+NMG+CPQFDA++ LL   E L  Y R+RG+   ++ +  +  ++ L L  + NK     SGGNKRK+ TA+ALIG P ++FLDEPT GMD  ARRFLW  I ++  E + +V+LTSH+MEECE LC R+AIMV+G  + +GS+QHLK++FG  Y + +R+        D   +E  + +E +    +KE++   ++Y+  S    L+ IF    D +    +++YSVSQ +LD+VF+NFAK
Sbjct: 1038 PSLELQPWMYNSQT------TFYSNDMPEDANVSRVVETLVDNPG-FGTRCMEGN--PIPRLPCSSGASDWFSPSVDQSVADIFLNGNWSMSNP------SPSCQCSTPGRTIIMPDCPPGAGGL-PPPQRVQNTTDTLLNLTSINMTDFLLKTYEHSGKKRYGGI-----SVGGINSQVLLT-------EVEIEEAFANLEPPGYGDTIQKAEMVLKKLGTRNNV-KVWFYNKGWHSMVSFLSVVNNGILRGYLPEGQNLRQYGLSVSNHPLNLSKEQLSLSAMASTSSDVVVSICVIFAMSFIPASFVLFLIQERVSKAKHLQFVSGVNPTVYWVASFVWDICNYVIPCFLVVGIFICFQQKAYVSPQNLPALILLLVMYGWAITPMMYPASFIFTVPSTAYVVLTCLNLFIGINGSVATFVMELFE--DESITKINNIVKQVLLIFPHFCLGRGLMDMARNQAMANVFSNFGEDRFEDPLSWNMVGKNLIAMSIQGAVMFAFTLLI-----QYKFFYKPRLSLPKVQSEE---KEDVDVARERQRVHEGR-ANNDVLRICDLTKVY--------------------PRKSTPAVYRLCVGVPAAECFGLLGINGAGKTTTFKMLTGDIPVSSGEAFLNGYSIRTQMGDVHQNMGYCPQFDAINDLLNGREHLELYARLRGVPEEEVAMVAEWGIQKLGLVKYANKSAGTYSGGNKRKLSTAMALIGCPPVIFLDEPTTGMDPKARRFLWDCILSVIKEGR-SVVLTSHSMEECEALCTRMAIMVNGRFQCLGSIQHLKNRFGDGYTLIVRVG---GCPPDLKPVEDFV-EETFPGTVLKEKHHNTLQYQLLSQEGALAKIFTELTDHQQELGLEDYSVSQTTLDQVFVNFAK 1867          

HSP 3 Score: 174.866 bits (442), Expect = 4.959e-43
Identity = 108/354 (30.51%), Postives = 174/354 (49.15%), Query Frame = 1
Query: 5302 RKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLH--------------------------PNRNSL--------------SDRNEIETIINKEIWSSARMK---EENAVIIEYRFDSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRNIS 6234
            +K+AV+ +S    E +    LG NGAGKTTT  +L G    T G A+INGY I  D     K +G CPQ + L   LT EE +YFY R++G+ PS++   +D  +K++ L          +SGG +RK+  AIA +G  KIVFLDEPT G+D  ARR +W L+  L  +    +IL++H+M+E ++L  R+AI+  G+M+  GS   LK  FG  YY+ +                             P+ +SL              +D   +   + + +  +  ++   +E   I+ Y        + +F+  + +     +  Y VS  +L+E+F+  A++  V + +S
Sbjct:  568 KKVAVDGLSVDFYENQITSFLGHNGAGKTTTMSILTGLFPPTSGTALINGYDIRTDMDNIRKYLGMCPQHNVLFDELTVEEHIYFYGRLKGLNPSELQTEMDQMIKDVGLLHKRKDLVKNLSGGMQRKLSVAIAFVGGSKIVFLDEPTAGVDPFARRGIWDLL--LKYKKGRTIILSTHHMDEADILGDRIAIISHGKMRCCGSSIFLKKSFGSGYYLTLVRSGTEVMTAQRSGIISGIAEEKPTESDCPSSSSLDEDRGCQSSDNSNPTDLKHVTQFVRRHVPEAVFLESIGQEITFILPYARARDGTFATLFQELDKVMDKLGLTSYGVSDTTLEEIFLKVAEDTGVDKELS 919          

HSP 4 Score: 172.94 bits (437), Expect = 1.817e-42
Identity = 113/350 (32.29%), Postives = 179/350 (51.14%), Query Frame = 2
Query: 2282 IENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNN-KASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNS------TNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLD 3310
            I +L K +P+  TPA+  L +    ++  G LG NGAGKTTT  +LTG +  +SG AF+    IR  M  +   +G CPQ + +   L   +H+  Y  L+G+ + E+       ++++GL K     +   SGG KRKLS AMA +G   +IFLDEPT G+DP +RR +WD I+      R+++LT+H M+E + LC R+AI+  G+ +C GS   LK  FGDGY L       ++   C  + K  E      +F+++  P + L ++          HN+      +       +F +L      L +  Y +S T+L++VF+  A +     H  ++ Q     +D
Sbjct: 1559 ICDLTKVYPRKSTPAVYRLCVGVPAAECFGLLGINGAGKTTTFKMLTGDIPVSSGEAFLNGYSIRTQMGDVHQNMGYCPQFDAINDLLNGREHLELYARLRGVPEEEVAMVAEWGIQKLGLVKYANKSAGTYSGGNKRKLSTAMALIGCPPVIFLDEPTTGMDPKARRFLWDCILSVIKEGRSVVLTSHSMEECEALCTRMAIMVNGRFQCLGSIQHLKNRFGDGYTLI------VRVGGCPPDLKPVE------DFVEETFPGTVLKEK---------HHNTLQYQLLSQEGALAKIFTELTDHQQELGLEDYSVSQTTLDQVFVNFAKE----QHDEEDLQAHDNPVD 1883          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Medaka
Match: ENSORLT00000025407.2 (ATP-binding cassette sub-family A member 1 [Source:NCBI gene;Acc:101163308])

HSP 1 Score: 574.318 bits (1479), Expect = 0.000e+0
Identity = 380/1046 (36.33%), Postives = 576/1046 (55.07%), Query Frame = 2
Query:  656 SLINSTKSIPTCQLAFMNYFTKSNGLSVLYPIIGPLVFGKIYYTPNSAFTQEIIRRANSTFRILDNLRLASVEWR-LTFSNW-LINNSTNMGLLNDARNYCANSRTLMCQIINNSLSIETIQS-------------TIASLSAMF-------VLIENSLNCTQLNKFTPMPSSIDIDNLSKQ--SSLGILAGIVFTDDFQYVTPQNATFL----NYQIRMPASRIDSTKNFKVLDRFWTPIPRVNTLTNFNYYTSGFLFLQEIIDQAFIELITDNASVNIGSSMQIMPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTXXXXXXXXXXXXXXXXXGKXXXXXXXXXXXXXXXXXXXXXXCQCFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEK--------------------------------------SFEIQSETCHNNKASE--------SGTKLLE-FIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQI-TSEMLDTLTDGG----NLPRPVSVLSFRKKTINTANINGPKVSFEFE-------NNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGLFSE 3532
            S +    S P C  + ++    S    +++  + PL+ GKI YTP++  TQ+II   N TF+ L   R     W  +    W  + +S  M ++         +  L  ++ +   +++T+ +             +I +   +F       + I   + C  L+K  P+ +   + N S +        AGIVF D    + P NAT L    NY+IRM    ++ T   K+ D +W P PR +   +  Y   GF +LQ++I+Q  I  +T       G  +Q MPYPCY++D  +  +S  MP  + +AW  +V+ ++KS+VYEKE RLKE MR+MG+ N + W SWF S+++ L++   L+ ++LK G +L +S P +IFL L  + V  I QCF+IS  F  +N+AA  GGI+YF  YLP+++ + +QD +         LL+ V+F     +    E+   G Q+SNL +S + + +F +   +++++ DS  Y ++ WY+EAVFPG+YG+P+PWYF FT+ YW    K+ ++ +I  N R+ +  + +   E+EP  LE G+ IENLVK + + K  A+D L L FY+ QIT FLGHNGAGKTTT+SILTG+  PTSGTA+IL  DIR D+  IR  +G+CPQHN+LF+ LTVE+HI+FY  LKG+ + ++K ++  I+++ GL  K +  +  LSGGM+RKLS+A+AFVG ++++ LDEPTAGVDP++RRGIWDL++KYR   RTIIL+THHMDEAD L DRIAIIS GKL C GSSL+LK   G GYYL L K                                        E ++ T  N  A+         + T L+   I + +P ++L+++   + T +L +++     F  LF+ LD  L  L I+SYG+SDT+LEE+FLKVA+D    +    +  +       T   GG    +  +P+S       T +  +  G     E +            ++G SL  QQ   L  KRF + +R+ KG F++
Sbjct:  351 STLYDNSSTPFCN-SLVSNMDSSPMAHMIWQALKPLLLGKILYTPHTPATQKIIHEVNRTFQELGVFRDLGGMWEEMRPKVWDFMESSQEMNMIRTMLKNNITASFLTSKLASTDWTVDTLSTFLSNQVDNSHLPESIVTWRKVFNETDQAIMSISRFMECVNLDKLEPVSNEELMINRSMKLLEDRKFWAGIVFPD----IAP-NATALPPKVNYKIRMDIDNVERTN--KIKDAYWDPGPRADPFEDMRYIWGGFTYLQDVIEQGIIRALTGTKE-KTGVYIQQMPYPCYVDDIFLRVMSRSMPLFMTLAWMYSVSIILKSVVYEKEARLKETMRIMGLDNGILWFSWFISSLIPLLISAGLLVLLLKKGNLLPYSDPGVIFLFLGSFAVVTIMQCFLISTAFARANLAAACGGIIYFTLYLPYVLCVAWQDYIGYGAKVMASLLSPVAFGFGCEYFALFEEQGVGIQWSNLLSSPLQEDDFSLRTTILVMYFDSFLYGVLTWYIEAVFPGQYGIPRPWYFPFTKSYWFG-DKDENSSKIPLNRRRNQTAVCV---EEEPAHLEPGVYIENLVKVYRQGKKLAVDGLTLGFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYILGKDIRTDLNAIRQSLGVCPQHNVLFSMLTVEEHIWFYARLKGLPEEQVKGEIEHILQDTGLQHKRRSRTSTLSGGMQRKLSVALAFVGGAKVVILDEPTAGVDPYARRGIWDLLLKYRQ-GRTIILSTHHMDEADILGDRIAIISHGKLCCVGSSLYLKNQLGSGYYLTLVKKDPETSLSSCRNSSSTISFNKKDEENTSVSSSDAGLGSEHESEAATIENGPAASICTVPFVPTDTSLVSALILRHVPTARLVEDLGHELTYILPYSAAKNGAFVELFKDLDLKLHELGISSYGVSDTTLEEIFLKVAEDNGVDTEVLSDGTLPVRARRRTHAFGGGEHQSCLKPIS----EDDTYDCNDSEGDPDCRETDWLSCTEGKGSYQVNGWSLRRQQFVALMWKRFLYARRSRKGFFAQ 1378          

HSP 2 Score: 519.62 bits (1337), Expect = 0.000e+0
Identity = 319/938 (34.01%), Postives = 514/938 (54.80%), Query Frame = 1
Query: 3604 PSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMNTSLYQLENFKCLYP----------------YNTNKWSEKSPIEISLVTPECDCSTTGNQ--ICSSPL-SGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMK-----------QYGGLQFILPSFFGQSCQVIGESQIWFDFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNIS---GGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDV-KLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLH-PNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSV-KLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAK---NDSVTRNIS--NGNALIQKPNFNNDGYLNEG 6294
            PS+ + PW+   +       TF   +   D    KL ++     G  G RCM+   Y +    C                   +++  W+ ++P      +P C C++ G +  +   P+ +GG       ++++D L +L+  NISDYL+K +   I K           +YGG      S   +S QV+  +    D  + + +  +        +FL+    F N    K N+ ++W N+KG+ S+PA+ N+ +N +LR+ +       NYGI   N+PL  T+  L         ++V ++I VIF +SF+PASFV+FLI+ERV  +K  Q++SGV P +YW +NF WD   Y +   +VIL F+ F  ++Y+ S N+    +LL LY  ++ P MYP SFF +  STA+VV+++ N+L+G   +I+TF ++L  + D  +   ND LK + LIFP + LGRG+ID+  +    +     G +   +  EWD+ G  + ++ +  V + +I + ++ K     CIK + + KL     + +ED DV +ER+RI +      D+L++  LTK++                    + K+K AV+ +  G+  GECFGLLGVNGAGKTTTFKML G+  +T G A + G SI+ +  + H+NMG+CPQFDA++ LLT  E L  Y  +RG+  +++    +  ++ LSL  + +K     SGGN RK+ TAI+LIG P +VFLDEPT GMD  ARR LW  I ++  + + +++LTSH+MEECE LC R+AIMV+G  + +GSVQHLK++FG  Y + +R+  P+ + L     IE+ +     S + +KE++  +++Y+  SS+  L+ IF +    +    +++YSV+Q +LD+VF+NFAK   +D VT++ S    + +I+ P   +     EG
Sbjct: 1403 PSLELQPWMYEDQV------TFISDDAPGDANMQKLLKSLMEPPG-FGTRCMDG--YSIPESPCTMGDEDWHNPDVPESLQQLFSSGNWTMENP------SPSCFCASDGKKRMLPDCPVGAGGLPPPEMKLSATDTLQNLTGRNISDYLVKTYAQIIGKSLNNKVWVNEFRYGGF-----SLGARSTQVLPPANEIDDAIERVRNIFELQKGAAADRFLDSLSNFINGLDTKNNV-KVWFNNKGWHSVPAFMNVMNNAILRANLPPGADPSNYGIMSFNHPLNLTKEQLSQVALVTTSVDVLVSICVIFAMSFVPASFVVFLIQERVNKAKHMQFISGVQPLLYWTANFLWDMCNYFVPAALVILIFVCFQQKAYVSSANLPVLALLLLLYGWSITPLMYPASFFFTIPSTAYVVLTSVNILIGINGSISTFVMEL--FGDHEIGGINDILKNVLLIFPHFCLGRGLIDMVKNQAMADALERFGENRFRSPLEWDMVGKNLFAMAVEGVVFFIITLLIQYK----FCIKPRPISKLTKMGSLGEEDEDVARERQRI-VQGLGQGDILELRQLTKVF--------------------KRKQKPAVDRLCVGIPPGECFGLLGVNGAGKTTTFKMLTGDTMVTSGEAFLAGKSILREIDEVHQNMGYCPQFDAINELLTGREHLELYAVLRGVPGNEVCDVAEWGIRKLSLLKYADKRAGSYSGGNMRKLSTAISLIGAPPVVFLDEPTTGMDPKARRALWNCIHSVIKQGR-SIVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGYTIILRVAGPDPDLLPVMKFIESEL-----SGSTLKEKHRNMLQYQLPSSLTSLAHIFSILAKNKDTLRIEDYSVTQTTLDQVFVNFAKDQSDDYVTKDASVRRKDTIIEVPELGSAHGAAEG 2286          

HSP 3 Score: 171.4 bits (433), Expect = 5.717e-42
Identity = 111/348 (31.90%), Postives = 180/348 (51.72%), Query Frame = 2
Query: 2216 REENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPS 3259
            RE    + G   + D LE+      L K F + + PA+D L +     +  G LG NGAGKTTT  +LTG    TSG AF+    I  +++ +   +G CPQ + +   LT  +H+  Y +L+G+  +E+       ++++ L K     + + SGG  RKLS A++ +G   ++FLDEPT G+DP +RR +W+ I       R+I+LT+H M+E + LC R+AI+  G+ +C GS   LK  FGDGY + L  +                   +++FI+  +  S L ++ +      L  + T+      +F  L  + D L+I  Y ++ T+L++VF+  A D S
Sbjct: 1927 RERQRIVQGL-GQGDILEL----RQLTKVFKRKQKPAVDRLCVGIPPGECFGLLGVNGAGKTTTFKMLTGDTMVTSGEAFLAGKSILREIDEVHQNMGYCPQFDAINELLTGREHLELYAVLRGVPGNEVCDVAEWGIRKLSLLKYADKRAGSYSGGNMRKLSTAISLIGAPPVVFLDEPTTGMDPKARRALWNCIHSVIKQGRSIVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGYTIILRVA-----------GPDPDLLPVMKFIESELSGSTLKEKHRNMLQYQLPSSLTS---LAHIFSILAKNKDTLRIEDYSVTQTTLDQVFVNFAKDQS 2255          

