Ras-related protein Rab-3

Overview
NameRas-related protein Rab-3
Smed IDSMED30032068
Length (bp)1022
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ras-related protein Rab-3 (SMED30032068) t-SNE clustered cells

Violin plots show distribution of expression levels for Ras-related protein Rab-3 (SMED30032068) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ras-related protein Rab-3 (SMED30032068) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ras-related protein Rab-3 (SMED30032068) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032068

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30032068SMESG000037789.1 dd_Smed_v4_2466_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30032068SMESG000037789.1 dd_Smed_v4_2466_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30032068SMESG000037789.1 dd_Smed_v4_2466_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032068SMESG000065416.1 Contig1074GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032068SMESG000037789.1 Contig1074GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30032068SMESG000037789.1 dd_Smed_v4_2466_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ras-related protein Rab-3 vs. Ensembl Human
Match: RAB3A (RAB3A, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9777])

HSP 1 Score: 331.643 bits (849), Expect = 3.095e-114
Identity = 154/209 (73.68%), Postives = 177/209 (84.69%), Query Frame = 2
Query:  266 KELSDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIEGEPYLANGGVKGKKLHQASETDGQGCQC 892
            KE SDQNFDYMFK+L+IGNSSVGKTSFLFRYAD+SF+ AFV+TVGIDFKVKT++R+DKR+KLQIWDTAGQERYRTITTAYYRGAMGFILMYD+TNEESFNAV DW  QIKTYSWDNAQV+LVGNKCD+ED++V+S  RG+QLAD LG EFFE+SAK+NINVK  FERLVD+ICEKM ES++       G  +G +L        Q C C
Sbjct:   12 KESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLSDQQVPPHQDCAC 220          
BLAST of Ras-related protein Rab-3 vs. Ensembl Human
Match: RAB3C (RAB3C, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:30269])

HSP 1 Score: 331.257 bits (848), Expect = 5.249e-114
Identity = 154/209 (73.68%), Postives = 178/209 (85.17%), Query Frame = 2
Query:  266 KELSDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIEGEPYLANGGVKGKKLHQASETDGQGCQC 892
            K+ SDQNFDYMFKLL+IGNSSVGKTSFLFRYAD+SF+SAFV+TVGIDFKVKTVF+++KR+KLQIWDTAGQERYRTITTAYYRGAMGFILMYD+TNEESFNAV DW  QIKTYSWDNAQV+LVGNKCD+ED++VIS  RGQ L +QLG EFFE+SAK+NINVK  FERLVDIIC+KM ES+E +P +     +  +L +        C C
Sbjct:   20 KDSSDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFKNEKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVILVGNKCDMEDERVISTERGQHLGEQLGFEFFETSAKDNINVKQTFERLVDIICDKMSESLETDPAIT-AAKQNTRLKETPPPPQPNCAC 227          
BLAST of Ras-related protein Rab-3 vs. Ensembl Human
Match: RAB3B (RAB3B, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9778])

HSP 1 Score: 323.168 bits (827), Expect = 6.194e-111
Identity = 149/209 (71.29%), Postives = 177/209 (84.69%), Query Frame = 2
Query:  266 KELSDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIEGEPYLANGGVKGKKLHQASETDGQGCQC 892
            K+ SDQNFDYMFKLL+IGNSSVGKTSFLFRYAD++F+ AFV+TVGIDFKVKTV+RH+KRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYD+TNEESFNAV DW  QIKTYSWDNAQV+LVGNKCD+E+++V+   +GQ LA+QLG +FFE+SAKENI+V+  FERLVD IC+KM +S++ +P +  G  K  +L        Q C C
Sbjct:   12 KDASDQNFDYMFKLLIIGNSSVGKTSFLFRYADDTFTPAFVSTVGIDFKVKTVYRHEKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWATQIKTYSWDNAQVILVGNKCDMEEERVVPTEKGQLLAEQLGFDFFEASAKENISVRQAFERLVDAICDKMSDSLDTDPSML-GSSKNTRLSDTPPLLQQNCSC 219          
BLAST of Ras-related protein Rab-3 vs. Ensembl Human
Match: RAB3D (RAB3D, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9779])

HSP 1 Score: 318.546 bits (815), Expect = 3.763e-109
Identity = 146/181 (80.66%), Postives = 166/181 (91.71%), Query Frame = 2
Query:  266 KELSDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIE 808
            ++ +DQNFDYMFKLLLIGNSSVGKTSFLFRYAD+SF+ AFV+TVGIDFKVKTV+RHDKR+KLQIWDTAGQERYRTITTAYYRGAMGF+LMYD+ N+ESF AV DW  QIKTYSWDNAQV+LVGNKCDLED++V+    G++LAD LG EFFE+SAKENINVK VFERLVD+ICEKM ES+E
Sbjct:   12 RDAADQNFDYMFKLLLIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTVYRHDKRIKLQIWDTAGQERYRTITTAYYRGAMGFLLMYDIANQESFAAVQDWATQIKTYSWDNAQVILVGNKCDLEDERVVPAEDGRRLADDLGFEFFEASAKENINVKQVFERLVDVICEKMNESLE 192          
BLAST of Ras-related protein Rab-3 vs. Ensembl Human
Match: RAB3D (RAB3D, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9779])

HSP 1 Score: 318.546 bits (815), Expect = 3.763e-109
Identity = 146/181 (80.66%), Postives = 166/181 (91.71%), Query Frame = 2
Query:  266 KELSDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIE 808
            ++ +DQNFDYMFKLLLIGNSSVGKTSFLFRYAD+SF+ AFV+TVGIDFKVKTV+RHDKR+KLQIWDTAGQERYRTITTAYYRGAMGF+LMYD+ N+ESF AV DW  QIKTYSWDNAQV+LVGNKCDLED++V+    G++LAD LG EFFE+SAKENINVK VFERLVD+ICEKM ES+E
Sbjct:   12 RDAADQNFDYMFKLLLIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTVYRHDKRIKLQIWDTAGQERYRTITTAYYRGAMGFLLMYDIANQESFAAVQDWATQIKTYSWDNAQVILVGNKCDLEDERVVPAEDGRRLADDLGFEFFEASAKENINVKQVFERLVDVICEKMNESLE 192          
BLAST of Ras-related protein Rab-3 vs. Ensembl Celegans
Match: rab-3 (Ras-related protein Rab-3 [Source:UniProtKB/Swiss-Prot;Acc:Q94986])

HSP 1 Score: 325.865 bits (834), Expect = 2.985e-112
Identity = 155/208 (74.52%), Postives = 180/208 (86.54%), Query Frame = 2
Query:  275 SDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIEGEPYLANGGVKGKKL--HQASETDGQGCQC 892
             DQNFDYMFKLL+IGNSSVGKTSFLFRY D+SF+SAFV+TVGIDFKVKTVFR DKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYD+TNEESFN+V DW  QIKTYSW+NAQVVLVGNKCD++ ++V+S+ RG+QLADQLG+EFFE+SAKENINVK VFE+LV+IIC+KM ES++ +P       KG+KL  +   +   Q C C
Sbjct:   29 PDQNFDYMFKLLIIGNSSVGKTSFLFRYCDDSFTSAFVSTVGIDFKVKTVFRGDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNSVQDWCTQIKTYSWENAQVVLVGNKCDMDSERVVSMDRGRQLADQLGLEFFETSAKENINVKAVFEKLVEIICDKMAESLDKDP---QQQPKGQKLEANPTQKPAQQQCNC 233          
BLAST of Ras-related protein Rab-3 vs. Ensembl Celegans
Match: rab-3 (Ras-related protein Rab-3 [Source:UniProtKB/Swiss-Prot;Acc:Q94986])

HSP 1 Score: 325.094 bits (832), Expect = 5.123e-112
Identity = 155/208 (74.52%), Postives = 180/208 (86.54%), Query Frame = 2
Query:  275 SDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIEGEPYLANGGVKGKKL--HQASETDGQGCQC 892
             DQNFDYMFKLL+IGNSSVGKTSFLFRY D+SF+SAFV+TVGIDFKVKTVFR DKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYD+TNEESFN+V DW  QIKTYSW+NAQVVLVGNKCD++ ++V+S+ RG+QLADQLG+EFFE+SAKENINVK VFE+LV+IIC+KM ES++ +P       KG+KL  +   +   Q C C
Sbjct:   15 PDQNFDYMFKLLIIGNSSVGKTSFLFRYCDDSFTSAFVSTVGIDFKVKTVFRGDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNSVQDWCTQIKTYSWENAQVVLVGNKCDMDSERVVSMDRGRQLADQLGLEFFETSAKENINVKAVFEKLVEIICDKMAESLDKDP---QQQPKGQKLEANPTQKPAQQQCNC 219          
BLAST of Ras-related protein Rab-3 vs. Ensembl Celegans
Match: rab-8 (RAB family; Rab8 [Source:UniProtKB/TrEMBL;Acc:G5EFC1])

HSP 1 Score: 202.601 bits (514), Expect = 4.203e-64
Identity = 91/171 (53.22%), Postives = 132/171 (77.19%), Query Frame = 2
Query:  281 QNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKM 793
            + +DY+FKLLLIG+S VGKT  LFR++D+SF+++F++T+GIDFK++T+    K++KLQIWDTAGQER+RTITTAYYRGAMG IL+YD+TNE SF  + +WI  I+ ++  + + +++GNKCD+E+ + +S  RG+QLA + G +F E+SAK N+N+   F  L   I  KM
Sbjct:    3 KTYDYLFKLLLIGDSGVGKTCVLFRFSDDSFNNSFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIILVYDITNERSFENIKNWIRNIEEHAASDVERMIIGNKCDIEERREVSRDRGEQLAIEYGTKFLETSAKANLNIDEAFFTLARDIKSKM 173          
BLAST of Ras-related protein Rab-3 vs. Ensembl Celegans
Match: rab-8 (RAB family; Rab8 [Source:UniProtKB/TrEMBL;Acc:G5EFC1])

HSP 1 Score: 202.601 bits (514), Expect = 4.203e-64
Identity = 91/171 (53.22%), Postives = 132/171 (77.19%), Query Frame = 2
Query:  281 QNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKM 793
            + +DY+FKLLLIG+S VGKT  LFR++D+SF+++F++T+GIDFK++T+    K++KLQIWDTAGQER+RTITTAYYRGAMG IL+YD+TNE SF  + +WI  I+ ++  + + +++GNKCD+E+ + +S  RG+QLA + G +F E+SAK N+N+   F  L   I  KM
Sbjct:    3 KTYDYLFKLLLIGDSGVGKTCVLFRFSDDSFNNSFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIILVYDITNERSFENIKNWIRNIEEHAASDVERMIIGNKCDIEERREVSRDRGEQLAIEYGTKFLETSAKANLNIDEAFFTLARDIKSKM 173          
BLAST of Ras-related protein Rab-3 vs. Ensembl Celegans
Match: rab-10 (Ras-related protein Rab-10 [Source:UniProtKB/Swiss-Prot;Acc:Q94148])

HSP 1 Score: 192.971 bits (489), Expect = 1.637e-60
Identity = 84/179 (46.93%), Postives = 133/179 (74.30%), Query Frame = 2
Query:  272 LSDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIE 808
            ++ + +D +FKLLLIG+S VGKT  L+R++D++F++ F++T+GIDFK+KT+    K++KLQIWDTAGQER+ TITT+YYRGAMG +L+YD+TN +SF+ +  W+  I  ++ ++   +++GNKCD+ D +V+S  RG+++A   G+ F E+SAK N++V   F  L + I  KM +S +
Sbjct:    1 MARRPYDMLFKLLLIGDSGVGKTCILYRFSDDAFNTTFISTIGIDFKIKTIELKGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITNAKSFDNIAKWLRNIDEHASEDVVKMILGNKCDMSDRRVVSRERGEKIAQDHGISFHETSAKLNVHVDTAFYDLAEAILAKMPDSTD 179          
BLAST of Ras-related protein Rab-3 vs. Ensembl Fly
Match: Rab3 (gene:FBgn0005586 transcript:FBtr0473383)

HSP 1 Score: 354.755 bits (909), Expect = 1.043e-123
Identity = 167/215 (77.67%), Postives = 189/215 (87.91%), Query Frame = 2
Query:  251 ENKMNKELSDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIEGEPYLANGGVKGKKL-HQASETDGQGCQC 892
            + K  K+ +DQNFDYMFKLL+IGNSSVGKTSFLFRYAD+SF+SAFV+TVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNE+SFN+V DW+ QIKTYSWDNAQV+LVGNKCD+ED +VIS  RG+QLADQLGVEFFE+SAKEN+NVK VFERLVDIIC+KM ES++ +P L  GG KG++L  Q   T    C C
Sbjct:    6 DPKWQKDAADQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSWDNAQVILVGNKCDMEDQRVISFERGRQLADQLGVEFFETSAKENVNVKAVFERLVDIICDKMSESLDADPTLVGGGQKGQRLTDQPQGTPNANCNC 220          
BLAST of Ras-related protein Rab-3 vs. Ensembl Fly
Match: Rab3 (gene:FBgn0005586 transcript:FBtr0088257)

HSP 1 Score: 354.755 bits (909), Expect = 1.043e-123
Identity = 167/215 (77.67%), Postives = 189/215 (87.91%), Query Frame = 2
Query:  251 ENKMNKELSDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIEGEPYLANGGVKGKKL-HQASETDGQGCQC 892
            + K  K+ +DQNFDYMFKLL+IGNSSVGKTSFLFRYAD+SF+SAFV+TVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNE+SFN+V DW+ QIKTYSWDNAQV+LVGNKCD+ED +VIS  RG+QLADQLGVEFFE+SAKEN+NVK VFERLVDIIC+KM ES++ +P L  GG KG++L  Q   T    C C
Sbjct:    6 DPKWQKDAADQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSWDNAQVILVGNKCDMEDQRVISFERGRQLADQLGVEFFETSAKENVNVKAVFERLVDIICDKMSESLDADPTLVGGGQKGQRLTDQPQGTPNANCNC 220          
BLAST of Ras-related protein Rab-3 vs. Ensembl Fly
Match: Rab8 (gene:FBgn0262518 transcript:FBtr0308833)

HSP 1 Score: 199.134 bits (505), Expect = 1.070e-62
Identity = 96/200 (48.00%), Postives = 142/200 (71.00%), Query Frame = 2
Query:  281 QNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIEGEPYLANGGVKGKKLHQASETDGQ 880
            + +DY+FKLLLIG+S VGKT  LFR+++++F++ F++T+GIDFK++T+   +K++KLQIWDTAGQER+RTITTAYYRGAMG +L+YD+T E+SF  + +WI  I+  +  + + +L+GNKC+L D + +S  RG+QLA + G++F E+SAK +INV+  F  L   I  K  + +E     AN   KG   HQ    D +
Sbjct:    3 KTYDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQVSKERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAKTEKRME-----ANNPPKGG--HQLKPMDSR 195          
BLAST of Ras-related protein Rab-3 vs. Ensembl Fly
Match: Rab8 (gene:FBgn0262518 transcript:FBtr0074921)

HSP 1 Score: 199.134 bits (505), Expect = 1.070e-62
Identity = 96/200 (48.00%), Postives = 142/200 (71.00%), Query Frame = 2
Query:  281 QNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIEGEPYLANGGVKGKKLHQASETDGQ 880
            + +DY+FKLLLIG+S VGKT  LFR+++++F++ F++T+GIDFK++T+   +K++KLQIWDTAGQER+RTITTAYYRGAMG +L+YD+T E+SF  + +WI  I+  +  + + +L+GNKC+L D + +S  RG+QLA + G++F E+SAK +INV+  F  L   I  K  + +E     AN   KG   HQ    D +
Sbjct:    3 KTYDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQVSKERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAKTEKRME-----ANNPPKGG--HQLKPMDSR 195          
BLAST of Ras-related protein Rab-3 vs. Ensembl Fly
Match: Rab10 (gene:FBgn0015789 transcript:FBtr0077337)

HSP 1 Score: 198.749 bits (504), Expect = 1.499e-62
Identity = 86/173 (49.71%), Postives = 132/173 (76.30%), Query Frame = 2
Query:  272 LSDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEK 790
            ++ + +D +FKLLLIG+S VGKT  LFR++D++F+S F++T+GIDFK+KTV    K++KLQIWDTAGQER+ TITT+YYRGAMG +L+YD+TNE+SF  +  W+  I  ++ ++ + +++GNKCD+ D +V++  RG+ +A + G+ F E+SAK NIN++  F  L + I +K
Sbjct:    1 MAKKTYDLLFKLLLIGDSGVGKTCILFRFSDDAFTSTFISTIGIDFKIKTVELRGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITNEKSFENIVKWLRNIDEHANEDVEKMILGNKCDMTDKRVVNKERGEAIAREHGIRFMETSAKSNINIERAFCELAEAILDK 173          
BLAST of Ras-related protein Rab-3 vs. Ensembl Zebrafish
Match: rab3da (RAB3D, member RAS oncogene family, a [Source:ZFIN;Acc:ZDB-GENE-080722-14])

HSP 1 Score: 328.561 bits (841), Expect = 3.826e-113
Identity = 157/223 (70.40%), Postives = 192/223 (86.10%), Query Frame = 2
Query:  230 SINPQRNENKMNKELSDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIEGEPYLANGGVKGKKLHQASETDGQ--GCQC 892
            S N  R++ ++ K+++DQNFDYMFKLL+IGNSSVGKTSFLFRYAD+SF+SAFV+TVGIDFKVKTV+R++KRVKLQIWDTAGQERYRTITTAYYRGAMGF+LMYD+TN++SF AV DW  QIKTYSWDNAQV+LVGNKCDLEDD++++   GQ+LA++LG +FFE+SAK+NINVK VFERLVDIIC+KM ES++ +P +     KG  L Q +  DGQ  GC C
Sbjct:    3 SANDTRHQTQVQKDVADQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVYRNEKRVKLQIWDTAGQERYRTITTAYYRGAMGFLLMYDITNQDSFYAVQDWATQIKTYSWDNAQVILVGNKCDLEDDRLVAREDGQRLANELGFQFFEASAKDNINVKQVFERLVDIICDKMNESLDTDPSILTNQ-KGPSL-QDTPPDGQSGGCGC 223          
BLAST of Ras-related protein Rab-3 vs. Ensembl Zebrafish
Match: rab3ab (RAB3A, member RAS oncogene family, b [Source:ZFIN;Acc:ZDB-GENE-041210-268])

HSP 1 Score: 327.02 bits (837), Expect = 1.197e-112
Identity = 150/209 (71.77%), Postives = 177/209 (84.69%), Query Frame = 2
Query:  266 KELSDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIEGEPYLANGGVKGKKLHQASETDGQGCQC 892
            KE SDQNFDYMFK+L+IGNSSVGKTSFLFRYAD+SF+ AFV+TVGIDFKVKT++R+DKR+KLQIWDTAGQERYRTITTAYYRGAMGFILMYD+TNEESF AV DW  QIKTYSWDNAQV+LVGNKCD+ED++V++  RG+QL++ LG E+FE+SAK+NINVK  FERLVDIICEKM ES++       G  +G +L +      Q C C
Sbjct:   12 KESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFAAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVASERGRQLSEHLGFEYFEASAKDNINVKQTFERLVDIICEKMSESLDAADPAVTGAKQGPQLTEQPAAPHQDCAC 220          
BLAST of Ras-related protein Rab-3 vs. Ensembl Zebrafish
Match: rab3c (RAB3C, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-040718-263])

HSP 1 Score: 324.324 bits (830), Expect = 1.249e-111
Identity = 146/214 (68.22%), Postives = 178/214 (83.18%), Query Frame = 2
Query:  251 ENKMNKELSDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIEGEPYLANGGVKGKKLHQASETDGQGCQC 892
            ++   KE SDQNFDYMFKLL+IGNSSVGKTSFLFRYAD++F+SAFV+TVGIDFKVKTV+++DKR+KLQIWDTAGQERYRTITTAYYRGAMGFILMYD+TNEESF AV DW  QIKTYSWDNAQV+L GNKCD+E+++++S+  G+ LA+QLG EFFE+SAK+NINVK  F+RLVDIIC+KM +++E +P  A G    +     +      C C
Sbjct:    5 QDNKQKENSDQNFDYMFKLLIIGNSSVGKTSFLFRYADDTFTSAFVSTVGIDFKVKTVYKNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFAAVQDWATQIKTYSWDNAQVILAGNKCDMEEERIVSVDSGRLLAEQLGFEFFETSAKDNINVKQTFDRLVDIICDKMSDTLEADPAAAGGTPSARLTETPAPPQPSDCSC 218          
BLAST of Ras-related protein Rab-3 vs. Ensembl Zebrafish
Match: rab3c (RAB3C, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-040718-263])

HSP 1 Score: 324.324 bits (830), Expect = 1.249e-111
Identity = 146/214 (68.22%), Postives = 178/214 (83.18%), Query Frame = 2
Query:  251 ENKMNKELSDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIEGEPYLANGGVKGKKLHQASETDGQGCQC 892
            ++   KE SDQNFDYMFKLL+IGNSSVGKTSFLFRYAD++F+SAFV+TVGIDFKVKTV+++DKR+KLQIWDTAGQERYRTITTAYYRGAMGFILMYD+TNEESF AV DW  QIKTYSWDNAQV+L GNKCD+E+++++S+  G+ LA+QLG EFFE+SAK+NINVK  F+RLVDIIC+KM +++E +P  A G    +     +      C C
Sbjct:    5 QDNKQKENSDQNFDYMFKLLIIGNSSVGKTSFLFRYADDTFTSAFVSTVGIDFKVKTVYKNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFAAVQDWATQIKTYSWDNAQVILAGNKCDMEEERIVSVDSGRLLAEQLGFEFFETSAKDNINVKQTFDRLVDIICDKMSDTLEADPAAAGGTPSARLTETPAPPQPSDCSC 218          
BLAST of Ras-related protein Rab-3 vs. Ensembl Zebrafish
Match: rab3c (RAB3C, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-040718-263])

HSP 1 Score: 323.939 bits (829), Expect = 2.330e-111
Identity = 146/215 (67.91%), Postives = 178/215 (82.79%), Query Frame = 2
Query:  248 NENKMNKELSDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIEGEPYLANGGVKGKKLHQASETDGQGCQC 892
             ++   KE SDQNFDYMFKLL+IGNSSVGKTSFLFRYAD++F+SAFV+TVGIDFKVKTV+++DKR+KLQIWDTAGQERYRTITTAYYRGAMGFILMYD+TNEESF AV DW  QIKTYSWDNAQV+L GNKCD+E+++++S+  G+ LA+QLG EFFE+SAK+NINVK  F+RLVDIIC+KM +++E +P  A G    +     +      C C
Sbjct:   10 TQDNKQKENSDQNFDYMFKLLIIGNSSVGKTSFLFRYADDTFTSAFVSTVGIDFKVKTVYKNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFAAVQDWATQIKTYSWDNAQVILAGNKCDMEEERIVSVDSGRLLAEQLGFEFFETSAKDNINVKQTFDRLVDIICDKMSDTLEADPAAAGGTPSARLTETPAPPQPSDCSC 224          
BLAST of Ras-related protein Rab-3 vs. Ensembl Xenopus
Match: rab3a (RAB3A, member RAS oncogene family [Source:NCBI gene;Acc:549180])