HSP 4 Score: 161.384 bits (407), Expect = 6.330e-39
Identity = 83/220 (37.73%), Postives = 130/220 (59.09%), Query Frame = 1
Query: 5302 RKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKI 5961
            +KLAV+ ++ G  EG+    LG NGAGKTTT  +L G    T G A I G  I  D     +++G CPQ + L S+LT EE ++FY R++G+    +   ++  L++  L       T  +SGG +RK+  A+A +G  K+V LDEPT G+D  ARR +W L+  L       +IL++H+M+E ++L  R+AI+  G++  +GS  +LK++ G  YY+ +
Sbjct:  919 KKLAVDGLTLGFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYILGKDIRTDLNAIRQSLGVCPQHNVLFSMLTVEEHIWFYARLKGLPEEQVKGEIEHILQDTGLQHKRRSRTSTLSGGMQRKLSVALAFVGGAKVVILDEPTAGVDPYARRGIWDLL--LKYRQGRTIILSTHHMDEADILGDRIAIISHGKLCCVGSSLYLKNQLGSGYYLTL 1136          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Medaka
Match: zgc:172302 (ATP-binding cassette sub-family A member 1 [Source:NCBI gene;Acc:101162276])

HSP 1 Score: 557.755 bits (1436), Expect = 0.000e+0
Identity = 362/1059 (34.18%), Postives = 584/1059 (55.15%), Query Frame = 2
Query:  638 LQNFNLSLINSTKSIPTCQLAFMNYFTKSNGLSVLYPIIGPLVFGKIYYTPNSAFTQEIIRRANSTF---RILDNLRLASVEWRLTFSNWLINNS-----------TNMGLLNDARNYCANSRTLMCQIIN-------NSLSIETIQSTIASLSAMFVLIENSL----NCTQLNKFTPMPSSIDIDNLSKQSSLGILAGIVFTDDFQYVTPQNAT-----FLNYQIRMPASRIDSTKNFKVLDRFWTPIPRVNTLTNFNYYTSGFLFLQEIIDQAFIELITDNASVNIGSSMQIMPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTXXXXXXXXXXXXXXXXXGKXXXXXXXXXXXXXXXXXXXXXXCQCFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELST--------------EMYYGVGL----------LTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYW--IPFSKNNDNIEISDNFRQREENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEI-------------------------QSETC-------HNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQE------KQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANINGPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGLFSE 3532
            +++ NL L N+T   P C+ + ++         +++  I PL  GK+ Y P++   +E+++  N TF   ++L ++  A +E       ++  +S             + +L + R    N+     QI +       N+        T   L   F  + N++     C  L+K   + S   + +     +L +L    F     ++ P ++T      ++Y+IRM    +  T   K+ D FW P P     ++  Y   GF+++Q+++++A  +++T       G  +Q MPYPCY++D  +  L+  +P  + +AW  +V  + KSIVYEKE RLKE MR+MG+S+   W SWF S+++  ++   L+  +LK G IL +S P ++F  L  +  + I QCF+IS FF  +N+A+  GG++YF  YLP+ +F  ++D L++              ++Y+ +G+          L+ V+F     +    E+   G Q+ NL +S +   ++     +IM+++D+  Y L AWY+EAVFPG++G+P+PWYF+F   YW  +P       + I      ++E    D  E EP ++ +G+ I NLVK + K    A+++LNLKF++ QIT FLGHNGAGKTTTIS+LTG+  PTSGT +I   DIRYDM+IIR+ +G+CPQHN+LF  LTVE+H++FYG LKG+++ ++K +L +++++VGL  K    +KNLSGGM+RKLS+A+AFVG S+++ LDEPTAGVDP+SRRGIWDL++KYR   RTIIL+TH+MDEA+ L DRIAIIS+GKL CCGS LFLK   G GYYL + K  E                           SE+         ++++S     LL  +++ IP++ L++E++ +  + L   +           +LD  L  L I+SYGLSD++LEE+FL+VA++    +   QE      +Q + E ++        P P+      +  + + +  G +           LSG  L++QQ+  LFIKR+ + +R+ +G F++
Sbjct:  346 IEDANLGLSNTT--TPFCR-SLIHQLESDPRSRIVWRGIKPLFVGKLLYAPDTPAVKEVMKEVNKTFEDLQVLQDVDEAWMEVGPEIKTYMETSSDIRLLRDLLRRPEVAVLVNMR--LENTPWTASQIAHFLSTPSPNAERKPGHPVTWLDLYNDFSHVTNTVAQVTKCISLDKLEGLESEAKLID----RALELLDNRQFWGGVLFLLPNSSTTELPPHVSYKIRMDIDNVARTN--KIKDNFWDPGPAAEPFSDLRYIWGGFVYIQDLVERALNQVLT-GIKQTTGIYIQQMPYPCYVDDVFLRVLNRSLPLFMTLAWIYSVAMITKSIVYEKEARLKETMRIMGLSSGTLWFSWFISSLIPFLISAALLIGLLKWGNILPYSDPAVVFFFLMAFATATIMQCFLISTFFCKANLASACGGLIYFSLYLPYALFTAWRDHLNSTHRILNCIFSPFIVKIYFCLGMFFFLREFLSFLSPVAFGFGCEYFAQYEEQGLGIQWFNLQSSPVEGDSYSFTTSIIMLYVDAFIYALAAWYIEAVFPGEFGIPRPWYFIFQLNYWGGVPLEAG---MPIPPAPTDQDE----DNIEAEPSNMTLGVNIRNLVKIYKKGGKLAVNHLNLKFFEGQITSFLGHNGAGKTTTISVLTGLFPPTSGTVYIKGLDIRYDMDIIRNTLGVCPQHNVLFDILTVEEHVWFYGCLKGLSEEKVKAELDNLLEDVGLLHKRHEQTKNLSGGMQRKLSVAIAFVGGSKVVVLDEPTAGVDPYSRRGIWDLLLKYRK-GRTIILSTHYMDEAELLGDRIAIISKGKLCCCGSPLFLKSQLGSGYYLTVVKREETNPNTPSGSSFSTSTSIITNKLPHAKDSESSLSEDTGLGSDESSSCVAALLALVQQHIPSASLVEESRREAVINLPQKAAKDGSLAIFLSKLDQRLPELGISSYGLSDSTLEEIFLRVAEETGVDAEPEQEELSPNSQQPSGERVEEQPAEQPEPEPL------ETDLLSGDCRGGEP----------LSGSWLMWQQLKALFIKRWLYARRSRRGFFAQ 1368          

HSP 2 Score: 500.745 bits (1288), Expect = 0.000e+0
Identity = 313/921 (33.98%), Postives = 490/921 (53.20%), Query Frame = 1
Query: 3604 PSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCM-----NTSLYQLE----------NFKCLYPYNTNKWSEKSPIEISLVTPECDCST--TGNQICSSPLSGG---PESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMK-----------QYGGLQFILPSFFGQSCQVIGESQIWFDFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYL---RYNISGGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDS-SVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKN--DSVTRNISNGNALIQ 6255
            PS+ + PW+   +       TF+  +   +     L E      G  G +CM     N +  ++E          +F     ++   WS++ P      +PEC CST      +   P   G   P    R+  + D L +L+SYN+SDYL+K +   + K           +YGG      S  G+  Q   + +   D   +         N      LN    F      K N+ ++W N+KG+ SM ++ N+ +N LLR+++        +GI+  N+PL  T+  L         ++V ++  VIF +SF+PASFV+FLIEER + +K  Q+VSGV P +YW++NF WD + Y++   +V+L F+ F  +SY+  +N+ A I+LL  Y  ++ P MYP SF  +  STA+VV+++ NL +G   ++ TF L+L+  D+  L   N+ LKK+FLIFP + LGRG+ID++ +      ++  G     + F+WD  G  +  +    V + +  + ++ K    L     + +L P   I  ED DV +ER R+ ++    +D+L +  L+K+Y                       +K AVN +  G+  GECFGLLGVNGAGKT+TF+ML G+  IT G A ++ +S++ +  + H+ MG+CPQFDA+  LLT  E L  Y R+RG+    +       ++ L LT +  +     SGGNKRK+ TAI+LIG P ++FLDEPT GMD  A+RFLW  I ++T E K AV+LTSH+MEECE LC R+AIMV+G+ + +GSVQHLK++FG  Y V +RL  +  S ++   ++  + K  + +  +KE++  +++Y   S    L+ IF    +      V ++SVSQ +LD+VFI+FAK+  D    ++   N L Q
Sbjct: 1393 PSVELQPWMYGEQY------TFFSNDAPGNPAMENLLEALLDQPG-FGTKCMEKEEGNNTSCEVEGGGQFRRPQVSFSMWQMFSKGNWSKERP------SPECQCSTEDVSRMLPECPEGAGGLPPPQIKRV--TGDILQNLTSYNVSDYLVKTYAQILKKSLKTKKLVNEFRYGGF-----SLGGKVTQTEVDVEHVEDAVSAFRRRYQVTQNSSLDSLLNKLPAFLEGLHSKDNV-KVWFNNKGWHSMVSFVNVMNNGLLRASLPPGPERSKHGISAYNHPLNLTKDQLTEVALMATSVDVLISTCVIFAMSFVPASFVLFLIEERASKAKHLQFVSGVQPLLYWVANFIWDMLNYAVPAAMVVLIFIGFQQKSYVSEQNLPALILLLLFYGWSITPLMYPASFVFTVPSTAYVVLTSINLFIGINCSMATFVLELFVDDN--LNQINNVLKKVFLIFPHFCLGRGLIDMAKNQAMADAFHRLGARPVLDPFQWDFVGKNLFCMAASGVFYFIFTILLQYKFFIHLKPWWTEPQLPP---IGPEDEDVARERARV-MSGKFHSDILTMINLSKVYKAG--------------------KKPAVNRLCLGIPPGECFGLLGVNGAGKTSTFRMLTGDTPITHGEAFLDRHSVLTEMDRVHQLMGYCPQFDAISDLLTGREHLELYARLRGVPEESVSKVAQWGVRKLGLTQYAEQKAGGYSGGNKRKLSTAISLIGAPPVIFLDEPTTGMDPKAKRFLWNCIHSVTKEGK-AVVLTSHSMEECEALCTRMAIMVNGQFQCLGSVQHLKNRFGDGYTVILRLA-DTKSDTESCPVDEYMTKS-FPNIELKEQHQNVLQYHLPSHGCSLALIFDALANNCEELGVADFSVSQTTLDQVFISFAKDQTDDCLTDVIISNGLAQ 2263          

HSP 3 Score: 177.948 bits (450), Expect = 6.058e-44
Identity = 127/446 (28.48%), Postives = 219/446 (49.10%), Query Frame = 2
Query: 1925 FCNAINFIGYLEQASDGAQFSNLFNSTIID---LNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADD 3253
            FC     I   +  +    F  L    ++D    +F VG  L  +    VFY +    ++  F   +   KPW+   T     P    ++++        RE    + G  K   D+   + + NL K +   K PA++ L L     +  G LG NGAGKT+T  +LTG    T G AF+  + +  +M+ +   +G CPQ + +   LT  +H+  Y  L+G+ +  +       V+++GL++  +  +   SGG KRKLS A++ +G   +IFLDEPT G+DP ++R +W+ I       + ++LT+H M+E + LC R+AI+  G+ +C GS   LK  FGDGY + L  +         + K+      + E++ K  PN +L ++ +    V+  H  ++      +F+ L ++ + L +A + +S T+L++VF+  A D
Sbjct: 1832 FCLGRGLIDMAKNQAMADAFHRLGARPVLDPFQWDF-VGKNLFCMAASGVFYFIFTILLQYKF---FIHLKPWW---TEPQLPPIGPEDEDV-------ARERARVMSG--KFHSDI---LTMINLSKVYKAGKKPAVNRLCLGIPPGECFGLLGVNGAGKTSTFRMLTGDTPITHGEAFLDRHSVLTEMDRVHQLMGYCPQFDAISDLLTGREHLELYARLRGVPEESVSKVAQWGVRKLGLTQYAEQKAGGYSGGNKRKLSTAISLIGAPPVIFLDEPTTGMDPKAKRFLWNCIHSVTKEGKAVVLTSHSMEECEALCTRMAIMVNGQFQCLGSVQHLKNRFGDGYTVILRLA---------DTKSDTESCPVDEYMTKSFPNIELKEQHQ---NVLQYHLPSHGCSLALIFDALANNCEELGVADFSVSQTTLDQVFISFAKD 2246          

HSP 4 Score: 149.443 bits (376), Expect = 2.895e-35
Identity = 83/219 (37.90%), Postives = 124/219 (56.62%), Query Frame = 1
Query: 5305 KLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKI 5961
            KLAVN+++    EG+    LG NGAGKTTT  +L G    T G   I G  I  D       +G CPQ + L  +LT EE ++FY  ++G+    +   +D  L+++ L    ++ T  +SGG +RK+  AIA +G  K+V LDEPT G+D  +RR +W L+  L       +IL++H M+E E+L  R+AI+  G++   GS   LKS+ G  YY+ +
Sbjct:  943 KLAVNHLNLKFFEGQITSFLGHNGAGKTTTISVLTGLFPPTSGTVYIKGLDIRYDMDIIRNTLGVCPQHNVLFDILTVEEHVWFYGCLKGLSEEKVKAELDNLLEDVGLLHKRHEQTKNLSGGMQRKLSVAIAFVGGSKVVVLDEPTAGVDPYSRRGIWDLL--LKYRKGRTIILSTHYMDEAELLGDRIAIISKGKLCCCGSPLFLKSQLGSGYYLTV 1159          

HSP 5 Score: 55.0694 bits (131), Expect = 1.229e-6
Identity = 24/73 (32.88%), Postives = 37/73 (50.68%), Query Frame = 2
Query:  152 LIIEMLIPLFVIFILVAVRRITSSYSMGTCELREKQMGSMGPIPFLRDFICTFNTSCYNTTQIDWTKNSINDF 370
            LIIE+  PLF+  IL+AVR+    Y  G C    K + S G +P+++  +C  N  C+ +     T     +F
Sbjct:   25 LIIELAWPLFLFLILIAVRQSHPPYKQGQCHFPNKALPSAGTLPWIQSIVCNVNNPCFRSPTPGETPGVAGNF 97          
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Medaka
Match: abca4a (retinal-specific ATP-binding cassette transporter [Source:NCBI gene;Acc:101171449])