HSP 1 Score: 331.257 bits (848), Expect = 4.391e-114
Identity = 154/209 (73.68%), Postives = 177/209 (84.69%), Query Frame = 2
Query:  266 KELSDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIEGEPYLANGGVKGKKLHQASETDGQGCQC 892
            KE SDQNFDYMFK+L+IGNSSVGKTSFLFRYAD+SF+ AFV+TVGIDFKVKT++R+DKR+KLQIWDTAGQERYRTITTAYYRGAMGFILMYD+TNEESFNAV DW  QIKTYSWDNAQV+LVGNKCD+ED++V+S  RG+QLA+ LG EFFE+SAK+NINVK  FERLVDIICEKM ES++       G  +G +L        Q C C
Sbjct:   12 KESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLAEHLGFEFFEASAKDNINVKQTFERLVDIICEKMSESLDTADPAVTGAKQGPQLTDQQAPPHQDCAC 220          
BLAST of Ras-related protein Rab-3 vs. Ensembl Xenopus
Match: RAB3C (RAB3C, member RAS oncogene family [Source:NCBI gene;Acc:100496123])

HSP 1 Score: 321.627 bits (823), Expect = 2.904e-110
Identity = 150/181 (82.87%), Postives = 170/181 (93.92%), Query Frame = 2
Query:  266 KELSDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIE 808
            K+ SDQNFDYMFKLL+IGNSSVGKTSFLFRYAD+SF+SAFV+TVGIDFKVKTVF+++KR+KLQIWDTAGQERYRTITTAYYRGAMGFILMYD+TNEESFNAV DW  QIKTYSWDNAQV+LVGNKCD+ED++VIS  RG+ LA+QLG EFFE+SAK+NINVK  FERLVDIIC+KM E+IE
Sbjct:   20 KDTSDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFKNEKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVILVGNKCDMEDERVISAERGKHLAEQLGFEFFEASAKDNINVKQTFERLVDIICDKMSENIE 200          
BLAST of Ras-related protein Rab-3 vs. Ensembl Xenopus
Match: RAB3C (RAB3C, member RAS oncogene family [Source:NCBI gene;Acc:100496123])

HSP 1 Score: 320.857 bits (821), Expect = 4.473e-110
Identity = 150/181 (82.87%), Postives = 170/181 (93.92%), Query Frame = 2
Query:  266 KELSDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIE 808
            K+ SDQNFDYMFKLL+IGNSSVGKTSFLFRYAD+SF+SAFV+TVGIDFKVKTVF+++KR+KLQIWDTAGQERYRTITTAYYRGAMGFILMYD+TNEESFNAV DW  QIKTYSWDNAQV+LVGNKCD+ED++VIS  RG+ LA+QLG EFFE+SAK+NINVK  FERLVDIIC+KM E+IE
Sbjct:   12 KDTSDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFKNEKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVILVGNKCDMEDERVISAERGKHLAEQLGFEFFEASAKDNINVKQTFERLVDIICDKMSENIE 192          
BLAST of Ras-related protein Rab-3 vs. Ensembl Xenopus
Match: tekt1 (tektin 1 [Source:Xenbase;Acc:XB-GENE-5929242])

HSP 1 Score: 320.472 bits (820), Expect = 6.958e-110
Identity = 151/209 (72.25%), Postives = 179/209 (85.65%), Query Frame = 2
Query:  266 KELSDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIEGEPYLANGGVKGKKLHQASETDGQGCQC 892
            K+ +DQ+FDYMFKLL+IGNSSVGKTSFLFRYAD+SF+SAFV+TVGIDFKVKTV+R++KRVKLQIWDTAGQERYRTITTAYYRGAMGF+LMYD++N ESFNAV DW  QIKTYSWDNAQV+LVGNKCDLEDD+VI    G++LA++LG EFFE+SAK+NINVK VFERLVDIICEKM ES+E  P  +       +L +++  +   C C
Sbjct:   12 KDAADQSFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVYRNEKRVKLQIWDTAGQERYRTITTAYYRGAMGFLLMYDISNLESFNAVQDWATQIKTYSWDNAQVLLVGNKCDLEDDRVIPAEDGRKLAEELGFEFFEASAKDNINVKQVFERLVDIICEKMNESLENGPVPSGTA----QLSESAPKEHSNCSC 216          
BLAST of Ras-related protein Rab-3 vs. Ensembl Xenopus
Match: rab3b (RAB3B, member RAS oncogene family [Source:NCBI gene;Acc:100101786])

HSP 1 Score: 318.161 bits (814), Expect = 4.613e-109
Identity = 150/209 (71.77%), Postives = 178/209 (85.17%), Query Frame = 2
Query:  266 KELSDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIEGEPYLANGGVKGKKLHQASETDGQGCQC 892
            +++SDQNFDYMFKLL+IGNSSVGKTSFLFRYAD++F+SAFV+TVGIDFKVKTV+R+DKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYD+T+E S+NAV DW  QIKTYSWDNAQV+LVGNKCD+E+++VI+  +G+ LADQLG EFFE+SAKENI VK VFERLVDIIC+KM ES++ +      G K  +    +    Q C C
Sbjct:   12 RDVSDQNFDYMFKLLIIGNSSVGKTSFLFRYADDTFTSAFVSTVGIDFKVKTVYRNDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITSESSYNAVQDWATQIKTYSWDNAQVILVGNKCDMEEERVIAPEKGKHLADQLGFEFFEASAKENIQVKQVFERLVDIICDKMSESLDTD---QPPGGKNLRFTDTAPPIHQKCSC 217          
BLAST of Ras-related protein Rab-3 vs. Ensembl Mouse
Match: Rab3a (Ras-related protein Rab-3A [Source:UniProtKB/Swiss-Prot;Acc:P63011])

HSP 1 Score: 332.413 bits (851), Expect = 1.258e-114
Identity = 154/209 (73.68%), Postives = 177/209 (84.69%), Query Frame = 2
Query:  266 KELSDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIEGEPYLANGGVKGKKLHQASETDGQGCQC 892
            KE SDQNFDYMFK+L+IGNSSVGKTSFLFRYAD+SF+ AFV+TVGIDFKVKT++R+DKR+KLQIWDTAGQERYRTITTAYYRGAMGFILMYD+TNEESFNAV DW  QIKTYSWDNAQV+LVGNKCD+ED++V+S  RG+QLAD LG EFFE+SAK+NINVK  FERLVD+ICEKM ES++       G  +G +L        Q C C
Sbjct:   12 KESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLTDQQAPPHQDCAC 220          
BLAST of Ras-related protein Rab-3 vs. Ensembl Mouse
Match: Rab3a (Ras-related protein Rab-3A [Source:UniProtKB/Swiss-Prot;Acc:P63011])

HSP 1 Score: 332.413 bits (851), Expect = 1.258e-114
Identity = 154/209 (73.68%), Postives = 177/209 (84.69%), Query Frame = 2
Query:  266 KELSDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIEGEPYLANGGVKGKKLHQASETDGQGCQC 892
            KE SDQNFDYMFK+L+IGNSSVGKTSFLFRYAD+SF+ AFV+TVGIDFKVKT++R+DKR+KLQIWDTAGQERYRTITTAYYRGAMGFILMYD+TNEESFNAV DW  QIKTYSWDNAQV+LVGNKCD+ED++V+S  RG+QLAD LG EFFE+SAK+NINVK  FERLVD+ICEKM ES++       G  +G +L        Q C C
Sbjct:   12 KESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLTDQQAPPHQDCAC 220          
BLAST of Ras-related protein Rab-3 vs. Ensembl Mouse
Match: Rab3a (RAB3A, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:97843])

HSP 1 Score: 332.413 bits (851), Expect = 1.258e-114
Identity = 154/209 (73.68%), Postives = 177/209 (84.69%), Query Frame = 2
Query:  266 KELSDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIEGEPYLANGGVKGKKLHQASETDGQGCQC 892
            KE SDQNFDYMFK+L+IGNSSVGKTSFLFRYAD+SF+ AFV+TVGIDFKVKT++R+DKR+KLQIWDTAGQERYRTITTAYYRGAMGFILMYD+TNEESFNAV DW  QIKTYSWDNAQV+LVGNKCD+ED++V+S  RG+QLAD LG EFFE+SAK+NINVK  FERLVD+ICEKM ES++       G  +G +L        Q C C
Sbjct:   12 KESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLTDQQAPPHQDCAC 220          
BLAST of Ras-related protein Rab-3 vs. Ensembl Mouse
Match: Rab3a (RAB3A, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:97843])

HSP 1 Score: 332.413 bits (851), Expect = 1.258e-114
Identity = 154/209 (73.68%), Postives = 177/209 (84.69%), Query Frame = 2
Query:  266 KELSDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIEGEPYLANGGVKGKKLHQASETDGQGCQC 892
            KE SDQNFDYMFK+L+IGNSSVGKTSFLFRYAD+SF+ AFV+TVGIDFKVKT++R+DKR+KLQIWDTAGQERYRTITTAYYRGAMGFILMYD+TNEESFNAV DW  QIKTYSWDNAQV+LVGNKCD+ED++V+S  RG+QLAD LG EFFE+SAK+NINVK  FERLVD+ICEKM ES++       G  +G +L        Q C C
Sbjct:   12 KESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLTDQQAPPHQDCAC 220          
BLAST of Ras-related protein Rab-3 vs. Ensembl Mouse
Match: Rab3a (RAB3A, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:97843])

HSP 1 Score: 332.413 bits (851), Expect = 1.258e-114
Identity = 154/209 (73.68%), Postives = 177/209 (84.69%), Query Frame = 2
Query:  266 KELSDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIEGEPYLANGGVKGKKLHQASETDGQGCQC 892
            KE SDQNFDYMFK+L+IGNSSVGKTSFLFRYAD+SF+ AFV+TVGIDFKVKT++R+DKR+KLQIWDTAGQERYRTITTAYYRGAMGFILMYD+TNEESFNAV DW  QIKTYSWDNAQV+LVGNKCD+ED++V+S  RG+QLAD LG EFFE+SAK+NINVK  FERLVD+ICEKM ES++       G  +G +L        Q C C
Sbjct:   12 KESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLTDQQAPPHQDCAC 220          
BLAST of Ras-related protein Rab-3 vs. UniProt/SwissProt
Match: sp|P25228|RAB3_DROME (Ras-related protein Rab-3 OS=Drosophila melanogaster OX=7227 GN=Rab3 PE=1 SV=1)

HSP 1 Score: 354.755 bits (909), Expect = 1.046e-122
Identity = 167/215 (77.67%), Postives = 189/215 (87.91%), Query Frame = 2
Query:  251 ENKMNKELSDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIEGEPYLANGGVKGKKL-HQASETDGQGCQC 892
            + K  K+ +DQNFDYMFKLL+IGNSSVGKTSFLFRYAD+SF+SAFV+TVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNE+SFN+V DW+ QIKTYSWDNAQV+LVGNKCD+ED +VIS  RG+QLADQLGVEFFE+SAKEN+NVK VFERLVDIIC+KM ES++ +P L  GG KG++L  Q   T    C C
Sbjct:    6 DPKWQKDAADQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSWDNAQVILVGNKCDMEDQRVISFERGRQLADQLGVEFFETSAKENVNVKAVFERLVDIICDKMSESLDADPTLVGGGQKGQRLTDQPQGTPNANCNC 220          
BLAST of Ras-related protein Rab-3 vs. UniProt/SwissProt
Match: sp|P63012|RAB3A_RAT (Ras-related protein Rab-3A OS=Rattus norvegicus OX=10116 GN=Rab3a PE=1 SV=1)