HSP 1 Score: 535.028 bits (1377), Expect = 0.000e+0
Identity = 341/1000 (34.10%), Postives = 538/1000 (53.80%), Query Frame = 2
Query:  677 SIPTCQLAFMNYFTKSNGLSVLYPIIGPLVFGKIYYTPNSAFTQEIIRRANSTFRILDNLRLASVEWRLTFSN-W--------------LINNSTNMGLLNDA-RNYCANSRTLMCQIINNSLSIETIQSTIASLSAMFVLIENSL-------NCTQLNKFTPMPS--SIDIDNLSKQSSLGILAGIVFTDDFQYVTPQNATFLNYQIRMPASRIDSTKNFKVLDRFWTPIPRVNTLTNFNYYTSGFLFLQEIIDQAFIELITDNASVNIGSSMQIMPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTXXXXXXXXXXXXXXXXXGKXXXXXXXXXXXXXXXXXXXXXXCQCFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFE-------IQSETC---HNNKASESGTK-----------LLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANINGPKVSFEFE--NNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGLFSE 3532
            + P C    M     +    V++  + P++ G+I Y P+S   + +I+ AN+TF  L+ LR     W       W              +I N + M  ++ +  +   +S+ ++  + N  L              +F +I+  +       +C  L+KF  +P   ++    L+        AG++F +   + T      + ++IRM    ++ T   KV DR+W P PR + + +  Y   GF + Q+II+   I   T      +G  +Q MPYPCY++D     L+   P  +V+AW  +V+ ++KSIV EKE RLKE ++ MG++N V W +WF  + +++     L+T I+  G++L +S+P I+FL L  +  + I QCF++SVFF+ + +AA   GI+YF  YLP +  I +QD ++ +M   + LL+QV+F     ++   E+   G Q+ N+  S +    F     + M+ +D+V Y ++AWY++ VFPG+YG+ +P+YF     YW+  +K N    I     ++     +  FE EPD+L  G+ IENLVK F     PA+D L + FY+  IT  LGHNGAGKTTT+SILTG+  PT GTA I   DIR DM+ IR  +G+CPQHNILF ++TV +HI F+ LLKG   +E + ++ ++++++GL  K   + +NLSGGM+RKLS+A+AFVG ++++ LDEPT+GVDP+SRR IWDL++KYR+  RT+I++THHMDEAD L DR+AI+SQG+L CCGS +FLK  FG G+YL L +  +        +   C      +A  S +K           ++  +   +P ++LI+    + T +L + +     + SLF +L+ +L  + ++S+G+SDTSLEE+FLKV                         DG N           +K I  +N   P    E         + G+ L  +Q   L IKR HH  R+ K   ++
Sbjct:  364 TTPFCN-DLMRELESNPATRVMWNSVKPMLMGRILYAPDSPAVRRVIKNANTTFEELERLRTMGKAWEEVAPQIWAFFQDGIQVEMIRDIIRNPSVMDFIDKSLEDAPFSSKHILNFLRNEPLEDRPYDVPNFDWRDVFKMIDRVIRMLNQYGDCVVLDKFVALPDEDAVTYRALNLLEDGKFWAGLIFVNMHPWTT-SVPPHIKFKIRMDIDIVERTN--KVKDRYWDPGPRADPMEDLRYVWGGFAYFQDIIEHGIIRTHT-GKEWPLGVYLQQMPYPCYVDDLFTLTLNRCFPVFMVLAWVYSVSMVVKSIVLEKELRLKETLKTMGVTNGVIWSTWFIDSFIMMGTSTALLTAIIMGGRVLNYSNPFILFLFLLTFTTATIMQCFLLSVFFNQAKLAAACCGIIYFTLYLPHVFCIAWQDRITKDMKILLSLLSQVAFGFGTEYLSRYEEQGMGLQWDNIQTSPLEGDEFSFLTSICMMVLDTVLYSVLAWYLDNVFPGQYGIGRPFYFPLLPCYWL--NKKNRKKRILKKILEKVSEQDMSFFEAEPDNLVKGVCIENLVKVFSSCVRPAIDGLTISFYEGHITSLLGHNGAGKTTTMSILTGLFPPTCGTATIYGKDIRTDMDSIRLSLGMCPQHNILF-HMTVAEHILFFSLLKGCPIAEAEEEVENMLQDLGLPHKRDELIQNLSGGMQRKLSVALAFVGGAKVVVLDEPTSGVDPYSRRSIWDLLLKYRT-GRTVIMSTHHMDEADLLSDRVAILSQGRLYCCGSPIFLKNCFGAGFYLTLVRRMKNDPPKVGRKPPVCFCAFKARAVSSNSKTAFLSTGNIESIMALVHHHVPQARLIETIGQELTFLLPNQNFQPRAYASLFRELEETLVDIGLSSFGVSDTSLEEIFLKVT-----------------------ADGTN-----------RKCIPESNGQDPSQIKEGSAGRGSYRVRGVCLTVKQFLALLIKRLHHATRSYKDFVAQ 1320          

HSP 2 Score: 480.715 bits (1236), Expect = 0.000e+0
Identity = 323/929 (34.77%), Postives = 480/929 (51.67%), Query Frame = 1
Query: 3604 PSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMNTSLYQLENFKCLYPYN--TNKWSEK--SPIEISLV----------TPECDCSTTGN----QICSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFI------------MKQYGGLQF---------------ILPSFFGQSCQVIGESQIWFDFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFS------YLRYNISGGDENYNAFEWDITG-NKICSLGILFVGWCLIIV-----FMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLH-PNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDS 6216
            PS+T+SPW+   +       TF+  E  +D  + +   N   D    G RCM      LE+F C    N  T +W     +P  I ++          +PEC CST        +C    +GG     RI ++ D L DL+  NISDYL+K +   I            M +YGG+                  L S  GQ   V G        + S  + RD  +      FL Y +          N  ++W N+KG+ +M ++ N+ +N +LR+ +     L  +GI V N+PL  T+  L         ++  +A+ VIF +SF+PASFV++LI+ERVT +K  Q+VSGV+P VYW++NF WD + YSIS  +V+  FL F+ + Y  + N+ A I LL LY  +V P MYP S+  S  STA+V +S  NL +G                   + S++            Y LGRG+ID++ +      Y R+   G D + + F W   G N  C     FV + + I+     FM+                +P+  I +ED+DV +ER+RI+ + +  ND+L++  L+K Y  +I                      AV+ I  GV  GECFGL+GVNGAGKTTTFKML G+ ++T G+A + G+SI+ + L  H+NMG+CPQFDA+  LLT  E L+ Y R+RG+  S I    D +++ L L+ + ++     SGGN+RK+ TAIA+IG P +V LDEPT GMD  +RRFLW  I ++  + + AV+LTSH+MEECE LC RLAIMV+G  K +G++QHLK K+G  Y V +++   N     D +  E  + +  +      E++   ++Y+  SS  L+ IF++    +    +++YSVSQ +LD+VF+NFAK  S
Sbjct: 1345 PSLTLSPWMYGRQY------TFFSNERPTDA-AMRYFGNVLLDKPGFGTRCMVDE--PLEDFPC----NNITTEWEMPLVNPALIEMLESPRWDSLRPSPECQCSTAKKLTMLPVCPEG-AGGLPPPQRIQSTGDVLMDLTGRNISDYLVKTYPKLIRTREVKQVFCSVMFRYGGISVGGQLPVLSLQPNAIQDLASQLGQLLNVTGG-------KYSKQTLRDIGT------FLRYLE--------TPNNVKVWYNNKGWHAMVSFMNVANNAILRAHLPERANLDEFGITVINHPLNLTKEQLSEITVLSTSVDAVVAMCVIFAMSFVPASFVLYLIQERVTQAKHLQFVSGVSPLVYWMANFLWDMVNYSISAAMVVQIFLFFDKKCYTSATNVQALIALLMLYGWSVTPMMYPMSYVFSVPSTAYVSLSCINLFIG-------------------INSSH------------YCLGRGLIDMAMNQAVTDVYARF---GEDYSPDPFSWVFIGRNLFCMAAEGFVYFIINILIQYRFFMD--------------HWQPH--ILEEDVDVAEERKRIQQSGNT-NDILRIKDLSKTYTGTI--------------------IPAVDRICVGVLPGECFGLVGVNGAGKTTTFKMLTGDIDVTSGDASVAGHSILTNILDVHQNMGYCPQFDAIDELLTGREHLHLYARLRGVPESQISRVADWAIQKLGLSEYASRTAGTYSGGNRRKLSTAIAMIGCPALVLLDEPTTGMDPLSRRFLWNSIMSVIQDGR-AVVLTSHSMEECEALCTRLAIMVNGSFKCLGTIQHLKYKYGDGYIVTMKIRTANPGCNPDLSRAEAFM-ESTFPGCIQTEKHYNTLQYKISSS-SLARIFQMVLVNKDKLNIEDYSVSQTTLDQVFVNFAKQQS 2164          

HSP 3 Score: 161.77 bits (408), Expect = 4.887e-39
Identity = 102/327 (31.19%), Postives = 176/327 (53.82%), Query Frame = 2
Query: 2282 IENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQ 3262
            I++L K +  +  PA+D + +     +  G +G NGAGKTTT  +LTG +  TSG A +  + I  ++  +   +G CPQ + +   LT  +H++ Y  L+G+ +S+I       ++++GLS+     +   SGG +RKLS A+A +G   ++ LDEPT G+DP SRR +W+ I+      R ++LT+H M+E + LC R+AI+  G  KC G+   LK  +GDGY +    + +I++    N   +   ++   F++   P     ++        +S +S  R     +F+ +  + D L I  Y +S T+L++VF+  A   S+
Sbjct: 1851 IKDLSKTYTGTIIPAVDRICVGVLPGECFGLVGVNGAGKTTTFKMLTGDIDVTSGDASVAGHSILTNILDVHQNMGYCPQFDAIDELLTGREHLHLYARLRGVPESQISRVADWAIQKLGLSEYASRTAGTYSGGNRRKLSTAIAMIGCPALVLLDEPTTGMDPLSRRFLWNSIMSVIQDGRAVVLTSHSMEECEALCTRLAIMVNGSFKCLGTIQHLKYKYGDGYIV----TMKIRTA---NPGCNPDLSRAEAFMESTFPGCIQTEKHYNTLQYKISSSSLAR-----IFQMVLVNKDKLNIEDYSVSQTTLDQVFVNFAKQQSR 2165          

HSP 4 Score: 131.724 bits (330), Expect = 6.102e-30
Identity = 99/363 (27.27%), Postives = 170/363 (46.83%), Query Frame = 1
Query: 5305 KLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYV-----------KIRLHP---------------NRNSLSDRNEIETI---INKEIWSSARMKE----ENAVIIEYRFDSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRNISNGNALIQKPNFNNDGYLNEG 6294
            + A++ ++    EG    LLG NGAGKTTT  +L G    T G A I G  I  D      ++G CPQ + L  + T  E + F++ ++G   ++    V+  L++L L    ++    +SGG +RK+  A+A +G  K+V LDEPT G+D  +RR +W L+  L       VI+++H+M+E ++L  R+AI+  G +   GS   LK+ FG  +Y+           K+   P               ++ +      IE+I   ++  +   AR+ E    E   ++  +       + +FR  E+   +  +  + VS  SL+E+F+    + +  + I   N   Q P+   +G    G
Sbjct:  929 RPAIDGLTISFYEGHITSLLGHNGAGKTTTMSILTGLFPPTCGTATIYGKDIRTDMDSIRLSLGMCPQHNILFHM-TVAEHILFFSLLKGCPIAEAEEEVENMLQDLGLPHKRDELIQNLSGGMQRKLSVALAFVGGAKVVVLDEPTSGVDPYSRRSIWDLL--LKYRTGRTVIMSTHHMDEADLLSDRVAILSQGRLYCCGSPIFLKNCFGAGFYLTLVRRMKNDPPKVGRKPPVCFCAFKARAVSSNSKTAFLSTGNIESIMALVHHHV-PQARLIETIGQELTFLLPNQNFQPRAYASLFRELEETLVDIGLSSFGVSDTSLEEIFLKVTADGTNRKCIPESNG--QDPSQIKEGSAGRG 1285          
BLAST of ATP binding cassette subfamily A member 1 vs. Planmine SMEST
Match: SMESG000056983.1 (SMESG000056983.1)

HSP 1 Score: 1860.5 bits (4818), Expect = 0.000e+0
Identity = 904/907 (99.67%), Postives = 905/907 (99.78%), Query Frame = 1
Query: 3592 MDNQPSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMNTSLYQLENFKCLYPYNTNKWSEKSPIEISLVTPECDCSTTGNQICSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMKQYGGLQFILPSFFGQSCQVIGESQIWFDFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNISGGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRNISNGNALIQKPNFNNDGYLNEGFEKTDF 6312
            MDNQPSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMNTSLYQLENFKCLYPYNTNKWSEKSPIEISLVTPECDCSTTGNQICSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMKQYGGLQFILPSFFGQSCQVIGESQIWFDFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNISGGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDI INVDLSLKNL LTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLS+IFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRNISNGNALIQKPNFNNDGYLNEGFEKTDF
Sbjct: 1180 MDNQPSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMNTSLYQLENFKCLYPYNTNKWSEKSPIEISLVTPECDCSTTGNQICSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMKQYGGLQFILPSFFGQSCQVIGESQIWFDFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNISGGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIQINVDLSLKNLGLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLSNIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRNISNGNALIQKPNFNNDGYLNEGFEKTDF 2086          

HSP 2 Score: 1687.55 bits (4369), Expect = 0.000e+0
Identity = 868/1136 (76.41%), Postives = 968/1136 (85.21%), Query Frame = 2
Query:  143 PFSLIIEMLIPLFVIFILVAVRRITSSYSMGTCELREKQMGSMGPIPFLRDFICTFNTSCYNTTQIDWTKNSINDFLTFMNNISSLYSSLYTTNFTVPGFVDWSNVNPNLYTQLLNSINYISPVISSFITSIKEMQTGDQTLINKNLKILGQLLCGSDQNDIDVFLQNFNLSLINSTKSIPTCQLAFMNYFTKSNGLSVLYPIIGPLVFGKIYYTPNSAFTQEIIRRANSTFRILDNLRLASVEWRLTFSNWL---INNSTNMGLLNDARNYCANSRT---LMCQIINNSLSIETIQSTIASLSAMFVLIENSLNCTQLNKFTPMPSSIDIDNLSKQSSLGILAGIVFTDDFQYVTPQNATFLNYQIRMPASRIDSTKNFKVLDRFWTPIPRVNTLTNFNYYTSGFLFLQEIIDQAFIELITDNASVNIGSSMQIMPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTXXXXXXXXXXXXXXXXXGKXXXXXXXXXXXXXXXXXXXXXXCQCFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANINGPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGLFSE 3532
            PF L  E+LI L  I  L+ +R+    + +G CELREK M S+GPIPFLRD++CTFNT+CYN TQIDW  N  ND+LTF+NN + +Y+S      T   F+ W  ++P     L  S+ +++  I   + SI  + +G+   +++ +  L  ++CGSD+ND  + + N NL L  S +SI TCQ  +  Y +       L  +  P++FGKIY+TP+S FT++II++AN TF ILDNLRL++VEWRL F +WL   +NNS+ +  +++    C  +      +CQ+I  S     IQ++I   S +F LIE  LNCT+LNKF PM S +DIDNL++   + I AG+VF + FQY+T  NAT LNYQIRMP +RIDSTKNFKVLD FW PIPR +T+ +  YYTSGFLFLQE  DQAFIEL+T N ++NIG+SMQIMPYPC+++DR I FLS +MPF+L+IAW P+VT +IKSIVYEKENRLKEFM +MG++NFVHW SWF STI++LI P+I MT+ILK  +I+ FSSP IIF+++  YV+SFICQ FMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDS+FYILIAWYVEAVFPGKYGVPKPWYFLFTR YWIPFSKNNDNIEISDNFRQREENI IDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKTTTISILTGILTPTSGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANIN PKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGLFSE
Sbjct:   25 PFQLTFEILICLSFILSLIGIRQAQLKFRIGRCELREKNMASLGPIPFLRDYLCTFNTTCYNETQIDWKDNKTNDYLTFLNNCTRIYNSYPKRQLTSTEFLQWLILHPEESEMLRYSLIFLNAKIDYVVESIDLINSGNSNNVSRGINKLTTMICGSDKNDAAILIFNLNL-LQRSKRSIQTCQEVYEKYLSVDYFHRQLLGMTAPIIFGKIYFTPDSEFTRQIIKKANITFEILDNLRLSAVEWRLNFRDWLSNQVNNSSTLDNMSNNAKVCMETSQNYYTVCQLIYKSSDRNRIQNSIEIASRIFDLIERGLNCTELNKFQPMKSKVDIDNLAQNKLINIFAGVVFNESFQYLTLNNATVLNYQIRMPTNRIDSTKNFKVLDTFWNPIPRRDTIYDLKYYTSGFLFLQEAFDQAFIELVTGNVTINIGTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSIFYILIAWYVEAVFPGKYGVPKPWYFLFTRHYWIPFSKNNDNIEISDNFRQREENIAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKTTTISILTGILTPTSGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANINDPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGLFSE 1159          

HSP 3 Score: 161.77 bits (408), Expect = 3.828e-39
Identity = 101/315 (32.06%), Postives = 166/315 (52.70%), Query Frame = 1
Query: 5311 AVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIR---------LHPNRNSLSDRNEIETIINKEIWSSARMKEEN----AVIIEYRFDSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDS 6216
            A++N++    + +  G LG NGAGKTTT  +L G    T G A I    I  D       +G CPQ + L + LT E+ +YFY  ++G+  S+I   +   +K + L+      +  +SGG KRK+  A+A +G  +I+FLDEPT G+D  +RR +W LI    + ++  +ILT+H+M+E + LC R+AI+  G++K  GS   LK  FG  YY+ +           H N+ S S    +E I  K+I  ++++ +E      V++ +   +  + + +F   +       +  Y +S  SL+EVF+  A + S
Sbjct:  757 ALDNLNLKFYQSQITGFLGHNGAGKTTTISILTGILTPTSGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINR-TIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFI--KKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPS 1068          