HSP 1 Score: 332.413 bits (851), Expect = 8.796e-114
Identity = 154/209 (73.68%), Postives = 177/209 (84.69%), Query Frame = 2
Query:  266 KELSDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIEGEPYLANGGVKGKKLHQASETDGQGCQC 892
            KE SDQNFDYMFK+L+IGNSSVGKTSFLFRYAD+SF+ AFV+TVGIDFKVKT++R+DKR+KLQIWDTAGQERYRTITTAYYRGAMGFILMYD+TNEESFNAV DW  QIKTYSWDNAQV+LVGNKCD+ED++V+S  RG+QLAD LG EFFE+SAK+NINVK  FERLVD+ICEKM ES++       G  +G +L        Q C C
Sbjct:   12 KESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLTDQQAPPHQDCAC 220          
BLAST of Ras-related protein Rab-3 vs. UniProt/SwissProt
Match: sp|Q06AU3|RAB3A_PIG (Ras-related protein Rab-3A OS=Sus scrofa OX=9823 GN=RAB3A PE=2 SV=1)

HSP 1 Score: 332.413 bits (851), Expect = 8.796e-114
Identity = 154/209 (73.68%), Postives = 177/209 (84.69%), Query Frame = 2
Query:  266 KELSDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIEGEPYLANGGVKGKKLHQASETDGQGCQC 892
            KE SDQNFDYMFK+L+IGNSSVGKTSFLFRYAD+SF+ AFV+TVGIDFKVKT++R+DKR+KLQIWDTAGQERYRTITTAYYRGAMGFILMYD+TNEESFNAV DW  QIKTYSWDNAQV+LVGNKCD+ED++V+S  RG+QLAD LG EFFE+SAK+NINVK  FERLVD+ICEKM ES++       G  +G +L        Q C C
Sbjct:   12 KESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLTDQQAPPHQDCAC 220          
BLAST of Ras-related protein Rab-3 vs. UniProt/SwissProt
Match: sp|P63011|RAB3A_MOUSE (Ras-related protein Rab-3A OS=Mus musculus OX=10090 GN=Rab3a PE=1 SV=1)

HSP 1 Score: 332.413 bits (851), Expect = 8.796e-114
Identity = 154/209 (73.68%), Postives = 177/209 (84.69%), Query Frame = 2
Query:  266 KELSDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIEGEPYLANGGVKGKKLHQASETDGQGCQC 892
            KE SDQNFDYMFK+L+IGNSSVGKTSFLFRYAD+SF+ AFV+TVGIDFKVKT++R+DKR+KLQIWDTAGQERYRTITTAYYRGAMGFILMYD+TNEESFNAV DW  QIKTYSWDNAQV+LVGNKCD+ED++V+S  RG+QLAD LG EFFE+SAK+NINVK  FERLVD+ICEKM ES++       G  +G +L        Q C C
Sbjct:   12 KESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLTDQQAPPHQDCAC 220          
BLAST of Ras-related protein Rab-3 vs. UniProt/SwissProt
Match: sp|P11023|RAB3A_BOVIN (Ras-related protein Rab-3A OS=Bos taurus OX=9913 GN=RAB3A PE=1 SV=3)

HSP 1 Score: 332.028 bits (850), Expect = 9.290e-114
Identity = 154/209 (73.68%), Postives = 177/209 (84.69%), Query Frame = 2
Query:  266 KELSDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIEGEPYLANGGVKGKKLHQASETDGQGCQC 892
            KE SDQNFDYMFK+L+IGNSSVGKTSFLFRYAD+SF+ AFV+TVGIDFKVKT++R+DKR+KLQIWDTAGQERYRTITTAYYRGAMGFILMYD+TNEESFNAV DW  QIKTYSWDNAQV+LVGNKCD+ED++V+S  RG+QLAD LG EFFE+SAK+NINVK  FERLVD+ICEKM ES++       G  +G +L        Q C C
Sbjct:   12 KESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLTDQQAPPHQDCAC 220          
BLAST of Ras-related protein Rab-3 vs. TrEMBL
Match: A0A210Q034 (Ras-related protein Rab-3 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT09157 PE=4 SV=1)

HSP 1 Score: 361.688 bits (927), Expect = 9.180e-123
Identity = 168/215 (78.14%), Postives = 191/215 (88.84%), Query Frame = 2
Query:  248 NENKMNKELSDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIEGEPYLANGGVKGKKLHQASETDGQGCQC 892
            N++K  K+ +DQNFDYMFKLL+IGNSSVGKTSFLFRYAD+SF+SAFV+TVGIDFKVKTVFR DKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDW  QIKTYSWDNAQ+VLVGNKCDLED++V+S  RG+QLADQ+G+EFFE+SAKENINVK VFERLVDIIC+KM ES++ +P L N   KG +L + +     GCQC
Sbjct:   13 NDSKWQKDAADQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRQDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWCTQIKTYSWDNAQIVLVGNKCDLEDERVVSTERGKQLADQIGLEFFETSAKENINVKAVFERLVDIICDKMSESLDSDPSLINSQTKGTRLTENTNPQQGGCQC 227          
BLAST of Ras-related protein Rab-3 vs. TrEMBL
Match: J7FIS0 (Rab3 OS=Ruditapes philippinarum OX=129788 PE=2 SV=1)

HSP 1 Score: 360.918 bits (925), Expect = 1.393e-122
Identity = 168/215 (78.14%), Postives = 189/215 (87.91%), Query Frame = 2
Query:  248 NENKMNKELSDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIEGEPYLANGGVKGKKLHQASETDGQGCQC 892
            N++K  K+ +DQNFDYMFKLL+IGNSSVGKTSFLFRYAD+SF+SAFV+TVGIDFKVKTVFR DKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAV DW  QIKTYSWDNAQVVLVGNKCDLED++V+S  RG+QLADQLG+EFFE+SAKENINVK VFERLVDIIC+KM ES++ +P L +   KG +L +       GCQC
Sbjct:    5 NDSKWQKDAADQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRQDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVQDWCTQIKTYSWDNAQVVLVGNKCDLEDERVVSTERGKQLADQLGLEFFETSAKENINVKAVFERLVDIICDKMSESLDSDPTLVSSQAKGTRLTENPNPQASGCQC 219          
BLAST of Ras-related protein Rab-3 vs. TrEMBL
Match: K1R852 (Ras-related protein Rab-3 OS=Crassostrea gigas OX=29159 GN=CGI_10021960 PE=4 SV=1)

HSP 1 Score: 359.762 bits (922), Expect = 3.608e-122
Identity = 168/215 (78.14%), Postives = 191/215 (88.84%), Query Frame = 2
Query:  248 NENKMNKELSDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIEGEPYLANGGVKGKKLHQASETDGQGCQC 892
            N++K  K+ +DQNFDYMFKLL+IGNSSVGKTSFLFRYAD+SF+SAFV+TVGIDFKVKTVFR DKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAV DW  QIKTYSWDNAQVVLVGNKCDLED++V+S  RG+QLADQ+G+EFFE+SAKENINVK VFERLVDIIC+KM ES++ +P L N   KG +L + +  +G  CQC
Sbjct:    5 NDSKWQKDAADQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRQDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVMDWCTQIKTYSWDNAQVVLVGNKCDLEDERVVSTERGKQLADQIGLEFFETSAKENINVKAVFERLVDIICDKMSESLDQDPSLVNSQTKGTRLTENTAPEGGSCQC 219          
BLAST of Ras-related protein Rab-3 vs. TrEMBL
Match: A0A0L8G4F2 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22000262mg PE=4 SV=1)

HSP 1 Score: 358.221 bits (918), Expect = 1.385e-121
Identity = 167/215 (77.67%), Postives = 188/215 (87.44%), Query Frame = 2
Query:  248 NENKMNKELSDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIEGEPYLANGGVKGKKLHQASETDGQGCQC 892
            N++K  K+ +DQNFDYMFKLL+IGNSSVGKTSFLFRYAD+SF+SAFV+TVGIDFKVKTVFR DKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAV DW  QIKTYSWDNAQVVLVGNKCDLE+++V+S  RG+QLADQLG+EFFE+SAKENINVK VFERLVDIIC+KM ES++ +P L N   KG +L +        CQC
Sbjct:    5 NDSKWQKDAADQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRQDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVQDWCTQIKTYSWDNAQVVLVGNKCDLEEERVVSTERGKQLADQLGLEFFETSAKENINVKAVFERLVDIICDKMSESLDSDPTLVNSQTKGTRLTENPNPQNSSCQC 219          
BLAST of Ras-related protein Rab-3 vs. TrEMBL
Match: Q6BCV2 (Rab3 OS=Doryteuthis pealeii OX=1051067 GN=rab3 PE=4 SV=1)

HSP 1 Score: 358.221 bits (918), Expect = 1.549e-121
Identity = 168/215 (78.14%), Postives = 188/215 (87.44%), Query Frame = 2
Query:  248 NENKMNKELSDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIEGEPYLANGGVKGKKLHQASETDGQGCQC 892
            N++K  K+ +DQNFDYMFKLL+IGNSSVGKTSFLFRYAD+SF+SAFV+TVGIDFKVKTVFR DKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAV DW  QIKTYSWDNAQVVLVGNKCDLE+++V+S  RG+QLADQLG+EFFE+SAKENINVK VFERLVDIICEKM ES++ +P L N   KG +L +        CQC
Sbjct:    6 NDSKWQKDAADQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRQDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVQDWCTQIKTYSWDNAQVVLVGNKCDLEEERVVSTERGKQLADQLGLEFFETSAKENINVKAVFERLVDIICEKMSESLDTDPTLVNSQTKGTRLTENPNPQNGSCQC 220          
BLAST of Ras-related protein Rab-3 vs. Ensembl Cavefish
Match: rab3aa (ras-related protein Rab-3A-like [Source:NCBI gene;Acc:103026901])

HSP 1 Score: 332.798 bits (852), Expect = 8.144e-115
Identity = 152/209 (72.73%), Postives = 181/209 (86.60%), Query Frame = 2
Query:  266 KELSDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIEGEPYLANGGVKGKKLHQASETDGQGCQC 892
            K+ SDQNFDYMFK+L+IGNSSVGKTSFLFRYAD+SF+ AFV+TVGIDFKVKT++R+DKR+KLQIWDTAGQERYRTITTAYYRGAMGFILMYD+TNE+SFNAV DW  QIKTYSWDNAQV+LVGNKCD+ED+++++  RG+QLADQLG EFFE+SAK+NINVK  FERLVD+ICE+M ES+E       GG +G +L +  +   Q C C
Sbjct:   19 KDTSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEDSFNAVQDWSTQIKTYSWDNAQVLLVGNKCDIEDERLVASQRGRQLADQLGFEFFEASAKDNINVKQTFERLVDVICERMSESLESGDSSVTGGKQGPQLTEQPQRSHQDCAC 227          
BLAST of Ras-related protein Rab-3 vs. Ensembl Cavefish
Match: rab3aa (ras-related protein Rab-3A-like [Source:NCBI gene;Acc:103026901])