HSP 4 Score: 154.066 bits (388), Expect = 6.648e-37
Identity = 102/315 (32.38%), Postives = 169/315 (53.65%), Query Frame = 2
Query: 2324 ALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINR-TIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFI--KKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPS 3259
            A++N++    + +  G LG NGAGKTTT  +L G    T G A I    I  D       +G CPQ + L + LT E+ +YFY  ++G+  S+I+  +   +K +GL+      +  +SGG KRK+  A+A +G  +I+FLDEPT G+D  +RR +W LI    + ++  +ILT+H+M+E + LC R+AI+  G++K  GS   LK  FG  YY+ +           H N+ S S    +E I  K+I  ++++ +E      V++ +   +  + +++F   +       +  Y +S  SL+EVF+  A + S
Sbjct: 1753 AVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIQINVDLSLKNLGLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIR---------LHPNRNSLSDRNEIETIINKEIWSSARMKEEN----AVIIEYRFDSSVKLSNIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDS 2054          
BLAST of ATP binding cassette subfamily A member 1 vs. Planmine SMEST
Match: SMESG000068605.1 (SMESG000068605.1)

HSP 1 Score: 1709.5 bits (4426), Expect = 0.000e+0
Identity = 896/1128 (79.43%), Postives = 991/1128 (87.85%), Query Frame = 2
Query:  164 MLIPLFVIFILVAVRRITSSYSMGTCELREKQMGSMGPIPFLRDFICTFNTSCYNTTQIDWTKNSINDFLTFMNNISSLYSSLYTTNFTVPGFVDWSNVNPNLYTQLLNSINYISPVISSFITSIKEMQTGDQTLINKNLKILGQLLCGSDQNDIDVFLQNFNLSLINSTKSIPTCQLAFMNYFTKSNGLSVLYPIIGPLVFGKIYYTPNSAFTQEIIRRANSTFRILDNLRLASVEWRLTFSNWLINNSTNMGLLNDARNYCANSRTLMCQIINNSLSIETIQSTIASLSAMFVLIENSLNCTQLNKFTPMPSSIDIDNLSKQSSLGILAGIVFTDDFQYVTPQNATFLNYQIRMPASRIDSTKNFKVLDRFWTPIPRVNTLTNFNYYTSGFLFLQEIIDQAFIELITDNASVNIGSSMQIMPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTXXXXXXXXXXXXXXXXXGKXXXXXXXXXXXXXXXXXXXXXXCQCFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYW--IPFSKNNDNIEISDNFRQR---EENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANINGPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGLFSE 3532
            MLIPLFVIFILVAVRRITSSYSMGTCELREKQMGSMGPIPFLRDFICTFNTSCYNTTQIDWTKNSINDFLTFMNNISSLYSSLYTTNFTVPGFVDWSNVNPNLYTQLLNSINYISPVISSFITSIKEMQTGDQTLINKNLKILGQLLCGSDQNDIDVFLQNFNLSLINSTKSIPTCQLAFMNYFTKSNGLSVLYPIIGPLVFGKIYYTPNSAFTQEIIRRANSTFRILDNLRLASVEWRLTFSNWLINNSTNMGLLNDARNYCANSRTLMCQIINNSLSIETIQSTIASLSAMFVLIENSLNCTQLNKFTPMPSSIDIDNLS QSSLGILAGIVFTDDFQY+TPQNATFLNY+IRMPASRIDSTKNFKVLDR WTPIPRVNTLTNFNYYTSGFLFLQEIIDQAFIELITDNASVNIGSSMQIMPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTILILILPIILMTIILKLGKILTFSSPIIIFLILFFYVVSFICQCFMISVFFD ++VA++ GGI+YF+FYLPFL+F+N QD ++  MYY   LLTQVS  N+INFI Y EQ++DG QFSNLF+S I+DLNFGVGHC++M+WIDSV Y+LIAWYVE VFPG++G+ KPW F FTR YW  I    N D  E   N        E++   GFE EP  L++GI I+NL K FPKSK PA++NLNL FYQSQIT FLGHNGAGKTTTISILTG+  P+SGTAFIL++DIR +M+ IR K+GLCPQHNILF  LTVEDHIYFYGLLK M K+ IK+ +P I++EVGL+KK+  ++KNLSGGMKRKLS+A+AFVG+SR++FLDEPTAGVDPF+RRGIWDL+VKYR  +R IILTTHHMDEADYL DRIAIISQGKL+CCGSS+FLK+ FG+GYYL + K+  IQ E    N+ S SG   L+FI+  +P++K+++ET++QWT+ L  +  N ++F  LF+ LD +++ L I +YGLSDTSLEEVFLKVADDPS      +EK++T E LD LTDGGN PRP S+LS R K+         +VSF+ E    +L+G+SL  QQI GL IKRFH+T+RN+K   +E
Sbjct:    1 MLIPLFVIFILVAVRRITSSYSMGTCELREKQMGSMGPIPFLRDFICTFNTSCYNTTQIDWTKNSINDFLTFMNNISSLYSSLYTTNFTVPGFVDWSNVNPNLYTQLLNSINYISPVISSFITSIKEMQTGDQTLINKNLKILGQLLCGSDQNDIDVFLQNFNLSLINSTKSIPTCQLAFMNYFTKSNGLSVLYPIIGPLVFGKIYYTPNSAFTQEIIRRANSTFRILDNLRLASVEWRLTFSNWLINNSTNMGLLNDARNYCANSRTLMCQIINNSLSIETIQSTIASLSAMFVLIENSLNCTQLNKFTPMPSSIDIDNLSNQSSLGILAGIVFTDDFQYLTPQNATFLNYRIRMPASRIDSTKNFKVLDRLWTPIPRVNTLTNFNYYTSGFLFLQEIIDQAFIELITDNASVNIGSSMQIMPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTILILILPIILMTIILKLGKILTFSSPIIIFLILFFYVVSFICQCFMISVFFDKASVASVSGGILYFVFYLPFLIFVNLQDSMTVPMYYAAALLTQVSLSNSINFIAYWEQSTDGIQFSNLFDSAIMDLNFGVGHCMVMMWIDSVIYLLIAWYVETVFPGQFGLSKPWNFPFTRNYWNSICGKSNLDETESFSNSLNEPIPNESLNERGFEHEPAHLKMGISIQNLFKIFPKSKIPAVNNLNLNFYQSQITAFLGHNGAGKTTTISILTGLFAPSSGTAFILNDDIRTNMDRIRQKMGLCPQHNILFEDLTVEDHIYFYGLLKRMDKNMIKNIIPKIIEEVGLTKKISSLTKNLSGGMKRKLSVALAFVGDSRVVFLDEPTAGVDPFARRGIWDLLVKYRCEDRAIILTTHHMDEADYLSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESIQWED-FQNELSISGGIALKFIQNHVPDAKMMEETRSQWTIALPQSENNCSKFPDLFDNLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGEVGGIKEKKLTPEKLDALTDGGNFPRPASILSLRDKSEFAKIEEIRRVSFKSEITYSMLTGISLFIQQIIGLQIKRFHYTRRNMKSFIAE 1127          

HSP 2 Score: 1129.01 bits (2919), Expect = 0.000e+0
Identity = 568/904 (62.83%), Postives = 695/904 (76.88%), Query Frame = 1
Query: 3592 MDNQPSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMNTSLYQLENFKCLYPYNTNKWSEKSPIEISLVTPECDCSTTGNQICSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMKQYGGLQFILPSFFGQSCQVIGESQIWFDFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNISGGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESK-HKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRNISNGNALIQKPNFNNDGYLNEGFE 6300
            + + P M ISPWLMMPKTRLVNLNTFYRKE+ S+ I   +   YRSD+G+SGVRCMN+++Y+L N+ C    N N+WS      ISL +PECDCS TG Q CS PLSGGP  S+RIM SSD+L +++ YNISDYL+K FKTFI KQYGG QF+LPS FG S   IG S IW      INSS +N++    + FLNY Q FFN SGIKTN +RIW+NSKG++SMPAY NIFSN+LLRS +N+   +  YGI+V NYPLK++Q+DL S +  QMFLEVSLAIFVIFGLSFIPASFVIFLIEER++G+K QQ+VSGVNPY+YWISNF WD +KY I V IV++ F+ FNYQSYIG++N  AFIVLL  Y LA+IPHMYPFSF +S  STAFV++ AYNLLVG +TTI TF+LDL Q DD SLK AND LKKIFLIFPQYDLGRGM+DLSF+YL+YNISGG   Y+ F W+ TG K+CSL ILF+ W  +I  +ES    +++C ++K+ KLK  E+  +ED DVF ERER+    + + DVL+V  LTKIYNPS++  NKC  +A+ +  S +KRKLAVNNI FGVKEGECFGLLGVNGAGKTTTFKML GEE IT G+A IN +SI+++ + AHKNMGFCPQFDALHSLLTCEE+LYFY RIRGI    I   V+LSLKNLSL PH  K T  +SGGNKRK+ TAIA+IG+PKIVFLDEPT GMDAGARRFLW +IQT+T E+K AVILTSHNMEECEVLCHRL+IMV+GEMK +G+VQHLKSKFG DY+VKIR++   N   + ++I+ I+  +      +K+EN + ++YRF+ S+KLS IF  FE+L+ N ++ +YSVSQ SLDEVFINFAKN S + N +  +     P F  DG +NE +E
Sbjct: 1148 LSDAPPMVISPWLMMPKTRLVNLNTFYRKESPSNAIIDSMENVYRSDVGESGVRCMNSAVYRLGNYSCYPENNVNQWSAIPSAPISLSSPECDCSKTGFQFCSDPLSGGPTISSRIMTSSDQLGNITGYNISDYLLKKFKTFIKKQYGGYQFLLPSNFGLSSNSIGSSPIWDGISSYINSSPNNSN---SLGFLNYSQRFFNQSGIKTNYTRIWVNSKGFVSMPAYENIFSNILLRSKLNSFSDISKYGISVTNYPLKFSQTDLQSQLNTQMFLEVSLAIFVIFGLSFIPASFVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFNYLQYNISGGKVTYDPFGWETTGQKLCSLIILFIAWWSVIFTIESGIINRSICGRIKNYKLKERELQHEEDTDVFLERERMTKRKENV-DVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIEN---ESDKIKAIMKTQFPQGVSLKDENFITLQYRFNCSLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKNKS-SNNENEESIRNSVPLF--DGQVNECYE 2041          

HSP 3 Score: 169.859 bits (429), Expect = 1.214e-41
Identity = 114/325 (35.08%), Postives = 182/325 (56.00%), Query Frame = 2
Query: 2324 ALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRT-IILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNS-KLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQI 3292
            A++N+     + +  G LG NGAGKTTT  +LTG    T G AFI D+ I  +M      +G CPQ + L + LT E+ +YFY  ++G+    IK  +   +K + L    K +++ LSGG KRKLS A+A +G  +I+FLDEPT+G+D  +RR +W++I    + N+T +ILT+H+M+E + LC R++I+  G++KC G+   LK  FGD Y++ +  +F I++E+           K+   +K   P    L DE      + L +      + +++F   ++      IA Y +S TSL+EVF+  A + S  S+   E+ I
Sbjct: 1718 AVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNF-IENES----------DKIKAIMKTQFPQGVSLKDEN----FITLQYRFNCSLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKNKS--SNNENEESI 2025          

HSP 4 Score: 159.073 bits (401), Expect = 2.168e-38
Identity = 105/316 (33.23%), Postives = 163/316 (51.58%), Query Frame = 1
Query: 5311 AVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYV------KIRLHPNRNSLSDRNEIETIINKEIWSSARMKEEN----AVIIEYRFDSSVKLSDIF----RVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDS 6216
            AVNN++    + +    LG NGAGKTTT  +L G    + G A I    I  +  +  + MG CPQ + L   LT E+ +YFY  ++ +  + I   +   ++ + LT   +  T  +SGG KRK+  A+A +G  ++VFLDEPT G+D  ARR +W L+     E + A+ILT+H+M+E + L  R+AI+  G+++  GS   LK +FG+ YY+       I+    +N LS    I     +     A+M EE      + +    ++  K  D+F    R  EDL     +  Y +S  SL+EVF+  A + S
Sbjct:  726 AVNNLNLNFYQSQITAFLGHNGAGKTTTISILTGLFAPSSGTAFILNDDIRTNMDRIRQKMGLCPQHNILFEDLTVEDHIYFYGLLKRMDKNMIKNIIPKIIEEVGLTKKISSLTKNLSGGMKRKLSVALAFVGDSRVVFLDEPTAGVDPFARRGIWDLLVKYRCEDR-AIILTTHHMDEADYLSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESIQWEDFQNELSISGGIALKFIQNHVPDAKMMEETRSQWTIALPQSENNCSKFPDLFDNLDRAMEDLG----IVTYGLSDTSLEEVFLKVADDPS 1036          
BLAST of ATP binding cassette subfamily A member 1 vs. Planmine SMEST
Match: SMESG000032861.1 (SMESG000032861.1)