HSP 1 Score: 332.413 bits (851), Expect = 8.474e-115
Identity = 152/209 (72.73%), Postives = 181/209 (86.60%), Query Frame = 2
Query:  266 KELSDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIEGEPYLANGGVKGKKLHQASETDGQGCQC 892
            K+ SDQNFDYMFK+L+IGNSSVGKTSFLFRYAD+SF+ AFV+TVGIDFKVKT++R+DKR+KLQIWDTAGQERYRTITTAYYRGAMGFILMYD+TNE+SFNAV DW  QIKTYSWDNAQV+LVGNKCD+ED+++++  RG+QLADQLG EFFE+SAK+NINVK  FERLVD+ICE+M ES+E       GG +G +L +  +   Q C C
Sbjct:   12 KDTSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEDSFNAVQDWSTQIKTYSWDNAQVLLVGNKCDIEDERLVASQRGRQLADQLGFEFFEASAKDNINVKQTFERLVDVICERMSESLESGDSSVTGGKQGPQLTEQPQRSHQDCAC 220          
BLAST of Ras-related protein Rab-3 vs. Ensembl Cavefish
Match: pld6 (GTP-binding protein Rab-3D-like [Source:NCBI gene;Acc:103040938])

HSP 1 Score: 332.028 bits (850), Expect = 1.094e-114
Identity = 154/221 (69.68%), Postives = 185/221 (83.71%), Query Frame = 2
Query:  230 SINPQRNENKMNKELSDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIEGEPYLANGGVKGKKLHQASETDGQGCQC 892
            S++  R + +  K+ +DQNFDYMFKLL+IGNSSVGKTSFLFRYAD+SF+SAFV+TVGIDFKVKTV+R++KRVKLQIWDTAGQERYRTITTAYYRGAMGF+LMYD+TN+ESF AV DW  QIKTYSWDNAQV+LVGNKCDLEDD++++   GQ+LA++LG +FFE+SAK+NINVK VFERLVD+IC+KM ES++GEP       KG  L         GC C
Sbjct:    3 SVSDPRQQTQAQKDAADQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVYRNEKRVKLQIWDTAGQERYRTITTAYYRGAMGFLLMYDITNQESFYAVQDWATQIKTYSWDNAQVILVGNKCDLEDDRLVATEDGQRLANELGFQFFEASAKDNINVKQVFERLVDVICDKMNESMDGEPSQMTNH-KGPSLQDTPPAGQSGCSC 222          
BLAST of Ras-related protein Rab-3 vs. Ensembl Cavefish
Match: rab3ab (RAB3A, member RAS oncogene family [Source:NCBI gene;Acc:103043849])

HSP 1 Score: 328.946 bits (842), Expect = 2.037e-113
Identity = 151/209 (72.25%), Postives = 177/209 (84.69%), Query Frame = 2
Query:  266 KELSDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIEGEPYLANGGVKGKKLHQASETDGQGCQC 892
            KE SDQNFDYMFK+L+IGNSSVGKTSFLFRYAD+SF+ AFV+TVGIDFKVKT++R+DKR+KLQIWDTAGQERYRTITTAYYRGAMGFILMYD+TNEESF AV DW  QIKTYSWDNAQV+LVGNKCD+ED++V++  RG+QL++ LG EFFE+SAK+NINVK  FERLVDIICEKM ES++       G  +G +L +      Q C C
Sbjct:   12 KESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFAAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVAAERGRQLSEHLGFEFFEASAKDNINVKQTFERLVDIICEKMSESLDAADPAVTGAKQGPQLTEQPAAPHQDCAC 220          
BLAST of Ras-related protein Rab-3 vs. Ensembl Cavefish
Match: rab3ab (RAB3A, member RAS oncogene family [Source:NCBI gene;Acc:103043849])

HSP 1 Score: 328.946 bits (842), Expect = 2.037e-113
Identity = 151/209 (72.25%), Postives = 177/209 (84.69%), Query Frame = 2
Query:  266 KELSDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIEGEPYLANGGVKGKKLHQASETDGQGCQC 892
            KE SDQNFDYMFK+L+IGNSSVGKTSFLFRYAD+SF+ AFV+TVGIDFKVKT++R+DKR+KLQIWDTAGQERYRTITTAYYRGAMGFILMYD+TNEESF AV DW  QIKTYSWDNAQV+LVGNKCD+ED++V++  RG+QL++ LG EFFE+SAK+NINVK  FERLVDIICEKM ES++       G  +G +L +      Q C C
Sbjct:   12 KESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFAAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVAAERGRQLSEHLGFEFFEASAKDNINVKQTFERLVDIICEKMSESLDAADPAVTGAKQGPQLTEQPAAPHQDCAC 220          
BLAST of Ras-related protein Rab-3 vs. Ensembl Sea Lamprey
Match: rab3c (RAB3C, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-040718-263])

HSP 1 Score: 319.316 bits (817), Expect = 4.030e-110
Identity = 156/225 (69.33%), Postives = 185/225 (82.22%), Query Frame = 2
Query:  230 SINPQRNENKMNKELSDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIEGEPYLANGGV----KGKKLHQASETDGQGCQC 892
            +I    +E    K+ +DQNFDYMFKLL+IGNSSVGKTSFLFRYAD SF+SAFV+TVGIDFKVKTV+R++KR+KLQIWDTAGQERYRTITTAYYRGAMGFILMYD+TNE+SFNAV DW  QIKTYSWDNAQVVLVGNKCD+EDD+++   +G+QLA+QLG EFFE+SAK+NINVK  FERLVD+ICEKM ES++G+   A  G     +G +L  +     Q C C
Sbjct:    7 TIMASASERYGPKDAADQNFDYMFKLLIIGNSSVGKTSFLFRYADESFTSAFVSTVGIDFKVKTVYRNEKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEDSFNAVSDWSTQIKTYSWDNAQVVLVGNKCDMEDDRMVPTEQGRQLAEQLGFEFFETSAKDNINVKQTFERLVDVICEKMSESLDGDGAAAGAGAAGSKQGTRLTDSLPQSSQACGC 231          
BLAST of Ras-related protein Rab-3 vs. Ensembl Sea Lamprey
Match: rab8a (RAB8A, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-070424-36])

HSP 1 Score: 199.519 bits (506), Expect = 1.746e-63
Identity = 93/202 (46.04%), Postives = 143/202 (70.79%), Query Frame = 2
Query:  281 QNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIEGEPYLANGGVKGKKLHQASETDGQGC 886
            + +DY+FKLLLIG+S VGKT  LFR+++++F+S F++T+GIDFK++T+    K++KLQIWDTAGQER+RTITTAYYRGAMG +L+YD+TNE+SF  + +WI  I+ ++  + + +++GNKCD+ + + ++  RG++LA + G++F E+SAK +INV+  F  L   I  KM   +EG     +  V+     Q  +T    C
Sbjct:    3 KTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIDLDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFENIKNWIRNIEEHASADVEKMILGNKCDMNERRQVTRERGEKLAIEYGIKFMETSAKASINVEEAFFTLARDIKAKMDRKLEGNNTPDSNAVRITAPSQGKKTSFFRC 204          
BLAST of Ras-related protein Rab-3 vs. Ensembl Sea Lamprey
Match: rab1aa (RAB1A, member RAS oncogene family a [Source:ZFIN;Acc:ZDB-GENE-090312-110])

HSP 1 Score: 189.119 bits (479), Expect = 1.580e-59
Identity = 93/209 (44.50%), Postives = 135/209 (64.59%), Query Frame = 2
Query:  260 MNKELSDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIEGEPYLANGGVKGKKLHQASETDGQGC 886
            MN E     +DY+FKLLLIG+S VGK+  L R+AD++++ ++++T+G+DFK++T+    K +KLQIWDTAGQER+RTIT++YYRGA G I++YDVT++ESFN V  W+ +I  Y+ +N   +LVGNKCDL   KV+  +  ++ AD L + F E+SAK   NV+  F  +   I ++M     G      G    K      +T G GC
Sbjct:    4 MNPE-----YDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLEIPFLETSAKNATNVEQAFMTMAAEIKKRMG---PGATQAGAGKSNVKIDSTPVKTGGGGC 204          
BLAST of Ras-related protein Rab-3 vs. Ensembl Sea Lamprey
Match: rab8a (RAB8A, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-070424-36])

HSP 1 Score: 179.489 bits (454), Expect = 1.066e-55
Identity = 90/189 (47.62%), Postives = 134/189 (70.90%), Query Frame = 2
Query:  281 QNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKV-KTVFRHD-KRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIEGEPYLANGGVK 841
            +++D +FKLLLIG+S VGKT  LFR+++++F+S F++T+G    V +   R D K++KLQIWDTAGQER+RTITTAYYRGAMG +L+YD+TNE+SF  + +WI  I+ ++  + Q  +VGNKCD+ D + ++  RG++LA+   ++F E+SAK +INV+  F  L   I  KM + +EG     N  V+
Sbjct:    3 KSYDCLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGGSRPVCQVCIRIDLKKIKLQIWDTAGQERFRTITTAYYRGAMGSMLVYDITNEKSFENIKNWIRNIEEHASADVQ-KMVGNKCDMNDRRQVTKDRGEKLAEDYNIQFMETSAKASINVEEAFFTLAREIKAKMDKKMEGNTAAENSSVQ 190          
BLAST of Ras-related protein Rab-3 vs. Ensembl Sea Lamprey
Match: rab27a (RAB27A, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-050913-46])

HSP 1 Score: 158.688 bits (400), Expect = 1.555e-47
Identity = 81/219 (36.99%), Postives = 141/219 (64.38%), Query Frame = 2
Query:  272 LSDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVF----------RHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSW-DNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIEGEPYLANGGVKGK-KLHQASETDGQGCQC 892
            +SD  +DY+ KLL++G+S VGK+S L +Y +  F   ++ TVGIDF+ K V           +  KRV LQ+WDTAGQER+R++TTA++R AMGF++++D+T+E++F  V +W+ Q++ +++ ++  +VL GNK DL +   I+  + ++ A++ G+ +FE+SA+   NV    E L+ +I ++M   I+ + ++  G +  K KL +  E D +  +C
Sbjct:    1 MSDLEYDYLIKLLVLGDSGVGKSSLLCQYTEGRFHDKYITTVGIDFREKRVTYTNEGADGTAKQTKRVHLQLWDTAGQERFRSLTTAFFRDAMGFLVIFDLTSEQTFLNVRNWLNQLQMHAYCESPDIVLCGNKSDLSEHN-ITQKQAKEFAEKHGMPYFETSARTGNNVVPAVETLLGLIMKRMERCID-KSWIPQGVLNKKDKLQEVDEADSEKKKC 217          
BLAST of Ras-related protein Rab-3 vs. Ensembl Yeast
Match: SEC4 (Rab family GTPase; essential for vesicle-mediated exocytic secretion and autophagy; associates with the exocyst component Sec15p and may regulate polarized delivery of transport vesicles to the exocyst at the plasma membrane [Source:SGD;Acc:S000001889])

HSP 1 Score: 185.652 bits (470), Expect = 3.470e-58
Identity = 87/171 (50.88%), Postives = 127/171 (74.27%), Query Frame = 2
Query:  281 QNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKM 793
            +++D + K+LLIG+S VGK+  L R+ ++ F+ +F+ T+GIDFK+KTV  + K+VKLQ+WDTAGQER+RTITTAYYRGAMG IL+YDVT+E +F  +  W   +  ++ D AQ++LVGNK D+E  +V++  +G+ LA +LG+ F ESSAK + NV  +F  L  +I EK+
Sbjct:   15 KSYDSIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVKLQLWDTAGQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHANDEAQLLLVGNKSDME-TRVVTADQGEALAKELGIPFIESSAKNDDNVNEIFFTLAKLIQEKI 184          
BLAST of Ras-related protein Rab-3 vs. Ensembl Yeast
Match: YPT1 (Rab family GTPase; involved in the ER-to-Golgi step of the secretory pathway; complex formation with the Rab escort protein Mrs6p is required for prenylation of Ypt1p by type II protein geranylgeranyltransferase (Bet2p-Bet4p); binds to unspliced HAC1 mRNA; regulates the unfolded protein response (UPR) by promoting the decay of HAC1 RNA; localizes to the early Golgi, the transitional Golgi and ER membranes, pre-autophagosomal structures, and cytoplasmic vesicles [Source:SGD;Acc:S000001856])

HSP 1 Score: 182.956 bits (463), Expect = 2.667e-57
Identity = 91/205 (44.39%), Postives = 135/205 (65.85%), Query Frame = 2
Query:  287 FDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMM-----ESIEGEPYLANGGVKGKKLHQASETDGQGC 886
            +DY+FKLLLIGNS VGK+  L R++D+++++ +++T+G+DFK+KTV    K VKLQIWDTAGQER+RTIT++YYRG+ G I++YDVT++ESFN V  W+ +I  Y+      +LVGNKCDL+D +V+     ++ AD   + F E+SA ++ NV+  F  +   I E M      E+ + +    N  +KG+ L       G GC
Sbjct:    5 YDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMSQQNLNETTQKKEDKGNVNLKGQSLTNT----GGGC 205          
BLAST of Ras-related protein Rab-3 vs. Ensembl Yeast
Match: YPT31 (Rab family GTPase; involved in the exocytic pathway; mediates intra-Golgi traffic or the budding of post-Golgi vesicles from the trans-Golgi; YPT31 has a paralog, YPT32, that arose from the whole genome duplication; localizes to the transitional and late Golgi [Source:SGD;Acc:S000000833])

HSP 1 Score: 145.206 bits (365), Expect = 1.761e-42
Identity = 69/178 (38.76%), Postives = 113/178 (63.48%), Query Frame = 2
Query:  260 MNKELSDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKM 793
            M+ E    ++D +FK++LIG+S VGK++ L R+  N F+    +T+G++F  +T+    KR+K QIWDTAGQERYR IT+AYYRGA+G +++YD++   S+   + W+ +++  + DN  V L+GNK DL   + +     +  A +  + F E+SA  + NV   FE L++ I +K+
Sbjct:    1 MSSEDYGYDYDLLFKIVLIGDSGVGKSNLLSRFTKNEFNMDSKSTIGVEFATRTLEIDGKRIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLSELRENADDNVAVGLIGNKSDLAHLRAVPTEESKTFAQENQLLFTETSALNSENVDKAFEELINTIYQKV 178          
BLAST of Ras-related protein Rab-3 vs. Ensembl Yeast
Match: YPT32 (Rab family GTPase involved in the exocytic pathway; mediates intra-Golgi traffic or the budding of post-Golgi vesicles from the trans-Golgi; protein abundance increases in response to DNA replication stress; YPT32 has a paralog, YPT31, that arose from the whole genome duplication [Source:SGD;Acc:S000003178])

HSP 1 Score: 140.198 bits (352), Expect = 1.617e-40
Identity = 65/171 (38.01%), Postives = 109/171 (63.74%), Query Frame = 2
Query:  260 MNKELSDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLV 772
            M+ E    ++DY+FK++LIG+S VGK++ L R+  + F+    +T+G++F  +T+   +K++K QIWDTAGQERYR IT+AYYRGA+G +++YD++   S+   + W+ +++  + DN  V L+GNK DL   + +     +  A +  + F E+SA  + NV   F  L+
Sbjct:    1 MSNEDYGYDYDYLFKIVLIGDSGVGKSNLLSRFTTDEFNIESKSTIGVEFATRTIEVENKKIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENADDNVAVGLIGNKSDLAHLRAVPTDEAKNFAMENQMLFTETSALNSDNVDKAFRELI 171          
BLAST of Ras-related protein Rab-3 vs. Ensembl Yeast
Match: YPT6 (Rab family GTPase; required for endosome-to-Golgii, intra-Golgi retrograde, and retrograde Golgi-to-ER transport; temporarily at the Golgi, dissociating into the cytosol on arrival of the late Golgi GTPase Ypt32p; Golgi-localized form is GTP bound, while cytosolic form is GDP-bound; required for delivery of Atg9p to the phagophore assembly site during autophagy under heat stress, with Ypt6p for starvation induced autophagy and for the CVT pathway; homolog of mammalian Rab6 [Source:SGD;Acc:S000004252])

HSP 1 Score: 137.887 bits (346), Expect = 1.112e-39
Identity = 75/205 (36.59%), Postives = 119/205 (58.05%), Query Frame = 2
Query:  299 FKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWD-NAQVVLVGNKCDLEDDKVISISRGQQLADQLGVE-FFESSAKENINVKIVFERLVDIICE-KMMESIEGEPYLANGGVKGKK----LHQASETDGQGCQC 892
            +K++ +G   VGKTS + R+  ++F   + AT+GIDF  KT++  DK ++LQ+WDTAGQER+R++  +Y R +   I++YD+T  +SF  +  WI  +K    D N  + +VGNK DL D++ IS   G++ A  LG + F E+S K   NVK +F+++   + E +  ES   +   AN   + K     +  A E +   CQC
Sbjct:   11 YKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDDKTIRLQLWDTAGQERFRSLIPSYIRDSRVAIIVYDITKRKSFEYIDKWIEDVKNERGDENVILCIVGNKSDLSDERQISTEEGEKKAKLLGAKIFMETSTKAGYNVKALFKKIAKSLPEFQNSESTPLDSENANSANQNKPGVIDISTAEEQEQSACQC 215          
BLAST of Ras-related protein Rab-3 vs. Ensembl Nematostella
Match: EDO34944 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMW8])

HSP 1 Score: 325.094 bits (832), Expect = 2.327e-112
Identity = 151/211 (71.56%), Postives = 182/211 (86.26%), Query Frame = 2
Query:  266 KELSDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIEGEPYLANGGVKG--KKLHQASETDGQGCQC 892
            K+ +DQNFDYMFKLL+IGNS+VGKTSFLFRYAD+SF+SAFV+TVGIDFKVKTVFR+DKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYD+TNEESF AV DW  Q+KTYSW NAQV+LVGNKCD+E+++V+S  RG+QLADQLG+EF+E+SAK+N NVK VFERLVDIIC+KM +S++ +P + +G   G  K   +  + +   C C
Sbjct:   11 KDAADQNFDYMFKLLIIGNSAVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRNDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFQAVQDWSTQVKTYSWANAQVILVGNKCDMEEERVVSYDRGKQLADQLGLEFYETSAKDNTNVKKVFERLVDIICDKMSQSLDTDPTIVSGQKPGTTKLTAERPKQNQDNCAC 221          
BLAST of Ras-related protein Rab-3 vs. Ensembl Nematostella
Match: EDO47471 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMA6])

HSP 1 Score: 204.527 bits (519), Expect = 2.760e-65
Identity = 90/207 (43.48%), Postives = 147/207 (71.01%), Query Frame = 2
Query:  272 LSDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIEGEPYLANGGVKGKKLHQASETDGQGCQC 892
            ++ +++DY+FKLLLIG+S VGKT  LFR++D++F++ F++T+GIDFK+KT+    K++KLQIWDTAGQER+ TITT+YYRGAMG +L+YD+T E++F+ +  W+  I+ ++ ++ + +++GNKCD++D +++S  RG+Q+A + G+ F E+SAK NIN++  F+ L   I +K +     EP           +H   + D +G  C
Sbjct:    1 MAKKSYDYLFKLLLIGDSGVGKTCILFRFSDDAFNTTFISTIGIDFKIKTIEMQGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITQEKTFDNISKWLRNIEEHANEDVEKMILGNKCDMDDRRIVSRERGEQIAREHGIRFLETSAKTNINIEQAFQYLAQDILKKELNKDSEEP--------SNNIHVHDQKDKKGGCC 199          
BLAST of Ras-related protein Rab-3 vs. Ensembl Nematostella
Match: EDO41018 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5I6])

HSP 1 Score: 204.527 bits (519), Expect = 3.891e-65
Identity = 93/187 (49.73%), Postives = 141/187 (75.40%), Query Frame = 2
Query:  281 QNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIEGEPYLANGGVK 841
            + +D++FKLLLIG+S VGKT  LFR+++++F+S F++T+GIDFK++T+    K++KLQIWDTAGQER+RTITTAYYRGAMG +L+YD+TN++SF  + +WI  I+ ++  + + +++GNKCD+ED + +S  RG+QLA + G++F E+SAK +INV+  F  L   I  KM + +E     + G VK
Sbjct:    3 KTYDFLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNDKSFENIKNWIRNIEEHASQDVEKMVLGNKCDMEDRRQVSKERGEQLAVEYGIKFMETSAKASINVEEAFFTLARDIKLKMDKKLENSNPASTGAVK 189          
BLAST of Ras-related protein Rab-3 vs. Ensembl Nematostella
Match: EDO40845 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5Z2])

HSP 1 Score: 201.83 bits (512), Expect = 1.804e-64
Identity = 92/183 (50.27%), Postives = 138/183 (75.41%), Query Frame = 2
Query:  272 LSDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVK----IVFERLVDIICEKMMESIE 808
            ++++  D  FKLLLIG+S VGKT  +FR+ADN+F+ +F++T+GIDFK+KT+    K++KLQIWDTAGQER+ TITTAYYRGAMG +L+YDVTNE+SF+ +  W+ +I  ++ ++ + +LVGNKCD+ D +VIS ++G+QLA   G+ F E+SA  NINV+    ++ E +++ +C   +E  E
Sbjct:    1 MANKKSDLFFKLLLIGDSGVGKTCIIFRFADNTFNPSFISTIGIDFKIKTLELGGKKIKLQIWDTAGQERFHTITTAYYRGAMGIMLVYDVTNEKSFSNISKWLKKIDDHANEDVKRMLVGNKCDMYDKRVISQTKGEQLASSYGISFIETSALSNINVEKSFVVLTEDILNAVCPPTVEETE 183          
BLAST of Ras-related protein Rab-3 vs. Ensembl Nematostella
Match: EDO40167 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S806])

HSP 1 Score: 192.2 bits (487), Expect = 1.954e-60
Identity = 94/209 (44.98%), Postives = 135/209 (64.59%), Query Frame = 2
Query:  260 MNKELSDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIEGEPYLANGGVKGKKLHQASETDGQGC 886
            MN E     +DY+FKLLLIG+S VGK+  L R+AD++++ ++++T+G+DFK++T+    K +KLQIWDTAGQER+RTIT++YYRGA G I++YDVT++ESFN V  W+ +I  Y+ +N   +LVGNKCDL   KV+  +  ++ A+ LGV F E+SAK   NV+  F  +   I  +M  S    P  A   VK        +  G  C
Sbjct:    4 MNPE-----YDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYACENVNKLLVGNKCDLTTKKVVDFTTAKEYAESLGVPFLETSAKNATNVEQAFMTMAAEIKNRMGPS--PAPQGAGSNVKINSSTPVKQGGGGCC 205          
BLAST of Ras-related protein Rab-3 vs. Ensembl Medaka
Match: rab3ab (RAB3A, member RAS oncogene family [Source:NCBI gene;Acc:101167944])

HSP 1 Score: 330.102 bits (845), Expect = 7.154e-114
Identity = 152/209 (72.73%), Postives = 178/209 (85.17%), Query Frame = 2
Query:  266 KELSDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIEGEPYLANGGVKGKKLHQASETDGQGCQC 892
            KE SDQNFDYMFK+L+IGNSSVGKTSFLFRYAD+SF+ AFV+TVGIDFKVKT++R+DKR+KLQIWDTAGQERYRTITTAYYRGAMGFILMYD+TNE+SFNAV DW  QIKTYSWDNAQV+LVGNKCD+ED++V+S  RG+QL++ LG EFFE+SAK+NINVK  FERLVDIICEKM ES++       G  +G +L +      Q C C
Sbjct:   11 KESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEDSFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSADRGRQLSEHLGFEFFEASAKDNINVKQTFERLVDIICEKMSESLDAGDPAVTGAKQGPQLTEQPAPPHQDCAC 219          
BLAST of Ras-related protein Rab-3 vs. Ensembl Medaka
Match: rab3ab (RAB3A, member RAS oncogene family [Source:NCBI gene;Acc:101167944])