HSP 1 Score: 1253.81 bits (3243), Expect = 0.000e+0
Identity = 661/1115 (59.28%), Postives = 850/1115 (76.23%), Query Frame = 2
Query:  230 MGTCELREKQMGSMGPIPFLRDFICTFNTSCYNTTQIDWTKNSINDFLTFMNNISSLYSSLYTTNFTVPGFVDWSNVNPNLYTQLLNSINYISPVISSFITSIKEMQTGDQTLINKNLKILGQLLCGSDQNDIDVFLQNFNLSLINSTKSIPTCQLAFMNYFTKSNGLSVLYPIIGPLVFGKIYYTPNSAFTQEIIRRANSTFRILDNLRLASVEWRLTFSNWLINNSTNMGLLNDARNYCA---NSRTLMCQIINNSLSIETIQSTIASLSAMFVLIENSLNCTQLNKFTPMPSSIDIDNLSKQSSLGILAGIVFTDDFQYVTPQNATFLNYQIRMPASRIDSTKNFKVLDRFWTPIPRVNTLTNFNYYTSGFLFLQEIIDQAFIELI-TDNASVNIGSSMQIMPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTXXXXXXXXXXXXXXXXXGKXXXXXXXXXXXXXXXXXXXXXXCQCFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEIS--DNFRQRE--------ENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANINGPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGLFSE 3532
            M  CELREKQM SMGPIPFLRDF+CT NT+CYN TQIDW+ N+ NDF TF+NN++ LY  ++   F  P         PN  TQL  S+NY++      + ++ ++Q+G++T  +K +K +   +CGS +ND+++F+ +F ++   S +S+ +CQ  F+     S+  S LY +I PL+FGKIYYTP+S FT+E+I+RANSTF+ILD+LRL++VEWRL FS++ +N   N   +N+ RN+C         MC  +N +L +E I +  A++SA+F +IENSLNCT+LNKF PM SSIDIDNL+ QS   I AG+V  + FQY+T  NATFL+YQIRMP +RID+T  FKV+D FWTP PR++T ++F YYTSGF+ LQE +DQAFIE++ T+N S+N+GSSMQIMPYPCY+ND+ I FLS++MPFLL+IAW P+VT L+K IVYEKENRLKEFM+VMG+SN VHW+ WF +TI IL+LPII+MT+IL+   IL FSSP ++FLIL  YVVSFICQ FMISVFFD +NVAA+ GGI+YFI YLPF VFI   D+++  MYYGVGLLTQV+F N+INFI + EQ++DG QFSNLF+ST+++LN GVGHC++M+W+DSV Y+LIAWYVE+VFPG+YGV KPWYFLFT+ YW    +N+ + +I+  DN+   E        E I   GFE EP +L++GI I+NLVK +P +KT A+D+LNL FYQSQIT FLGHNGAGKTTTISILTGI + TSGTA+IL+ DIR DM+ IR K+GLCPQHNILF+ LTVEDHIYFYGLLKGM   EI+  LP I+++VGL+KK+K  SKNLSGGMKRKLS+AMAF+G+S+++FLDEPTAGVDPF+RRGIWDL++KYR+  RTIILTTHHMDEADYL DRIAIISQGKL+CCGSS+FLK+ FGDGYYL L K+   Q E   +   S SG K+L FI+  I ++K+I+ET+TQWT+VL  N  N  +F+ LF  +D SL  L I SYGLSDTSLEEVFLKVADDP+    + ++KQIT+E LD+LTD GN PRP S LSFR K       +   + +E      LL+G +L+ QQ+ GL +KRFH+TKRNIKG  +E
Sbjct:    1 MDLCELREKQMASMGPIPFLRDFLCTLNTTCYNKTQIDWSGNNTNDFQTFLNNMTYLYD-VFNKPFPTP--------TPNDITQLTYSLNYLNSSTYPLLVAMMQIQSGNKTESDKGMKTIEASICGSSENDMNLFVNSF-VTNQKSKRSLQSCQNQFLQTLGSSSYGSQLYEVIAPLIFGKIYYTPDSPFTRELIKRANSTFKILDDLRLSAVEWRLHFSSYFVNYMNNSQPINNLRNFCKLNIPGTQQMCSTVNTTLDMENILAYNAAISAVFAIIENSLNCTELNKFVPMKSSIDIDNLANQSLTNIYAGLVINESFQYLTRNNATFLSYQIRMPTNRIDTTLKFKVIDSFWTPAPRISTFSDFKYYTSGFMLLQEALDQAFIEIVSTNNESINVGSSMQIMPYPCYVNDKFIKFLSSMMPFLLIIAWMPSVTILLKGIVYEKENRLKEFMQVMGLSNLVHWIGWFITTISILMLPIIIMTLILRYSTILGFSSPAVVFLILLSYVVSFICQSFMISVFFDKANVAAVAGGIIYFISYLPFYVFITIPDDVTDSMYYGVGLLTQVAFSNSINFIAFWEQSTDGVQFSNLFDSTVVNLNVGVGHCMVMMWVDSVIYLLIAWYVESVFPGQYGVGKPWYFLFTQHYW---CQNSASYKITPIDNYYPYESSPIPNINEGILKHGFESEPTNLKVGISIKNLVKTYPGAKTRAVDDLNLNFYQSQITAFLGHNGAGKTTTISILTGIFSATSGTAYILNEDIRSDMDKIREKMGLCPQHNILFSNLTVEDHIYFYGLLKGMKTEEIREILPKIIEDVGLTKKMKSFSKNLSGGMKRKLSVAMAFIGDSKVVFLDEPTAGVDPFARRGIWDLLIKYRNDERTIILTTHHMDEADYLSDRIAIISQGKLQCCGSSVFLKKEFGDGYYLILVKNSRSQEEDFRSG-ISSSGEKVLNFIRAHITDAKMIEETRTQWTIVLPQNEINSGKFSDLFADIDRSLSGLNIVSYGLSDTSLEEVFLKVADDPAGTVEEIKDKQITAEDLDSLTDDGNFPRPSSRLSFRCKREFPRFDDLNSIPYESGAPSSLLTGSALLRQQLLGLQVKRFHYTKRNIKGFVAE 1101          

HSP 2 Score: 1105.12 bits (2857), Expect = 0.000e+0
Identity = 544/908 (59.91%), Postives = 699/908 (76.98%), Query Frame = 1
Query: 3592 MDNQPSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMNTSLYQLENFKCLYPYNTNKWSEKSPIEISLVTPECDCSTTGNQICSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMKQYGGLQFILPSFFGQSCQVIGESQIWFDFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNISGGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKH-KKTLCIKLKDVKLKPYEIITD-EDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRNISNGNALIQKPNFNNDGYLNEGFEKTD 6309
            ++ QP M ISPWLMMPK R +NLNTFYRKEN+S+ +  KL E YRSD+ ++G RCMN S+Y+L+++ C      N+W+   P  I L+T  CDC+TTG Q+CS+  SGGP++S R+MAS+D+L +L+ YNISD+L+K FK++I KQYGG QF+LPS FGQSC++IG   IW D  +S ++S +++SN +Q+ FLNYFQ FFN SGIKTN +RIWINSKGY S+PAY NIFSNLL+R+   ++ +  NYGI+VANYPLKYTQSDL S +  QMF+EVSLA+FVIFGLSFIPASFVIFLIEER+TGSK QQ VSGVNPYVYW+SNF WD +KY + + I++L F+AF+YQSYIGSKN+ AFI LL  Y LA+IPHMYPFSF +S  STAFVV+ AYNLL+G +TTI+TF+LDL Q DD +LK  ND LKK+FL+FPQY LGRGM+DLSF+YL +NIS G ++Y+ F W  TG K+CSL +LFVGW +++  +ES    + LC K+K+  LK  E+  + ED+DV  ERERI ++  + +DVL+V  LTK+YN S++ +N C  K + +    +KRKLAVNN+ FGV+EGECFGLLGVNGAGKTTTFKML GEE IT GNA ING SII D + AH+NMGFCPQFDALH+LLTCEE+L FY RIRGI+ + I   VD SL+NLSLTPH  K T  +SGGNKRK+ TAIALIG PK++FLDEPT GMDAGARRFLW +IQ +TNE+K+AVILTSHNMEECE LCHRL+IMV+GEMK +GSVQHLKSKFG DYYV IR+   ++  +D  +++ II  +  S     + + V ++YRF SS KL+ IF  FE+L+ + ++ +YSVSQ +LD+VFINFA++D   +      +L+ +   ++ G  NEGF+ ++
Sbjct: 1122 LNYQPPMEISPWLMMPKARSLNLNTFYRKENSSNTLIDKLVEGYRSDLSEAGTRCMNQSVYRLDSYPCSSSIG-NQWTGNPPEPIPLLTAACDCNTTGFQLCSNSSSGGPQNSYRLMASTDKLNNLTGYNISDHLIKKFKSYIKKQYGGFQFLLPSPFGQSCKLIGSLPIW-DAMRSQSNSSNSSSNSDQLPFLNYFQEFFNLSGIKTNFTRIWINSKGYASLPAYGNIFSNLLMRTRFESNGS--NYGISVANYPLKYTQSDLLSKLNTQMFVEVSLAVFVIFGLSFIPASFVIFLIEERITGSKRQQIVSGVNPYVYWMSNFLWDILKYIVPIFIIVLIFVAFDYQSYIGSKNLGAFITLLIFYGLAIIPHMYPFSFLLSTPSTAFVVLDAYNLLLGSITTISTFFLDLLQQDDETLKPVNDVLKKVFLLFPQYGLGRGMMDLSFNYLTFNISNGKQDYDPFGWSTTGEKLCSLSVLFVGWWIVVFIIESGIINRMLCGKIKNRNLKAKEMKDEFEDVDVAVERERI-ISEKISDDVLKVIKLTKVYNQSLNVKNTCCKKVVKDTLENEKRKLAVNNLCFGVQEGECFGLLGVNGAGKTTTFKMLTGEEEITHGNAFINGQSIISDMIGAHRNMGFCPQFDALHALLTCEEQLTFYCRIRGIKSNQIKSVVDRSLRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVTIRMPFGKDHENDNEKVKAIIEDKFPSEVSFVDGSFVTLQYRFASSTKLAVIFDFFENLKKDSIILDYSVSQTTLDDVFINFARDDKPVK------SLVLQNLSDDGGAFNEGFDNSE 2018          

HSP 3 Score: 176.792 bits (447), Expect = 9.681e-44
Identity = 115/337 (34.12%), Postives = 182/337 (54.01%), Query Frame = 2
Query: 2324 ALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINR-TIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNS-KLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGG 3328
            A++NL     + +  G LG NGAGKTTT  +LTG    T G AFI    I  DM      +G CPQ + L A LT E+ + FY  ++G+  ++IK  +   ++ + L+     +++NLSGG KRKLS A+A +GN ++IFLDEPT+G+D  +RR +W++I K  + N+  +ILT+H+M+E + LC R++I+  G++KC GS   LK  FGD YY+ +   F    E            K+   I+   P+    +D +     V L +   +  +   +F+  ++      I  Y +S T+L++VF+  A         R +K + S +L  L+D G
Sbjct: 1692 AVNNLCFGVQEGECFGLLGVNGAGKTTTFKMLTGEEEITHGNAFINGQSIISDMIGAHRNMGFCPQFDALHALLTCEEQLTFYCRIRGIKSNQIKSVVDRSLRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVTIRMPFGKDHE--------NDNEKVKAIIEDKFPSEVSFVDGS----FVTLQYRFASSTKLAVIFDFFENLKKDSIILDYSVSQTTLDDVFINFA---------RDDKPVKSLVLQNLSDDG 2007          

HSP 4 Score: 167.933 bits (424), Expect = 5.060e-41
Identity = 108/315 (34.29%), Postives = 174/315 (55.24%), Query Frame = 1
Query: 5311 AVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSD-RNEI----ETIIN--KEIWSSARMKEEN----AVIIEYRFDSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVT 6222
            AV++++    + +    LG NGAGKTTT  +L G  + T G A I    I  D  K  + MG CPQ + L S LT E+ +YFY  ++G++  +I   +   ++++ LT      +  +SGG KRK+  A+A IG  K+VFLDEPT G+D  ARR +W L+    N+ +  +ILT+H+M+E + L  R+AI+  G+++  GS   LK +FG  YY+ I +  +R+   D R+ I    E ++N  +   + A+M EE      +++     +S K SD+F   +   +   +  Y +S  SL+EVF+  A + + T
Sbjct:  700 AVDDLNLNFYQSQITAFLGHNGAGKTTTISILTGIFSATSGTAYILNEDIRSDMDKIREKMGLCPQHNILFSNLTVEDHIYFYGLLKGMKTEEIREILPKIIEDVGLTKKMKSFSKNLSGGMKRKLSVAMAFIGDSKVVFLDEPTAGVDPFARRGIWDLLIKYRNDER-TIILTTHHMDEADYLSDRIAIISQGKLQCCGSSVFLKKEFGDGYYL-ILVKNSRSQEEDFRSGISSSGEKVLNFIRAHITDAKMIEETRTQWTIVLPQNEINSGKFSDLFADIDRSLSGLNIVSYGLSDTSLEEVFLKVADDPAGT 1012          
BLAST of ATP binding cassette subfamily A member 1 vs. Planmine SMEST
Match: SMESG000032896.1 (SMESG000032896.1)

HSP 1 Score: 1243.02 bits (3215), Expect = 0.000e+0
Identity = 657/1103 (59.56%), Postives = 836/1103 (75.79%), Query Frame = 2
Query:  260 MGSMGPIPFLRDFICTFNTSCYNTTQIDWTKNSINDFLTFMNNISSLYSSLYTTNFTVPGFVDWSNVNPNLYTQLLNSINYISPVISSFITSIKEMQTGDQTLINKNLKILGQLLCGSDQNDIDVFLQNFNLSLINSTKSIPTCQLAFMNYFTKSNGLSVLYPIIGPLVFGKIYYTPNSAFTQEIIRRANSTFRILDNLRLASVEWRLTFSNWLINNSTNMGLLNDARNYCA---NSRTLMCQIINNSLSIETIQSTIASLSAMFVLIENSLNCTQLNKFTPMPSSIDIDNLSKQSSLGILAGIVFTDDFQYVTPQNATFLNYQIRMPASRIDSTKNFKVLDRFWTPIPRVNTLTNFNYYTSGFLFLQEIIDQAFIELI-TDNASVNIGSSMQIMPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTXXXXXXXXXXXXXXXXXGKXXXXXXXXXXXXXXXXXXXXXXCQCFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQRE--------ENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANINGPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGLFSE 3532
            M SMGPIPFLRDF+CT NT+CYN TQIDW+ N+ NDF TF+NN++ LY  L    F  P         PN  TQL  S+NY++      + ++ ++Q+G++T  +K +K +   +CGS +ND+++F+ +F ++   S +S+ +CQ  F+     S+  S +Y ++ PL+FGKIYYTP+S FT+E+I+RANSTF+ILD+LRL++VEWRL FS++ +N   N   +N+ RN+C         MC  +N  L +E I +  A++SA+F +IENSLNCT+LNKF PM SSIDIDNL+ QS   I AG+V  + FQY+T  NATFL+YQIRMP +RID+T  FKVLD +WTP PR+NTLT+F YYTSGF+ LQE +DQAFIE++ T+N S+N+GSSMQIMPYPCY+ND+ I FLS++MPFLL+IAW P+VTNL+K IVYEKENRLKEFM+VMG+SN VHW+ WF +TI IL+LPII+MT+IL    IL FSSP ++FLIL  YVVSFICQ FMISVFFD +NVAA+ GGI+Y I YLPF VFI   D+++  MYYGVGLLTQV+FCN+INFI + EQ++DG QFSNLF+ST+++LN GVGHC++M+W+DSV Y+LIAWYVE+VFPG+YGV KPWYFLFTR YW   S + D I + DN    E        E I   GFE EP +L++GI I+NLVK +P +KT A+DNLNL FYQSQIT FLGHNG GKTTTISILTGI + TSGTA+IL+ DIR DM+ IR K+GLCPQHNILF+ LTVEDHIYFYGLLKGM   EI+  LP I+++VGL+KK+K  SKNLSGGMKRKLS+AMAF+G+S+++FLDEPTAGVDPF+RRGIWDL++KYR+  RTIILTTHHMDEADYL DRIAIISQGKL+CCGSS+FLK+ FGDGYYL L K+   Q E   +   S SG K+L FI+  I ++K+I+ET+TQWT+VL  N  N  +F+ LF  +D SL  L   SYGLSDTSLEEVFLKVADDP+    + ++KQIT+E LD+LTD GN PRP S LSFR K       +   + +E      LL+G +L+ QQ+ GL +KRFH+TKRNIKG  +E
Sbjct:    1 MASMGPIPFLRDFLCTLNTTCYNKTQIDWSGNNTNDFQTFLNNMTYLYGVL-NKPFPTP--------TPNDITQLTYSLNYLNSSTYPLLVAMMQIQSGNKTESDKGMKTIEASICGSSENDMNLFVNSF-VTNQKSKRSLQSCQNQFLQTLGSSSYGSQMYQVLAPLIFGKIYYTPDSPFTRELIKRANSTFKILDDLRLSAVEWRLHFSSYFVNYMNNSQPINNLRNFCKLNIPGTQQMCSTVNAILDMENILAYNAAISAVFAIIENSLNCTELNKFVPMKSSIDIDNLANQSLTNIYAGLVINESFQYLTRNNATFLSYQIRMPTNRIDTTLKFKVLDSYWTPAPRINTLTDFKYYTSGFMLLQEALDQAFIEIVSTNNESINVGSSMQIMPYPCYVNDKFIKFLSSMMPFLLIIAWMPSVTNLLKGIVYEKENRLKEFMQVMGLSNLVHWIGWFITTISILMLPIIIMTLILHYSTILDFSSPAVVFLILLSYVVSFICQSFMISVFFDKANVAAVAGGIIYSILYLPFYVFITIPDDVTDSMYYGVGLLTQVAFCNSINFIAFWEQSTDGVQFSNLFDSTVVNLNVGVGHCMVMMWVDSVIYLLIAWYVESVFPGQYGVGKPWYFLFTRHYWCQNSAS-DKITLIDNHYSYESLPIPNINEGILKHGFESEPTNLKVGISIKNLVKTYPGAKTRAVDNLNLNFYQSQITAFLGHNGDGKTTTISILTGIFSATSGTAYILNEDIRSDMDKIREKMGLCPQHNILFSNLTVEDHIYFYGLLKGMKTEEIREILPKIIEDVGLTKKMKSFSKNLSGGMKRKLSVAMAFIGDSKVVFLDEPTAGVDPFARRGIWDLLIKYRNDERTIILTTHHMDEADYLSDRIAIISQGKLQCCGSSVFLKKEFGDGYYLILVKNSRSQEEDFRSG-ISSSGEKVLNFIRAHITDAKMIEETRTQWTIVLPQNEINIGKFSDLFADIDRSLSGLNFVSYGLSDTSLEEVFLKVADDPAGSVQEIKDKQITAEDLDSLTDDGNFPRPSSRLSFRDKLEFPRFDDLNSIPYESGAPSSLLTGSALLRQQLLGLQVKRFHYTKRNIKGFVAE 1091          

HSP 2 Score: 988.023 bits (2553), Expect = 0.000e+0
Identity = 506/910 (55.60%), Postives = 656/910 (72.09%), Query Frame = 1
Query: 3592 MDNQPSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMNTSLYQLENFKCLYPYNTNKWSEKSPIEISLVTPECDCSTTGNQICSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMKQYGGLQFILPSFFGQSCQVIGESQIWFDFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNISGGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESK-HKKTLCIKLKDVKLKPYEIITD-EDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMK--TIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRNISNGNALIQKPNFNNDGYLNEGFEKTD 6309
            ++ QP M ISPWLMMPK R +NLNTFYRKEN+S+ +  KL E YRSD+ ++G RCMN S+Y+L+++ C      N+W    P  I L+T  CDC   G Q+CS+  SGGP+SS R+MAS+D+L +L+ YNISD+L+K FK++I KQYGG QF+LPS FGQSC++IG   IW D  +S ++S +++SN +Q+ FLNYFQ FFN SGIKTN +RIWINSKGY S+PAY NIFSNLLLR+   ++ +  NYGI+VANYPLKYTQSDL                 +I GLSFIPASFVIFL EER+TGSK QQ VSGVNPYVYW+SNF WD +KY + + I++L F+AF+YQSYIGSKN+ AFI LL  Y LA+IPHMYPFSF +S  STAFV ++AYNL +G +TTI+TF LDL Q DD +LK  ND LKK+FL+FPQY LGRGM+DLSF+YL++NIS G ++Y+ F W  TG K+CSL +LFVGW +++  +ES    +TLC K+K+  LK  E+  + ED+DV  ERERI ++  + +DVL+V  LTK+YN S++ +N C    + +    +KR+LAVNN+ FGV+EGECFGLLGVNGAGKTTTFKML GEE IT GNA ING SII D + AH+NMGFCPQFDALH+LLTCEE+L FY RIRGI+ + I   VD SL+NLSLTPH  K T  +SGGNKRK+ TAIALIG PK++FLDEPT GMDAGARRFLW +IQ +TNE+K+A +                    +GE +   +GSVQHLKSKFG DYYV IR+   ++  +D  +++ II  +  S       + V ++YRF SS KL+ IF  FE+L+ + ++  YSVSQ +L++VFINFA++D   +      +LI +   ++ G  NEGF+ ++
Sbjct: 1112 LNYQPPMEISPWLMMPKARSLNLNTFYRKENSSNTLIDKLVEGYRSDLSEAGTRCMNQSVYRLDSYLC-SSSTGNQWIGNPPEPIPLLTAACDCKKIGYQMCSNSSSGGPQSSYRLMASNDKLNNLTGYNISDHLIKKFKSYIKKQYGGFQFLLPSPFGQSCKLIGSLPIW-DAMRSQSNSSNSSSNSDQLPFLNYFQEFFNLSGIKTNFTRIWINSKGYASLPAYGNIFSNLLLRTRFESNGS--NYGISVANYPLKYTQSDLL----------------MISGLSFIPASFVIFLSEERITGSKRQQIVSGVNPYVYWMSNFLWDILKYIVPIFIIVLIFVAFDYQSYIGSKNLGAFITLLIFYGLAIIPHMYPFSFLLSTPSTAFVNLNAYNLFLGSITTISTFLLDLLQKDDETLKPVNDFLKKVFLLFPQYGLGRGMMDLSFNYLKFNISNGKQDYDPFGWSTTGEKLCSLSVLFVGWWIVVFIIESGIINRTLCGKIKNRNLKAKEMKDEFEDVDVAVERERI-ISEKISDDVLKVIKLTKVYNQSLNVKNTCCKNVVKDALENEKRELAVNNLCFGVREGECFGLLGVNGAGKTTTFKMLTGEEEITRGNAFINGQSIISDMIGAHRNMGFCPQFDALHALLTCEEQLTFYCRIRGIESNQIKSVVDTSLRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAAV-------------------NNGEWRNEVLGSVQHLKSKFGDDYYVTIRMPFGKDHENDNEKVKAIIEDKFRSEVSFVNGSFVTLQYRFASSTKLAVIFDFFENLKKDSIILYYSVSQTTLNDVFINFARDDKPVK------SLILQNLSDDGGSFNEGFDNSE 1975          

HSP 3 Score: 162.155 bits (409), Expect = 2.719e-39
Identity = 106/313 (33.87%), Postives = 170/313 (54.31%), Query Frame = 1
Query: 5311 AVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSD-RNEI----ETIIN--KEIWSSARMKEEN----AVIIEYRFDSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDS 6216
            AV+N++    + +    LG NG GKTTT  +L G  + T G A I    I  D  K  + MG CPQ + L S LT E+ +YFY  ++G++  +I   +   ++++ LT      +  +SGG KRK+  A+A IG  K+VFLDEPT G+D  ARR +W L+    N+ +  +ILT+H+M+E + L  R+AI+  G+++  GS   LK +FG  YY+ I +  +R+   D R+ I    E ++N  +   + A+M EE      +++     +  K SD+F   +   +      Y +S  SL+EVF+  A + +
Sbjct:  690 AVDNLNLNFYQSQITAFLGHNGDGKTTTISILTGIFSATSGTAYILNEDIRSDMDKIREKMGLCPQHNILFSNLTVEDHIYFYGLLKGMKTEEIREILPKIIEDVGLTKKMKSFSKNLSGGMKRKLSVAMAFIGDSKVVFLDEPTAGVDPFARRGIWDLLIKYRNDER-TIILTTHHMDEADYLSDRIAIISQGKLQCCGSSVFLKKEFGDGYYL-ILVKNSRSQEEDFRSGISSSGEKVLNFIRAHITDAKMIEETRTQWTIVLPQNEINIGKFSDLFADIDRSLSGLNFVSYGLSDTSLEEVFLKVADDPA 1000          

HSP 4 Score: 135.961 bits (341), Expect = 2.267e-31
Identity = 110/344 (31.98%), Postives = 169/344 (49.13%), Query Frame = 2
Query: 2324 ALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLK--CCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLK-------IASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGG 3328
            A++NL     + +  G LG NGAGKTTT  +LTG    T G AFI    I  DM      +G CPQ + L A LT E+ + FY  ++G+  ++IK  +   ++ + L+     +++NLSGG KRKLS A+A +GN ++IFLDEPT+G+D  +RR +W++I K  + N                  +IA ++ G+ +    GS   LK  FGD YY+ +   F    E  +            E +K II      D+ +++ + V     T + +F S   +L    DF +       I  Y +S T+L +VF+  A         R +K + S +L  L+D G
Sbjct: 1666 AVNNLCFGVREGECFGLLGVNGAGKTTTFKMLTGEEEITRGNAFINGQSIISDMIGAHRNMGFCPQFDALHALLTCEEQLTFYCRIRGIESNQIKSVVDTSLRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNEN------------------KIAAVNNGEWRNEVLGSVQHLKSKFGDDYYVTIRMPFGKDHENDN------------EKVKAIIE-----DKFRSEVSFVNGSFVTLQYRFASS-TKLAVIFDFFENLKKDSIILYYSVSQTTLNDVFINFA---------RDDKPVKSLILQNLSDDG 1964          
BLAST of ATP binding cassette subfamily A member 1 vs. Planmine SMEST
Match: SMESG000032896.1 (SMESG000032896.1)

HSP 1 Score: 1238.79 bits (3204), Expect = 0.000e+0
Identity = 655/1100 (59.55%), Postives = 834/1100 (75.82%), Query Frame = 2
Query:  269 MGPIPFLRDFICTFNTSCYNTTQIDWTKNSINDFLTFMNNISSLYSSLYTTNFTVPGFVDWSNVNPNLYTQLLNSINYISPVISSFITSIKEMQTGDQTLINKNLKILGQLLCGSDQNDIDVFLQNFNLSLINSTKSIPTCQLAFMNYFTKSNGLSVLYPIIGPLVFGKIYYTPNSAFTQEIIRRANSTFRILDNLRLASVEWRLTFSNWLINNSTNMGLLNDARNYCA---NSRTLMCQIINNSLSIETIQSTIASLSAMFVLIENSLNCTQLNKFTPMPSSIDIDNLSKQSSLGILAGIVFTDDFQYVTPQNATFLNYQIRMPASRIDSTKNFKVLDRFWTPIPRVNTLTNFNYYTSGFLFLQEIIDQAFIELI-TDNASVNIGSSMQIMPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTXXXXXXXXXXXXXXXXXGKXXXXXXXXXXXXXXXXXXXXXXCQCFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQRE--------ENITIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANINGPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGLFSE 3532
            MGPIPFLRDF+CT NT+CYN TQIDW+ N+ NDF TF+NN++ LY  L    F  P         PN  TQL  S+NY++      + ++ ++Q+G++T  +K +K +   +CGS +ND+++F+ +F ++   S +S+ +CQ  F+     S+  S +Y ++ PL+FGKIYYTP+S FT+E+I+RANSTF+ILD+LRL++VEWRL FS++ +N   N   +N+ RN+C         MC  +N  L +E I +  A++SA+F +IENSLNCT+LNKF PM SSIDIDNL+ QS   I AG+V  + FQY+T  NATFL+YQIRMP +RID+T  FKVLD +WTP PR+NTLT+F YYTSGF+ LQE +DQAFIE++ T+N S+N+GSSMQIMPYPCY+ND+ I FLS++MPFLL+IAW P+VTNL+K IVYEKENRLKEFM+VMG+SN VHW+ WF +TI IL+LPII+MT+IL    IL FSSP ++FLIL  YVVSFICQ FMISVFFD +NVAA+ GGI+Y I YLPF VFI   D+++  MYYGVGLLTQV+FCN+INFI + EQ++DG QFSNLF+ST+++LN GVGHC++M+W+DSV Y+LIAWYVE+VFPG+YGV KPWYFLFTR YW   S + D I + DN    E        E I   GFE EP +L++GI I+NLVK +P +KT A+DNLNL FYQSQIT FLGHNG GKTTTISILTGI + TSGTA+IL+ DIR DM+ IR K+GLCPQHNILF+ LTVEDHIYFYGLLKGM   EI+  LP I+++VGL+KK+K  SKNLSGGMKRKLS+AMAF+G+S+++FLDEPTAGVDPF+RRGIWDL++KYR+  RTIILTTHHMDEADYL DRIAIISQGKL+CCGSS+FLK+ FGDGYYL L K+   Q E   +   S SG K+L FI+  I ++K+I+ET+TQWT+VL  N  N  +F+ LF  +D SL  L   SYGLSDTSLEEVFLKVADDP+    + ++KQIT+E LD+LTD GN PRP S LSFR K       +   + +E      LL+G +L+ QQ+ GL +KRFH+TKRNIKG  +E
Sbjct:    1 MGPIPFLRDFLCTLNTTCYNKTQIDWSGNNTNDFQTFLNNMTYLYGVL-NKPFPTP--------TPNDITQLTYSLNYLNSSTYPLLVAMMQIQSGNKTESDKGMKTIEASICGSSENDMNLFVNSF-VTNQKSKRSLQSCQNQFLQTLGSSSYGSQMYQVLAPLIFGKIYYTPDSPFTRELIKRANSTFKILDDLRLSAVEWRLHFSSYFVNYMNNSQPINNLRNFCKLNIPGTQQMCSTVNAILDMENILAYNAAISAVFAIIENSLNCTELNKFVPMKSSIDIDNLANQSLTNIYAGLVINESFQYLTRNNATFLSYQIRMPTNRIDTTLKFKVLDSYWTPAPRINTLTDFKYYTSGFMLLQEALDQAFIEIVSTNNESINVGSSMQIMPYPCYVNDKFIKFLSSMMPFLLIIAWMPSVTNLLKGIVYEKENRLKEFMQVMGLSNLVHWIGWFITTISILMLPIIIMTLILHYSTILDFSSPAVVFLILLSYVVSFICQSFMISVFFDKANVAAVAGGIIYSILYLPFYVFITIPDDVTDSMYYGVGLLTQVAFCNSINFIAFWEQSTDGVQFSNLFDSTVVNLNVGVGHCMVMMWVDSVIYLLIAWYVESVFPGQYGVGKPWYFLFTRHYWCQNSAS-DKITLIDNHYSYESLPIPNINEGILKHGFESEPTNLKVGISIKNLVKTYPGAKTRAVDNLNLNFYQSQITAFLGHNGDGKTTTISILTGIFSATSGTAYILNEDIRSDMDKIREKMGLCPQHNILFSNLTVEDHIYFYGLLKGMKTEEIREILPKIIEDVGLTKKMKSFSKNLSGGMKRKLSVAMAFIGDSKVVFLDEPTAGVDPFARRGIWDLLIKYRNDERTIILTTHHMDEADYLSDRIAIISQGKLQCCGSSVFLKKEFGDGYYLILVKNSRSQEEDFRSG-ISSSGEKVLNFIRAHITDAKMIEETRTQWTIVLPQNEINIGKFSDLFADIDRSLSGLNFVSYGLSDTSLEEVFLKVADDPAGSVQEIKDKQITAEDLDSLTDDGNFPRPSSRLSFRDKLEFPRFDDLNSIPYESGAPSSLLTGSALLRQQLLGLQVKRFHYTKRNIKGFVAE 1088          

HSP 2 Score: 987.638 bits (2552), Expect = 0.000e+0
Identity = 506/910 (55.60%), Postives = 656/910 (72.09%), Query Frame = 1
Query: 3592 MDNQPSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMNTSLYQLENFKCLYPYNTNKWSEKSPIEISLVTPECDCSTTGNQICSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMKQYGGLQFILPSFFGQSCQVIGESQIWFDFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNISGGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESK-HKKTLCIKLKDVKLKPYEIITD-EDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMK--TIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRNISNGNALIQKPNFNNDGYLNEGFEKTD 6309
            ++ QP M ISPWLMMPK R +NLNTFYRKEN+S+ +  KL E YRSD+ ++G RCMN S+Y+L+++ C      N+W    P  I L+T  CDC   G Q+CS+  SGGP+SS R+MAS+D+L +L+ YNISD+L+K FK++I KQYGG QF+LPS FGQSC++IG   IW D  +S ++S +++SN +Q+ FLNYFQ FFN SGIKTN +RIWINSKGY S+PAY NIFSNLLLR+   ++ +  NYGI+VANYPLKYTQSDL                 +I GLSFIPASFVIFL EER+TGSK QQ VSGVNPYVYW+SNF WD +KY + + I++L F+AF+YQSYIGSKN+ AFI LL  Y LA+IPHMYPFSF +S  STAFV ++AYNL +G +TTI+TF LDL Q DD +LK  ND LKK+FL+FPQY LGRGM+DLSF+YL++NIS G ++Y+ F W  TG K+CSL +LFVGW +++  +ES    +TLC K+K+  LK  E+  + ED+DV  ERERI ++  + +DVL+V  LTK+YN S++ +N C    + +    +KR+LAVNN+ FGV+EGECFGLLGVNGAGKTTTFKML GEE IT GNA ING SII D + AH+NMGFCPQFDALH+LLTCEE+L FY RIRGI+ + I   VD SL+NLSLTPH  K T  +SGGNKRK+ TAIALIG PK++FLDEPT GMDAGARRFLW +IQ +TNE+K+A +                    +GE +   +GSVQHLKSKFG DYYV IR+   ++  +D  +++ II  +  S       + V ++YRF SS KL+ IF  FE+L+ + ++  YSVSQ +L++VFINFA++D   +      +LI +   ++ G  NEGF+ ++
Sbjct: 1109 LNYQPPMEISPWLMMPKARSLNLNTFYRKENSSNTLIDKLVEGYRSDLSEAGTRCMNQSVYRLDSYLC-SSSTGNQWIGNPPEPIPLLTAACDCKKIGYQMCSNSSSGGPQSSYRLMASNDKLNNLTGYNISDHLIKKFKSYIKKQYGGFQFLLPSPFGQSCKLIGSLPIW-DAMRSQSNSSNSSSNSDQLPFLNYFQEFFNLSGIKTNFTRIWINSKGYASLPAYGNIFSNLLLRTRFESNGS--NYGISVANYPLKYTQSDLL----------------MISGLSFIPASFVIFLSEERITGSKRQQIVSGVNPYVYWMSNFLWDILKYIVPIFIIVLIFVAFDYQSYIGSKNLGAFITLLIFYGLAIIPHMYPFSFLLSTPSTAFVNLNAYNLFLGSITTISTFLLDLLQKDDETLKPVNDFLKKVFLLFPQYGLGRGMMDLSFNYLKFNISNGKQDYDPFGWSTTGEKLCSLSVLFVGWWIVVFIIESGIINRTLCGKIKNRNLKAKEMKDEFEDVDVAVERERI-ISEKISDDVLKVIKLTKVYNQSLNVKNTCCKNVVKDALENEKRELAVNNLCFGVREGECFGLLGVNGAGKTTTFKMLTGEEEITRGNAFINGQSIISDMIGAHRNMGFCPQFDALHALLTCEEQLTFYCRIRGIESNQIKSVVDTSLRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAAV-------------------NNGEWRNEVLGSVQHLKSKFGDDYYVTIRMPFGKDHENDNEKVKAIIEDKFRSEVSFVNGSFVTLQYRFASSTKLAVIFDFFENLKKDSIILYYSVSQTTLNDVFINFARDDKPVK------SLILQNLSDDGGSFNEGFDNSE 1972          