HSP 1 Score: 330.102 bits (845), Expect = 7.154e-114
Identity = 152/209 (72.73%), Postives = 178/209 (85.17%), Query Frame = 2
Query:  266 KELSDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIEGEPYLANGGVKGKKLHQASETDGQGCQC 892
            KE SDQNFDYMFK+L+IGNSSVGKTSFLFRYAD+SF+ AFV+TVGIDFKVKT++R+DKR+KLQIWDTAGQERYRTITTAYYRGAMGFILMYD+TNE+SFNAV DW  QIKTYSWDNAQV+LVGNKCD+ED++V+S  RG+QL++ LG EFFE+SAK+NINVK  FERLVDIICEKM ES++       G  +G +L +      Q C C
Sbjct:   11 KESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEDSFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSADRGRQLSEHLGFEFFEASAKDNINVKQTFERLVDIICEKMSESLDAGDPAVTGAKQGPQLTEQPAPPHQDCAC 219          
BLAST of Ras-related protein Rab-3 vs. Ensembl Medaka
Match: rab3c (RAB3C, member RAS oncogene family [Source:NCBI gene;Acc:101166306])

HSP 1 Score: 326.635 bits (836), Expect = 1.682e-112
Identity = 151/212 (71.23%), Postives = 177/212 (83.49%), Query Frame = 2
Query:  257 KMNKELSDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIEGEPYLANGGVKGKKLHQASETDGQGCQC 892
            K   E  DQNFDYMFKLL+IGNSSVGKTSFLFRYAD++F+SAFV+TVGIDFKVKTV+++DKR+KLQIWDTAGQERYRTITTAYYRGAMGFILMYD+TNEESF AV DW  QIKTYSWDNAQVVL GNKCD+E+++V+S+  G+ LA+QLG EFFE+SAK+NINVK  FERLVD+IC+KM ES++ +P +  G    K    A     QGC C
Sbjct:    8 KGKGEGGDQNFDYMFKLLIIGNSSVGKTSFLFRYADDAFTSAFVSTVGIDFKVKTVYKNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFGAVQDWSTQIKTYSWDNAQVVLAGNKCDMEEERVVSVESGRLLAEQLGFEFFETSAKDNINVKQTFERLVDLICDKMSESLDTDPAVTTGAPTAKLTDSAPPLQQQGCNC 219          
BLAST of Ras-related protein Rab-3 vs. Ensembl Medaka
Match: rab3c (RAB3C, member RAS oncogene family [Source:NCBI gene;Acc:101166306])

HSP 1 Score: 326.635 bits (836), Expect = 1.988e-112
Identity = 151/212 (71.23%), Postives = 177/212 (83.49%), Query Frame = 2
Query:  257 KMNKELSDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIEGEPYLANGGVKGKKLHQASETDGQGCQC 892
            K   E  DQNFDYMFKLL+IGNSSVGKTSFLFRYAD++F+SAFV+TVGIDFKVKTV+++DKR+KLQIWDTAGQERYRTITTAYYRGAMGFILMYD+TNEESF AV DW  QIKTYSWDNAQVVL GNKCD+E+++V+S+  G+ LA+QLG EFFE+SAK+NINVK  FERLVD+IC+KM ES++ +P +  G    K    A     QGC C
Sbjct:   15 KGKGEGGDQNFDYMFKLLIIGNSSVGKTSFLFRYADDAFTSAFVSTVGIDFKVKTVYKNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFGAVQDWSTQIKTYSWDNAQVVLAGNKCDMEEERVVSVESGRLLAEQLGFEFFETSAKDNINVKQTFERLVDLICDKMSESLDTDPAVTTGAPTAKLTDSAPPLQQQGCNC 226          
BLAST of Ras-related protein Rab-3 vs. Ensembl Medaka
Match: rab3c (RAB3C, member RAS oncogene family [Source:NCBI gene;Acc:101166306])

HSP 1 Score: 326.25 bits (835), Expect = 2.523e-112
Identity = 151/212 (71.23%), Postives = 177/212 (83.49%), Query Frame = 2
Query:  257 KMNKELSDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIEGEPYLANGGVKGKKLHQASETDGQGCQC 892
            K   E  DQNFDYMFKLL+IGNSSVGKTSFLFRYAD++F+SAFV+TVGIDFKVKTV+++DKR+KLQIWDTAGQERYRTITTAYYRGAMGFILMYD+TNEESF AV DW  QIKTYSWDNAQVVL GNKCD+E+++V+S+  G+ LA+QLG EFFE+SAK+NINVK  FERLVD+IC+KM ES++ +P +  G    K    A     QGC C
Sbjct:   14 KGKGEGGDQNFDYMFKLLIIGNSSVGKTSFLFRYADDAFTSAFVSTVGIDFKVKTVYKNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFGAVQDWSTQIKTYSWDNAQVVLAGNKCDMEEERVVSVESGRLLAEQLGFEFFETSAKDNINVKQTFERLVDLICDKMSESLDTDPAVTTGAPTAKLTDSAPPLQQQGCNC 225          
BLAST of Ras-related protein Rab-3 vs. Planmine SMEST
Match: SMESG000037789.1 (SMESG000037789.1)

HSP 1 Score: 439.113 bits (1128), Expect = 3.188e-157
Identity = 211/211 (100.00%), Postives = 211/211 (100.00%), Query Frame = 2
Query:  260 MNKELSDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIEGEPYLANGGVKGKKLHQASETDGQGCQC 892
            MNKELSDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIEGEPYLANGGVKGKKLHQASETDGQGCQC
Sbjct:    1 MNKELSDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIEGEPYLANGGVKGKKLHQASETDGQGCQC 211          
BLAST of Ras-related protein Rab-3 vs. Planmine SMEST
Match: SMESG000034019.1 (SMESG000034019.1)

HSP 1 Score: 332.028 bits (850), Expect = 7.002e-115
Identity = 160/213 (75.12%), Postives = 185/213 (86.85%), Query Frame = 2
Query:  263 NKELSDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIEGEPYLANGGVKGKKLHQASETD---GQGCQC 892
            N + +DQNFDYMFKLL+IGNSSVGKTSFLFRYAD+SF+SAFV+TVGIDFKVKT+ R DK+VKLQIWDTAGQERYRTITTAYYRGAMGFILMYD+TNEESFNAV DW+ QIKTYSWDNAQVVLVGNK DL+ ++VISI RG+QLA QLG+EFFE+SAKEN++VK VFERLVDIIC+KM ES++ +P + N   KG +L  A ET+      CQC
Sbjct:    4 NSKDTDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVRRDKKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSWDNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESLDTDPSIVNNPNKGTRL--ADETNKALPNDCQC 214          
BLAST of Ras-related protein Rab-3 vs. Planmine SMEST
Match: SMESG000055715.1 (SMESG000055715.1)

HSP 1 Score: 315.849 bits (808), Expect = 8.832e-109
Identity = 149/199 (74.87%), Postives = 171/199 (85.93%), Query Frame = 2
Query:  296 MFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIEGEPYLANGGVKGKKLHQASETDGQGCQC 892
            MFKLLLIGNSSVGKTSFLFRYADNSF+SAFVATVGIDFKVKTVFR DKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYD+TNE++FN V DW+ QIKTYSWDNAQ++LVGNKCDLE+++ +S  R +QLAD L ++FFE+SAKENINVK VFERLVD+IC+KM E I+  P L NG +  K +H+  +T    C C
Sbjct:    1 MFKLLLIGNSSVGKTSFLFRYADNSFTSAFVATVGIDFKVKTVFRQDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEDTFNCVQDWVTQIKTYSWDNAQIILVGNKCDLEENRAVSTERAKQLADYLNLDFFETSAKENINVKAVFERLVDVICDKMAECIDSSPALVNGHLL-KSMHE-DDTSESRCFC 197          
BLAST of Ras-related protein Rab-3 vs. Planmine SMEST
Match: SMESG000035214.1 (SMESG000035214.1)

HSP 1 Score: 192.2 bits (487), Expect = 5.811e-60
Identity = 91/206 (44.17%), Postives = 140/206 (67.96%), Query Frame = 2
Query:  272 LSDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKMMESIEGEPYLANGGVKGKKLHQASETDGQGCQ 889
            ++ +++D +FKLLLIG+S VGKT  LFRYAD++FS+ F++T+GIDFK+KT+  + KR+KLQIWDTAGQER+ TIT +YYRGAMG +L+YDVTN++SF+ +  W+  I++++ ++ + ++V NK D+E+ +V++   G+ +A    V F E SAK  +NV   FE+L   I  K+  + E     +    +G  L   S  D  G +
Sbjct:    1 MAKKSYDLLFKLLLIGDSGVGKTCLLFRYADDTFSTTFISTIGIDFKIKTIEMNGKRIKLQIWDTAGQERFHTITMSYYRGAMGIMLVYDVTNKKSFDNISKWLTNIQSHASESVEKLIVANKIDMEEKRVVTKDIGENIAVANKVSFLEVSAKTGVNVPQAFEKLTMAILAKVPNTKESAE--SQQTERGHHLSPHSTNDSSGSK 204          
BLAST of Ras-related protein Rab-3 vs. Planmine SMEST
Match: SMESG000026178.1 (SMESG000026178.1)