HSP 3 Score: 161.77 bits (408), Expect = 3.057e-39
Identity = 106/313 (33.87%), Postives = 170/313 (54.31%), Query Frame = 1
Query: 5311 AVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSD-RNEI----ETIIN--KEIWSSARMKEEN----AVIIEYRFDSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDS 6216
            AV+N++    + +    LG NG GKTTT  +L G  + T G A I    I  D  K  + MG CPQ + L S LT E+ +YFY  ++G++  +I   +   ++++ LT      +  +SGG KRK+  A+A IG  K+VFLDEPT G+D  ARR +W L+    N+ +  +ILT+H+M+E + L  R+AI+  G+++  GS   LK +FG  YY+ I +  +R+   D R+ I    E ++N  +   + A+M EE      +++     +  K SD+F   +   +      Y +S  SL+EVF+  A + +
Sbjct:  687 AVDNLNLNFYQSQITAFLGHNGDGKTTTISILTGIFSATSGTAYILNEDIRSDMDKIREKMGLCPQHNILFSNLTVEDHIYFYGLLKGMKTEEIREILPKIIEDVGLTKKMKSFSKNLSGGMKRKLSVAMAFIGDSKVVFLDEPTAGVDPFARRGIWDLLIKYRNDER-TIILTTHHMDEADYLSDRIAIISQGKLQCCGSSVFLKKEFGDGYYL-ILVKNSRSQEEDFRSGISSSGEKVLNFIRAHITDAKMIEETRTQWTIVLPQNEINIGKFSDLFADIDRSLSGLNFVSYGLSDTSLEEVFLKVADDPA 997          

HSP 4 Score: 135.961 bits (341), Expect = 2.383e-31
Identity = 110/344 (31.98%), Postives = 169/344 (49.13%), Query Frame = 2
Query: 2324 ALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLK--CCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLK-------IASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGG 3328
            A++NL     + +  G LG NGAGKTTT  +LTG    T G AFI    I  DM      +G CPQ + L A LT E+ + FY  ++G+  ++IK  +   ++ + L+     +++NLSGG KRKLS A+A +GN ++IFLDEPT+G+D  +RR +W++I K  + N                  +IA ++ G+ +    GS   LK  FGD YY+ +   F    E  +            E +K II      D+ +++ + V     T + +F S   +L    DF +       I  Y +S T+L +VF+  A         R +K + S +L  L+D G
Sbjct: 1663 AVNNLCFGVREGECFGLLGVNGAGKTTTFKMLTGEEEITRGNAFINGQSIISDMIGAHRNMGFCPQFDALHALLTCEEQLTFYCRIRGIESNQIKSVVDTSLRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNEN------------------KIAAVNNGEWRNEVLGSVQHLKSKFGDDYYVTIRMPFGKDHENDN------------EKVKAIIE-----DKFRSEVSFVNGSFVTLQYRFASS-TKLAVIFDFFENLKKDSIILYYSVSQTTLNDVFINFA---------RDDKPVKSLILQNLSDDG 1961          
The following BLAST results are available for this feature:
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ABCA13.937e-4536.77ATP binding cassette subfamily A member 1 [Source:... [more]
ABCA71.442e-16734.73ATP binding cassette subfamily A member 7 [Source:... [more]
ABCA46.430e-16034.36ATP binding cassette subfamily A member 4 [Source:... [more]
ABCA47.733e-15736.89ATP binding cassette subfamily A member 4 [Source:... [more]
ABCA22.451e-14937.67ATP binding cassette subfamily A member 2 [Source:... [more]
back to top
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abt-24.930e-10039.12ABC Transporter family [Source:UniProtKB/TrEMBL;A... [more]
abt-25.333e-10039.12ABC Transporter family [Source:UniProtKB/TrEMBL;A... [more]
abt-48.206e-10034.21ABC Transporter family [Source:UniProtKB/TrEMBL;A... [more]
ced-71.086e-6628.34ABC transporter ced-7 [Source:UniProtKB/Swiss-Pro... [more]
ced-71.172e-6628.34ABC transporter ced-7 [Source:UniProtKB/Swiss-Pro... [more]
back to top
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ABCA2.111e-10833.24gene:FBgn0031170 transcript:FBtr0306679[more]
ABCA2.245e-10833.24gene:FBgn0031170 transcript:FBtr0332489[more]
ABCA2.685e-10833.24gene:FBgn0031170 transcript:FBtr0332488[more]
CG60526.041e-9434.06gene:FBgn0036747 transcript:FBtr0075195[more]
CG341202.933e-6727.56gene:FBgn0083956 transcript:FBtr0343018[more]
back to top
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abca1b8.382e-4537.06ATP-binding cassette, sub-family A (ABC1), member ... [more]
abca1b9.618e-4536.63ATP-binding cassette, sub-family A (ABC1), member ... [more]
abca4a1.183e-3936.97ATP-binding cassette, sub-family A (ABC1), member ... [more]
abca4b1.811e-6435.83ATP-binding cassette, sub-family A (ABC1), member ... [more]
abca4b3.737e-4035.99ATP-binding cassette, sub-family A (ABC1), member ... [more]
back to top
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
klf91.024e-4033.55Kruppel-like factor 9 [Source:Xenbase;Acc:XB-GENE-... [more]
klf91.369e-6335.84Kruppel-like factor 9 [Source:Xenbase;Acc:XB-GENE-... [more]
klf96.547e-4335.84Kruppel-like factor 9 [Source:Xenbase;Acc:XB-GENE-... [more]
klf94.910e-4335.84Kruppel-like factor 9 [Source:Xenbase;Acc:XB-GENE-... [more]
klf94.846e-4335.84Kruppel-like factor 9 [Source:Xenbase;Acc:XB-GENE-... [more]
back to top
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Abca13.856e-4635.90ATP-binding cassette, sub-family A (ABC1), member ... [more]
Abca74.881e-16730.85ATP-binding cassette, sub-family A (ABC1), member ... [more]
Abca74.881e-16730.85ATP-binding cassette, sub-family A (ABC1), member ... [more]
Abca71.202e-16630.74ATP-binding cassette, sub-family A (ABC1), member ... [more]
Abca41.353e-15835.98ATP-binding cassette, sub-family A (ABC1), member ... [more]
back to top
BLAST of ATP binding cassette subfamily A member 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P41233|ABCA1_MOUSE2.697e-4535.90Phospholipid-transporting ATPase ABCA1 OS=Mus musc... [more]
sp|O95477|ABCA1_HUMAN1.891e-4436.77Phospholipid-transporting ATPase ABCA1 OS=Homo sap... [more]
sp|Q7TNJ2|ABCA7_RAT2.112e-17031.13ATP-binding cassette sub-family A member 7 OS=Ratt... [more]
sp|Q8IZY2|ABCA7_HUMAN6.177e-16734.73Phospholipid-transporting ATPase ABCA7 OS=Homo sap... [more]
sp|Q91V24|ABCA7_MOUSE3.414e-16630.85ATP-binding cassette sub-family A member 7 OS=Mus ... [more]
back to top
BLAST of ATP binding cassette subfamily A member 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3P9L2N41.846e-3936.17Uncharacterized protein OS=Oryzias latipes OX=8090... [more]
A0A0U2QQ095.219e-4136.34ATP-binding cassette transporter subfamily A membe... [more]
A0A3P9L2H41.725e-3936.26Uncharacterized protein OS=Oryzias latipes OX=8090... [more]
A0A3S2MJM91.403e-4035.71Uncharacterized protein OS=Oryzias javanicus OX=12... [more]
N1PB021.697e-3938.12Uncharacterized protein OS=Capitella teleta OX=283... [more]
back to top
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000016919.23.756e-4733.71pep primary_assembly:Astyanax_mexicanus-2.0:8:9912... [more]
ENSAMXT00000022236.29.146e-3936.51pep primary_assembly:Astyanax_mexicanus-2.0:21:133... [more]
abca4a2.713e-3834.86retinal-specific ATP-binding cassette transporter-... [more]
zgc:1723024.282e-4034.01zgc:172302 [Source:ZFIN;Acc:ZDB-GENE-081205-5][more]
abca4a8.812e-6536.83retinal-specific ATP-binding cassette transporter-... [more]
back to top
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002495.19.538e-17540.30pep scaffold:Pmarinus_7.0:GL480265:53:27909:1 gene... [more]
abca121.357e-11734.72ATP-binding cassette, sub-family A (ABC1), member ... [more]
ENSPMAT00000006855.13.218e-8648.40pep scaffold:Pmarinus_7.0:GL486953:391:4596:1 gene... [more]
ENSPMAT00000010397.15.343e-7742.38pep scaffold:Pmarinus_7.0:GL480213:155963:163950:1... [more]
ENSPMAT00000004117.11.631e-7637.79pep scaffold:Pmarinus_7.0:GL489716:190:6182:-1 gen... [more]
back to top
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PDR53.317e-1427.31Plasma membrane ATP-binding cassette (ABC) transpo... [more]
ADP19.332e-1326.32Putative ATP-dependent permease of the ABC transpo... [more]
PDR153.067e-1228.30Plasma membrane ATP binding cassette (ABC) transpo... [more]
ATM16.050e-1227.04Mitochondrial inner membrane ATP-binding cassette ... [more]
YOL075C_mRNA7.605e-1227.00Putative ABC transporter [Source:SGD;Acc:S00000543... [more]
back to top
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO468781.810e-17340.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388798.975e-16734.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO489511.502e-12437.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO320704.248e-7034.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO320711.386e-5838.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ATP binding cassette subfamily A member 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000045391.15.129e-4337.57ATP-binding cassette sub-family A member 1-like [S... [more]
ENSORLT00000046301.14.959e-4337.67ATP-binding cassette sub-family A member 1-like [S... [more]
ENSORLT00000025407.25.717e-4236.33ATP-binding cassette sub-family A member 1 [Source... [more]
zgc:1723026.058e-4434.18ATP-binding cassette sub-family A member 1 [Source... [more]
abca4a4.887e-3934.10retinal-specific ATP-binding cassette transporter ... [more]
back to top
BLAST of ATP binding cassette subfamily A member 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000056983.13.828e-3999.67SMESG000056983.1[more]
SMESG000068605.11.214e-4179.43SMESG000068605.1[more]
SMESG000032861.19.681e-4459.28SMESG000032861.1[more]
SMESG000032896.12.719e-3959.56SMESG000032896.1[more]
SMESG000032896.13.057e-3959.55SMESG000032896.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032074 ID=SMED30032074|Name=ATP binding cassette subfamily A member 1|organism=Schmidtea mediterranea sexual|type=transcript|length=6489bp
CTAAATGTTGCAGATGTTGCAGGAAATGTAATTCTTTTGGAATATTTTGA
TTACTATCTGGATCTGTGAAATAATGAAGAGTGTTTTTTTCGATCAACTT
CTATTATTATTATGGAAAAATTTTCGATTAAAAAAGCGTAAACCGTTTTC
GTTGATTATAGAAATGCTTATTCCTTTATTTGTCATATTTATATTGGTAG
CAGTTAGAAGGATTACTTCTTCTTATTCAATGGGTACTTGTGAATTGAGA
GAGAAGCAAATGGGCTCGATGGGTCCGATTCCGTTTTTGAGAGATTTTAT
ATGTACATTTAATACCTCATGTTATAATACTACGCAAATTGATTGGACCA
AGAATAGTATAAACGACTTTTTGACGTTTATGAATAACATCAGTAGTTTG
TATTCGAGTTTATACACGACAAATTTTACTGTACCAGGATTTGTTGATTG
GTCAAATGTCAATCCTAACTTATATACTCAGCTATTGAATAGTATTAATT
ACATTTCTCCAGTAATTTCTTCATTCATTACATCTATTAAAGAAATGCAA
ACTGGTGATCAAACATTGATCAATAAAAATCTCAAAATTCTTGGACAATT
GTTGTGCGGATCGGATCAAAATGATATTGATGTTTTTCTGCAGAATTTTA
ATTTATCTTTAATAAATTCTACCAAGTCTATTCCAACTTGTCAATTGGCT
TTTATGAATTATTTTACCAAAAGCAATGGTTTGTCGGTGTTGTATCCAAT
TATTGGTCCATTGGTATTTGGAAAAATTTATTACACTCCGAATTCTGCGT
TTACTCAAGAAATAATCCGAAGAGCAAATTCAACATTTAGAATCCTCGAC
AATTTACGATTAGCATCCGTAGAATGGCGGTTGACATTTTCCAATTGGTT
AATTAATAATTCTACTAATATGGGTTTACTAAACGATGCCAGAAATTATT
GTGCCAATTCGAGAACTTTGATGTGTCAAATAATTAATAACAGCCTCAGT
ATTGAAACTATCCAATCAACGATAGCTAGTCTATCGGCAATGTTTGTATT
GATTGAAAATTCATTGAATTGTACGCAACTGAATAAATTTACTCCAATGC
CATCATCGATAGATATTGATAATTTATCCAAACAATCATCTCTTGGAATA
TTAGCGGGAATAGTTTTCACTGATGATTTTCAATACGTAACTCCGCAAAA
CGCAACTTTCCTCAATTATCAAATTCGAATGCCAGCTTCGAGAATAGATT
CGACGAAAAATTTTAAAGTCCTCGACAGATTTTGGACTCCGATTCCAAGA
GTTAATACTTTGACTAATTTTAATTATTACACGAGTGGATTTTTATTTCT
CCAAGAAATTATAGATCAGGCATTTATTGAATTGATTACCGACAATGCCT
CAGTAAATATTGGTTCCAGTATGCAAATCATGCCGTATCCTTGTTATTTG
AATGATAGACTAATTTCATTTCTATCCAACTTGATGCCGTTTCTGTTAGT
GATTGCTTGGGCTCCCGCTGTTACGAACTTGATTAAAAGTATTGTTTATG
AAAAGGAAAATCGACTGAAAGAATTCATGAGAGTCATGGGAATGAGTAAC
TTTGTTCATTGGGTAAGTTGGTTTACTTCCACAATTTTAATATTAATCTT
GCCTATCATATTAATGACTATCATTTTAAAACTCGGCAAAATATTGACAT
TTTCGTCTCCGATAATAATATTTTTGATTTTATTTTTCTATGTTGTTTCT
TTTATTTGTCAATGTTTTATGATTAGTGTGTTTTTTGATAACTCAAATGT
CGCCGCAATTGTCGGGGGAATTGTTTATTTTATTTTTTACTTGCCATTTT
TAGTATTTATAAATTTTCAAGATGAGCTATCAACGGAGATGTATTATGGA
GTTGGTTTGTTGACGCAAGTTTCATTCTGCAACGCCATTAATTTCATTGG
CTATTTGGAGCAAGCGAGTGACGGTGCGCAATTTTCTAATCTGTTTAACA
GCACAATTATTGATTTGAATTTTGGAGTTGGACATTGTTTGATAATGATA
TGGATAGATAGTGTTTTTTATATTTTAATAGCTTGGTATGTTGAAGCGGT
ATTTCCTGGAAAATACGGAGTACCGAAGCCCTGGTATTTTCTATTCACAA
GACGTTATTGGATACCATTTTCTAAGAATAACGATAATATTGAAATTTCA
GACAATTTTCGGCAACGTGAAGAAAATATCACTATAGATGGTTTTGAGAA
GGAGCCCGACGATTTGGAAATTGGAATATTGATTGAAAATCTTGTCAAAA
AATTTCCGAAATCTAAAACACCGGCACTTGATAATCTCAATTTGAAATTC
TATCAGTCACAAATCACTGGATTTCTTGGTCATAACGGGGCTGGTAAAAC
AACCACAATATCGATTTTGACGGGGATTCTCACCCCTACTTCTGGAACTG
CATTTATTTTGGATAATGATATTAGATATGACATGGAAATAATAAGATCA
AAAATAGGATTATGTCCGCAGCACAATATCTTATTCGCCTATTTGACAGT
TGAGGATCATATTTATTTTTACGGACTCCTTAAAGGAATGACAAAATCAG
AAATTAAACATCAACTGCCGGATATAGTTAAAGAAGTTGGCTTATCTAAA
AAATTGAAATGTATGTCAAAAAATCTTTCCGGAGGAATGAAGCGAAAATT
AAGCATAGCAATGGCATTTGTTGGCAATTCTCGTATAATTTTTCTCGATG
AACCAACTGCTGGAGTCGATCCATTTTCTCGTCGAGGAATTTGGGATTTA
ATAGTGAAATATCGAAGCATCAATCGAACAATTATTCTCACCACTCATCA
CATGGATGAAGCCGATTATTTGTGTGACAGAATTGCCATAATATCTCAAG
GTAAACTCAAATGTTGTGGATCATCTTTGTTTCTAAAACAAAATTTCGGG
GATGGATATTATTTATTCCTAGAAAAATCTTTTGAAATTCAAAGTGAAAC
TTGTCATAACAATAAAGCATCTGAAAGTGGCACTAAGCTTCTAGAATTTA
TTAAAAAAATCATTCCGAATTCCAAACTAATTGACGAAACAAAAACTCAA
TGGACAGTCGTTTTATCGCATAATTCAACCAATAGAAATCAATTTACGAG
TCTATTTGAACAACTCGATTCTTCGTTAGACTTTTTAAAAATTGCGTCTT
ATGGCTTGTCGGATACTTCTCTTGAAGAGGTATTCTTAAAAGTCGCAGAT
GACCCGTCTCAAATTTCTCATAAACGACAAGAGAAACAAATTACTTCAGA
AATGCTGGATACGTTGACAGACGGTGGAAATTTACCTCGTCCAGTTTCAG
TTTTGAGTTTCAGAAAAAAAACTATTAATACTGCAAACATAAATGGCCCT
AAAGTTTCATTTGAATTCGAAAACAATTTAGTTTTACTTTCTGGCTTGTC
TTTAATTTTTCAACAAATTTCCGGGCTGTTTATTAAGCGTTTTCATCATA
CTAAAAGAAATATTAAAGGACTTTTCAGTGAATTAATATTGCCCCTGTTG
TTAATTTATTAATAAGTGGTTTATTAAAAATTAAAAGCTCTATGGACAAT
CAACCATCAATGACAATTAGTCCTTGGTTAATGATGCCTAAAACTCGATT
GGTAAATCTAAATACTTTCTATAGAAAAGAGAACACTTCCGATCAAATTA
GCTTTAAGTTAAATGAAAATTACAGGTCAGATATCGGACAATCTGGAGTT
CGGTGTATGAATACATCATTGTATCAATTGGAAAACTTTAAATGCCTTTA
TCCATATAACACAAATAAATGGTCGGAAAAATCGCCAATTGAAATATCTC
TAGTTACACCAGAATGTGACTGTAGTACCACTGGAAATCAAATTTGTTCC
AGTCCACTCAGTGGAGGTCCAGAGAGTTCGAATCGTATAATGGCCAGTTC
AGATAGGCTTTATGATCTTTCCTCGTATAATATTTCAGATTATCTTATGA
AAAATTTCAAAACATTTATCATGAAACAATATGGAGGCCTTCAATTTATT
CTTCCAAGCTTTTTCGGGCAATCTTGTCAAGTGATTGGAGAATCGCAGAT
TTGGTTTGATTTTCGTCAATCAATCAACTCTTCCCGTGATAACAATTCCA
ACCCGGAACAGGTTAAATTTCTCAATTATTTTCAATTGTTTTTCAATTCA
TCAGGAATAAAAACCAACTTGTCAAGAATCTGGATAAATTCAAAAGGTTA
CATTTCTATGCCAGCCTATGCAAATATTTTCAGTAATCTACTTTTGAGGT
CGACTGTTAATGCTTCCAAGGCATTGCAAAATTATGGAATTGCGGTTGCG
AATTACCCTTTAAAATATACCCAATCCGACTTGTTTAGTTTCATCTACGC
TCAAATGTTTCTTGAAGTTTCTTTAGCGATTTTTGTTATATTTGGACTTT
CTTTTATACCAGCTAGTTTCGTCATATTTTTGATTGAAGAGAGAGTCACT
GGGTCCAAGTTACAGCAGTATGTTTCTGGTGTAAACCCATACGTTTACTG
GATATCTAATTTCTTTTGGGATGCGATAAAATATTCAATATCTGTGTTAA
TTGTAATTTTATTTTTTCTTGCATTTAATTATCAGTCTTATATCGGTAGT
AAGAATATTCTGGCATTTATTGTCTTACTTTTCCTTTATTCTTTAGCTGT
GATTCCACACATGTATCCGTTTAGTTTTTTTATATCAAAATCTAGTACGG
CTTTTGTTGTTATTAGTGCTTATAATCTTCTAGTAGGAGGCCTCACGACT
ATAACCACGTTTTATTTGGATCTCTATCAGTATGATGATGCTTCCTTGAA
ATCTGCCAATGACGCATTGAAAAAAATATTTCTAATATTTCCTCAATATG
ATCTTGGCCGAGGAATGATAGATTTGTCTTTCAGTTATTTAAGATATAAT
ATTAGTGGGGGAGATGAAAATTACAATGCATTTGAATGGGATATAACTGG
AAATAAGATATGCTCTCTTGGTATTCTATTCGTCGGATGGTGCCTAATAA
TAGTTTTCATGGAAAGTAAACATAAAAAGACATTGTGTATAAAATTAAAA
GATGTTAAATTAAAGCCTTATGAAATAATCACTGACGAAGATTTGGATGT
ATTTAAAGAAAGAGAAAGAATTGAGTTAAATCATGACGTTCTTAATGATG
TTCTTCAAGTTTACGGTTTAACAAAAATTTATAATCCATCTATTGACTTT
AGAAATAAGTGCTTTGGAAAAGCCATTATTAATGTATCGTCGGAAGATAA
ACGTAAACTTGCCGTAAATAATATCAGTTTCGGAGTTAAAGAAGGAGAAT
GCTTTGGATTATTAGGAGTGAATGGAGCAGGCAAAACGACTACATTTAAA
ATGCTTATCGGAGAAGAAAATATAACTTTAGGAAATGCAATTATCAATGG
ATATTCCATTATTGATGACACATTAAAGGCTCATAAAAATATGGGATTCT
GTCCACAATTTGATGCTCTTCATTCTTTATTGACGTGCGAAGAAGAGTTA
TATTTTTACAATCGTATACGAGGAATACAGCCATCCGATATTCCAATTAA
TGTTGATTTAAGCTTGAAAAATCTTAGTCTAACTCCACACTATAATAAAC
CGACATATATGATATCTGGGGGAAACAAAAGAAAAATGCAAACTGCTATA
GCGCTAATTGGATATCCTAAAATTGTGTTTTTAGACGAACCGACATGTGG
AATGGATGCTGGAGCTAGGAGATTTTTATGGCGGTTAATTCAAACATTGA
CAAATGAACATAAAGTTGCTGTGATTTTAACATCACATAACATGGAGGAG
TGTGAAGTGCTATGTCATAGGTTAGCAATCATGGTAGATGGAGAAATGAA
AACCATCGGAAGTGTTCAACATTTAAAATCAAAATTTGGGCACGATTATT
ACGTAAAGATTCGTTTGCATCCTAATCGAAATTCCCTTTCAGATAGAAAT
GAAATAGAAACGATTATCAATAAAGAAATATGGTCCAGTGCCAGGATGAA
GGAGGAAAATGCTGTGATAATTGAATATCGATTTGATTCGTCAGTTAAAT
TATCCGATATTTTTAGAGTTTTCGAAGATCTCAGAACAAACGAAATGGTT
AAGGAATATTCAGTTTCTCAAATGTCTTTGGATGAGGTCTTCATAAACTT
TGCTAAAAATGATTCTGTAACACGAAATATTAGTAACGGAAACGCTTTAA
TTCAAAAACCGAATTTTAATAATGACGGATATTTGAATGAAGGATTCGAA
AAAACGGACTTTTGATATGAGATTTTCCAATAGTCTGTAGATATCATTTT
ACAGATTCGTTAAATTGTTTTTAGAAATTATTTTGTTGAGACTTCAAAAA
AAGAATTTATCAAAAACATCAATTATATATTTTCAATGTTTTATTTTGTG
ACTGTCTATCTTGAACTAAAAATTTGCAGATCGGAAGAG
back to top

protein sequence of SMED30032074-orf-1

>SMED30032074-orf-1 ID=SMED30032074-orf-1|Name=SMED30032074-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=908bp
MDNQPSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQ
SGVRCMNTSLYQLENFKCLYPYNTNKWSEKSPIEISLVTPECDCSTTGNQ
ICSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMKQYGGL
QFILPSFFGQSCQVIGESQIWFDFRQSINSSRDNNSNPEQVKFLNYFQLF
FNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGI
AVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEE
RVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSY
IGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGG
LTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYL
RYNISGGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCI
KLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPS
IDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTT
TFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCE
EELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQ
TAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHN
MEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLS
DRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLSDIFRVFEDLRTN
EMVKEYSVSQMSLDEVFINFAKNDSVTRNISNGNALIQKPNFNNDGYLNE
GFEKTDF*
back to top

protein sequence of SMED30032074-orf-2

>SMED30032074-orf-2 ID=SMED30032074-orf-2|Name=SMED30032074-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1163bp
MKSVFFDQLLLLLWKNFRLKKRKPFSLIIEMLIPLFVIFILVAVRRITSS
YSMGTCELREKQMGSMGPIPFLRDFICTFNTSCYNTTQIDWTKNSINDFL
TFMNNISSLYSSLYTTNFTVPGFVDWSNVNPNLYTQLLNSINYISPVISS
FITSIKEMQTGDQTLINKNLKILGQLLCGSDQNDIDVFLQNFNLSLINST
KSIPTCQLAFMNYFTKSNGLSVLYPIIGPLVFGKIYYTPNSAFTQEIIRR
ANSTFRILDNLRLASVEWRLTFSNWLINNSTNMGLLNDARNYCANSRTLM
CQIINNSLSIETIQSTIASLSAMFVLIENSLNCTQLNKFTPMPSSIDIDN
LSKQSSLGILAGIVFTDDFQYVTPQNATFLNYQIRMPASRIDSTKNFKVL
DRFWTPIPRVNTLTNFNYYTSGFLFLQEIIDQAFIELITDNASVNIGSSM
QIMPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKE
FMRVMGMSNFVHWVSWFTSTILILILPIILMTIILKLGKILTFSSPIIIF
LILFFYVVSFICQCFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQD
ELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNF
GVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFS
KNNDNIEISDNFRQREENITIDGFEKEPDDLEIGILIENLVKKFPKSKTP
ALDNLNLKFYQSQITGFLGHNGAGKTTTISILTGILTPTSGTAFILDNDI
RYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPD
IVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDP
FSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGS
SLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNS
KLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSL
EEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKT
INTANINGPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGL
FSELILPLLLIY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR026082ABCA
IPR003593AAA+_ATPase
IPR003439ABC_transporter-like
IPR027417P-loop_NTPase
IPR017871ABC_transporter_CS
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0016887ATPase activity
GO:0090554phosphatidylcholine-translocating ATPase activity
GO:0090556phosphatidylserine-translocating ATPase activity
GO:0000166nucleotide binding
GO:0008509anion transmembrane transporter activity
GO:0017127cholesterol transporter activity
GO:0019905syntaxin binding
GO:0031267small GTPase binding
GO:0034185apolipoprotein binding
GO:0034186apolipoprotein A-I binding
GO:0034188apolipoprotein A-I receptor activity
GO:0042626ATPase activity, coupled to transmembrane movement of substances
GO:0051117ATPase binding
GO:0005102signaling receptor binding
GO:0005215transporter activity
GO:0005515protein binding
GO:0005548phospholipid transporter activity
Vocabulary: biological process
TermDefinition
GO:0071397cellular response to cholesterol
GO:0098656anion transmembrane transport
GO:0006497protein lipidation
GO:0006810transport
GO:0006911phagocytosis, engulfment
GO:0007040lysosome organization
GO:0007186G-protein coupled receptor signaling pathway
GO:0007584response to nutrient
GO:0008203cholesterol metabolic process
GO:0010875positive regulation of cholesterol efflux
GO:0015914phospholipid transport
GO:0015917aminophospholipid transport
GO:0016197endosomal transport
GO:0030301cholesterol transport
GO:0030819positive regulation of cAMP biosynthetic process
GO:0032367intracellular cholesterol transport
GO:0032489regulation of Cdc42 protein signal transduction
GO:0033344cholesterol efflux
GO:0033700phospholipid efflux
GO:0034380high-density lipoprotein particle assembly
GO:0034616response to laminar fluid shear stress
GO:0038027apolipoprotein A-I-mediated signaling pathway
GO:0042157lipoprotein metabolic process
GO:0042158lipoprotein biosynthetic process
GO:0042493response to drug
GO:0042632cholesterol homeostasis
GO:0043691reverse cholesterol transport
GO:0045332phospholipid translocation
GO:0050702interleukin-1 beta secretion
GO:0055085transmembrane transport
GO:0055091phospholipid homeostasis
GO:0055098response to low-density lipoprotein particle
GO:0060155platelet dense granule organization
GO:0071222cellular response to lipopolysaccharide
GO:0071300cellular response to retinoic acid
GO:0002790peptide secretion
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0005887integral component of plasma membrane
GO:0009897external side of plasma membrane
GO:0009986cell surface
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030139endocytic vesicle
GO:0034364high-density lipoprotein particle
GO:0043231intracellular membrane-bounded organelle
GO:0045121membrane raft
GO:0045335phagocytic vesicle
GO:0048471perinuclear region of cytoplasm
GO:0005794Golgi apparatus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR026082ABC transporter APANTHERPTHR19229ATP-BINDING CASSETTE TRANSPORTER SUBFAMILY A ABCAcoord: 8..75
coord: 180..557
IPR026082ABC transporter APANTHERPTHR19229ATP-BINDING CASSETTE TRANSPORTER SUBFAMILY A ABCAcoord: 1..605
NoneNo IPR availablePANTHERPTHR19229:SF216ATP-BINDING CASSETTE, SUB-FAMILY A (ABC1), MEMBER 1Acoord: 8..75
coord: 180..557
NoneNo IPR availableTMHMMTMhelixcoord: 25..44
NoneNo IPR availableTMHMMTMhelixcoord: 540..557
NoneNo IPR availableTMHMMTMhelixcoord: 513..535
NoneNo IPR availableTMHMMTMhelixcoord: 470..492
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 174..446
e-value: 4.5E-65
score: 221.8
NoneNo IPR availableCDDcd03263ABC_subfamily_Acoord: 177..397
e-value: 1.59588E-115
score: 341.022
NoneNo IPR availableTMHMMTMhelixcoord: 90..112
NoneNo IPR availableTMHMMTMhelixcoord: 48..70
NoneNo IPR availableTMHMMTMhelixcoord: 16..38
IPR003593AAA+ ATPase domainSMARTSM00382AAA_5coord: 203..386
e-value: 2.7E-10
score: 50.2
IPR003439ABC transporter-likePFAMPF00005ABC_trancoord: 194..338
e-value: 2.5E-30
score: 105.8
IPR003439ABC transporter-likePROSITEPS50893ABC_TRANSPORTER_2coord: 177..409
score: 19.995
IPR017871ABC transporter, conserved sitePROSITEPS00211ABC_TRANSPORTER_1coord: 310..324
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 174..392