HSP 1 Score: 189.504 bits (480), Expect = 4.218e-59
Identity = 87/169 (51.48%), Postives = 128/169 (75.74%), Query Frame = 2
Query:  287 FDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEESFNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGVEFFESSAKENINVKIVFERLVDIICEKM 793
            +D++FKLLLIG+S VGKTS LFR+++++F++ F+AT+GIDFK++T+  + K++KLQIWDTAGQER+RTITTAYYRGAMG +L+YDVT+E+SFN ++ WI  I  ++  + + +L+GNK D+ D + +    G++LA   G++F E+SAK   NV   F +L   I  KM
Sbjct:    5 YDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKM 173          
The following BLAST results are available for this feature:
BLAST of Ras-related protein Rab-3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RAB3A3.095e-11473.68RAB3A, member RAS oncogene family [Source:HGNC Sym... [more]
RAB3C5.249e-11473.68RAB3C, member RAS oncogene family [Source:HGNC Sym... [more]
RAB3B6.194e-11171.29RAB3B, member RAS oncogene family [Source:HGNC Sym... [more]
RAB3D3.763e-10980.66RAB3D, member RAS oncogene family [Source:HGNC Sym... [more]
RAB3D3.763e-10980.66RAB3D, member RAS oncogene family [Source:HGNC Sym... [more]
back to top
BLAST of Ras-related protein Rab-3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab-32.985e-11274.52Ras-related protein Rab-3 [Source:UniProtKB/Swiss... [more]
rab-35.123e-11274.52Ras-related protein Rab-3 [Source:UniProtKB/Swiss... [more]
rab-84.203e-6453.22RAB family; Rab8 [Source:UniProtKB/TrEMBL;Acc:G5E... [more]
rab-84.203e-6453.22RAB family; Rab8 [Source:UniProtKB/TrEMBL;Acc:G5E... [more]
rab-101.637e-6046.93Ras-related protein Rab-10 [Source:UniProtKB/Swis... [more]
back to top
BLAST of Ras-related protein Rab-3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rab31.043e-12377.67gene:FBgn0005586 transcript:FBtr0473383[more]
Rab31.043e-12377.67gene:FBgn0005586 transcript:FBtr0088257[more]
Rab81.070e-6248.00gene:FBgn0262518 transcript:FBtr0308833[more]
Rab81.070e-6248.00gene:FBgn0262518 transcript:FBtr0074921[more]
Rab101.499e-6249.71gene:FBgn0015789 transcript:FBtr0077337[more]
back to top
BLAST of Ras-related protein Rab-3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab3da3.826e-11370.40RAB3D, member RAS oncogene family, a [Source:ZFIN;... [more]
rab3ab1.197e-11271.77RAB3A, member RAS oncogene family, b [Source:ZFIN;... [more]
rab3c1.249e-11168.22RAB3C, member RAS oncogene family [Source:ZFIN;Acc... [more]
rab3c1.249e-11168.22RAB3C, member RAS oncogene family [Source:ZFIN;Acc... [more]
rab3c2.330e-11167.91RAB3C, member RAS oncogene family [Source:ZFIN;Acc... [more]
back to top
BLAST of Ras-related protein Rab-3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab3a4.391e-11473.68RAB3A, member RAS oncogene family [Source:NCBI gen... [more]
RAB3C2.904e-11082.87RAB3C, member RAS oncogene family [Source:NCBI gen... [more]
RAB3C4.473e-11082.87RAB3C, member RAS oncogene family [Source:NCBI gen... [more]
tekt16.958e-11072.25tektin 1 [Source:Xenbase;Acc:XB-GENE-5929242][more]
rab3b4.613e-10971.77RAB3B, member RAS oncogene family [Source:NCBI gen... [more]
back to top
BLAST of Ras-related protein Rab-3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rab3a1.258e-11473.68Ras-related protein Rab-3A [Source:UniProtKB/Swis... [more]
Rab3a1.258e-11473.68Ras-related protein Rab-3A [Source:UniProtKB/Swis... [more]
Rab3a1.258e-11473.68RAB3A, member RAS oncogene family [Source:MGI Symb... [more]
Rab3a1.258e-11473.68RAB3A, member RAS oncogene family [Source:MGI Symb... [more]
Rab3a1.258e-11473.68RAB3A, member RAS oncogene family [Source:MGI Symb... [more]
back to top
BLAST of Ras-related protein Rab-3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P25228|RAB3_DROME1.046e-12277.67Ras-related protein Rab-3 OS=Drosophila melanogast... [more]
sp|P63012|RAB3A_RAT8.796e-11473.68Ras-related protein Rab-3A OS=Rattus norvegicus OX... [more]
sp|Q06AU3|RAB3A_PIG8.796e-11473.68Ras-related protein Rab-3A OS=Sus scrofa OX=9823 G... [more]
sp|P63011|RAB3A_MOUSE8.796e-11473.68Ras-related protein Rab-3A OS=Mus musculus OX=1009... [more]
sp|P11023|RAB3A_BOVIN9.290e-11473.68Ras-related protein Rab-3A OS=Bos taurus OX=9913 G... [more]
back to top
BLAST of Ras-related protein Rab-3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210Q0349.180e-12378.14Ras-related protein Rab-3 OS=Mizuhopecten yessoens... [more]
J7FIS01.393e-12278.14Rab3 OS=Ruditapes philippinarum OX=129788 PE=2 SV=... [more]
K1R8523.608e-12278.14Ras-related protein Rab-3 OS=Crassostrea gigas OX=... [more]
A0A0L8G4F21.385e-12177.67Uncharacterized protein OS=Octopus bimaculoides OX... [more]
Q6BCV21.549e-12178.14Rab3 OS=Doryteuthis pealeii OX=1051067 GN=rab3 PE=... [more]
back to top
BLAST of Ras-related protein Rab-3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab3aa8.144e-11572.73ras-related protein Rab-3A-like [Source:NCBI gene;... [more]
rab3aa8.474e-11572.73ras-related protein Rab-3A-like [Source:NCBI gene;... [more]
pld61.094e-11469.68GTP-binding protein Rab-3D-like [Source:NCBI gene;... [more]
rab3ab2.037e-11372.25RAB3A, member RAS oncogene family [Source:NCBI gen... [more]
rab3ab2.037e-11372.25RAB3A, member RAS oncogene family [Source:NCBI gen... [more]
back to top
BLAST of Ras-related protein Rab-3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab3c4.030e-11069.33RAB3C, member RAS oncogene family [Source:ZFIN;Acc... [more]
rab8a1.746e-6346.04RAB8A, member RAS oncogene family [Source:ZFIN;Acc... [more]
rab1aa1.580e-5944.50RAB1A, member RAS oncogene family a [Source:ZFIN;A... [more]
rab8a1.066e-5547.62RAB8A, member RAS oncogene family [Source:ZFIN;Acc... [more]
rab27a1.555e-4736.99RAB27A, member RAS oncogene family [Source:ZFIN;Ac... [more]
back to top
BLAST of Ras-related protein Rab-3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
SEC43.470e-5850.88Rab family GTPase; essential for vesicle-mediated ... [more]
YPT12.667e-5744.39Rab family GTPase; involved in the ER-to-Golgi ste... [more]
YPT311.761e-4238.76Rab family GTPase; involved in the exocytic pathwa... [more]
YPT321.617e-4038.01Rab family GTPase involved in the exocytic pathway... [more]
YPT61.112e-3936.59Rab family GTPase; required for endosome-to-Golgii... [more]
back to top
BLAST of Ras-related protein Rab-3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO349442.327e-11271.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO474712.760e-6543.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO410183.891e-6549.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO408451.804e-6450.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO401671.954e-6044.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ras-related protein Rab-3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab3ab7.154e-11472.73RAB3A, member RAS oncogene family [Source:NCBI gen... [more]
rab3ab7.154e-11472.73RAB3A, member RAS oncogene family [Source:NCBI gen... [more]
rab3c1.682e-11271.23RAB3C, member RAS oncogene family [Source:NCBI gen... [more]
rab3c1.988e-11271.23RAB3C, member RAS oncogene family [Source:NCBI gen... [more]
rab3c2.523e-11271.23RAB3C, member RAS oncogene family [Source:NCBI gen... [more]
back to top
BLAST of Ras-related protein Rab-3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000037789.13.188e-157100.00SMESG000037789.1[more]
SMESG000034019.17.002e-11575.12SMESG000034019.1[more]
SMESG000055715.18.832e-10974.87SMESG000055715.1[more]
SMESG000035214.15.811e-6044.17SMESG000035214.1[more]
SMESG000026178.14.218e-5951.48SMESG000026178.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032068 ID=SMED30032068|Name=Ras-related protein Rab-3|organism=Schmidtea mediterranea sexual|type=transcript|length=1022bp
CATTGTTGAAGGGCACACACACACAATTACACACTCAATAAAACAAAGGC
TGCCATGATAATACACACAATCAATCAATTGTGTGCTGGGTGGAATTTGA
TTGGTCGAAAATTATTTTAGAAATCGTTACCAAAAAACTTGTTTTTCTGA
ATATTTTGCATTGTACATATAATTAAAAATAAAACTCAATATTCATTCAG
TTGAATTGAGCGGATTTGGAAATTTTACCTCGATAAATCCTCAGAGAAAC
GAAAACAAAATGAACAAAGAATTGTCGGATCAGAATTTTGATTACATGTT
TAAATTATTGCTCATTGGCAATTCTTCAGTTGGTAAAACCTCATTTCTCT
TTCGGTATGCGGACAACAGTTTTTCATCGGCATTTGTTGCGACAGTCGGA
ATTGATTTCAAAGTGAAAACGGTTTTCAGACACGACAAGCGAGTTAAACT
TCAGATTTGGGACACTGCAGGCCAGGAAAGATATAGAACAATAACTACTG
CTTATTATAGAGGTGCAATGGGCTTTATTCTCATGTATGATGTTACAAAT
GAAGAATCTTTCAATGCCGTACATGATTGGATAATGCAAATCAAAACTTA
TTCATGGGACAATGCCCAAGTTGTACTAGTTGGCAATAAATGTGATTTAG
AAGACGATAAAGTCATCTCAATAAGCAGAGGCCAGCAATTAGCCGACCAA
TTAGGTGTTGAATTTTTTGAGTCTTCAGCCAAAGAGAATATCAATGTTAA
AATTGTTTTTGAAAGATTAGTGGACATAATCTGCGAGAAAATGATGGAAA
GTATAGAAGGTGAGCCTTATTTAGCAAATGGAGGAGTCAAAGGGAAAAAG
CTTCACCAAGCCTCAGAAACTGATGGCCAAGGATGCCAGTGCTGAAGAAA
ATCATCCAAAATTGACTCATTTTGAAATTCCATTTGCAGATTTTATTATA
AAATGTAATTAATGTTTAAAATATTTCAGATATTTGGTTTTAAATATATT
TTAATTTCTTTTTCTGAAAAAA
back to top

protein sequence of SMED30032068-orf-1

>SMED30032068-orf-1 ID=SMED30032068-orf-1|Name=SMED30032068-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=212bp
MNKELSDQNFDYMFKLLLIGNSSVGKTSFLFRYADNSFSSAFVATVGIDF
KVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEES
FNAVHDWIMQIKTYSWDNAQVVLVGNKCDLEDDKVISISRGQQLADQLGV
EFFESSAKENINVKIVFERLVDIICEKMMESIEGEPYLANGGVKGKKLHQ
ASETDGQGCQC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR005225Small_GTP-bd_dom
IPR001806Small_GTPase
IPR027417P-loop_NTPase
Vocabulary: biological process
TermDefinition
GO:0007264small GTPase mediated signal transduction
GO:0006810transport
GO:0006887exocytosis
GO:0007269neurotransmitter secretion
GO:0015031protein transport
GO:0016192vesicle-mediated transport
GO:0031630regulation of synaptic vesicle fusion to presynaptic active zone membrane
GO:0032482Rab protein signal transduction
GO:0048172regulation of short-term neuronal synaptic plasticity
GO:0048789cytoskeletal matrix organization at active zone
GO:0048790maintenance of presynaptic active zone structure
Vocabulary: molecular function
TermDefinition
GO:0005525GTP binding
GO:0000166nucleotide binding
GO:0003924GTPase activity
Vocabulary: cellular component
TermDefinition
GO:0008021synaptic vesicle
GO:0030054cell junction
GO:0031410cytoplasmic vesicle
GO:0031982vesicle
GO:0045202synapse
GO:0048786presynaptic active zone
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00449RASTRNSFRMNGcoord: 14..35
score: 44.38
coord: 55..77
score: 52.88
coord: 117..130
score: 54.13
coord: 37..53
score: 29.8
coord: 152..174
score: 40.25
NoneNo IPR availableSMARTSM00173ras_sub_4coord: 14..177
e-value: 4.5E-28
score: 109.3
NoneNo IPR availableSMARTSM00174rho_sub_3coord: 16..177
e-value: 8.2E-14
score: 56.6
NoneNo IPR availableSMARTSM00175rab_sub_5coord: 14..177
e-value: 5.5E-90
score: 314.9
NoneNo IPR availableSMARTSM00176ran_sub_2coord: 19..211
e-value: 2.4E-5
score: 26.6
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 1..180
e-value: 1.9E-64
score: 218.4
NoneNo IPR availablePANTHERPTHR24073FAMILY NOT NAMEDcoord: 3..195
NoneNo IPR availablePANTHERPTHR24073:SF853RAS-RELATED PROTEIN RAB-3coord: 3..195
NoneNo IPR availablePROSITEPS51419RABcoord: 9..211
score: 34.118
IPR005225Small GTP-binding protein domainTIGRFAMTIGR00231TIGR00231coord: 12..168
e-value: 2.5E-25
score: 87.1
IPR001806Small GTPasePFAMPF00071Rascoord: 15..174
e-value: 5.7E-60
score: 201.6
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 9..188