TRAF-4

Overview
NameTRAF-4
Smed IDSMED30032067
Length (bp)1416
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TRAF-4 (SMED30032067) t-SNE clustered cells

Violin plots show distribution of expression levels for TRAF-4 (SMED30032067) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TRAF-4 (SMED30032067) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TRAF-4 (SMED30032067) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032067

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30032067SMESG000044336.1 Contig1407GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30032067SMESG000044336.1 Contig1407GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30032067SMESG000044336.1 Contig1407GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30032067SMESG000015063.1 Contig1407GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30032067SMESG000015063.1 Contig1407GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30032067SMESG000015063.1 Contig1407GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
parenchymal cellSMED30032067SMESG000015063.1 SMESG000013769.1 SMESG000077491.1 SMESG000022744.1 dd_Smed_v4_2391_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TRAF-4 vs. Ensembl Human
Match: TRAF6 (TNF receptor associated factor 6 [Source:HGNC Symbol;Acc:HGNC:12036])

HSP 1 Score: 53.1434 bits (126), Expect = 6.734e-7
Identity = 34/110 (30.91%), Postives = 52/110 (47.27%), Query Frame = 2
Query:   98 INQYDFKFDASRYSDLICGMCGKLLSEAMQSSCSCKFCRRCIEIHCENNSVTCPGLSELCKSTVLDLDEDVIVDHTTNKRISLLKVKCPFDQCPFEDKLIHMESHVKMCD 427
            I  YD +FD    S   C +C   L EA+Q+ C  +FC+ CI     +    CP  +E+       L+  +  D+   + I  L VKCP + C  + +L H+E H   C+
Sbjct:   53 IQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEIL------LENQLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCE 156          
BLAST of TRAF-4 vs. Ensembl Human
Match: TRAF6 (TNF receptor associated factor 6 [Source:HGNC Symbol;Acc:HGNC:12036])

HSP 1 Score: 53.1434 bits (126), Expect = 6.734e-7
Identity = 34/110 (30.91%), Postives = 52/110 (47.27%), Query Frame = 2
Query:   98 INQYDFKFDASRYSDLICGMCGKLLSEAMQSSCSCKFCRRCIEIHCENNSVTCPGLSELCKSTVLDLDEDVIVDHTTNKRISLLKVKCPFDQCPFEDKLIHMESHVKMCD 427
            I  YD +FD    S   C +C   L EA+Q+ C  +FC+ CI     +    CP  +E+       L+  +  D+   + I  L VKCP + C  + +L H+E H   C+
Sbjct:   53 IQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEIL------LENQLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCE 156          
BLAST of TRAF-4 vs. Ensembl Fly
Match: Traf6 (gene:FBgn0265464 transcript:FBtr0071188)

HSP 1 Score: 48.9062 bits (115), Expect = 7.310e-6
Identity = 34/153 (22.22%), Postives = 76/153 (49.67%), Query Frame = 2
Query:  665 DQIIENQKTLSVKFEENFNEKQSDQQSRMKTNSTGKRERIKKVPKSQNILGELLWKIDNFSATKKSLMFGDDRWLDSAEFCTSPSRYKMQLRMWIG--EPNV-DILIKMISNEDDKYIQWPIKVEVNIGLLNPENGNLKVNETKIIEYQTASF 1114
            +QI++      V  E+   E+++  ++ M+      R++    P+  N  G ++W+I+   A    L    +  + S E  TSP  YK   R+ I   +P+V  + + ++ +E+D ++ WP K  + + +++P +  L  ++T + + +  +F
Sbjct:  283 EQIVQTMYQRIVVLEQRTREQETRLEN-MQKQLRLARQQAPVDPRYSN--GTIVWRIEQLGALVARLRANANNQVYSHECYTSPHGYKFCARLNIQPRKPHVLSLHVHLMQSENDYHLDWPFKGRIKLCMVHPADATLSQHDTIMTKPEILAF 432          
BLAST of TRAF-4 vs. Ensembl Zebrafish
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 52.7582 bits (125), Expect = 5.890e-7
Identity = 38/177 (21.47%), Postives = 78/177 (44.07%), Query Frame = 2
Query:  719 NEKQSDQQSRMKTNSTGKRERIKKVPKSQNILGELLWKIDNFSATKKSLMFGDDRWLDSAEFCTSPSRYKMQLRMWIGEPN-------VDILIKMISNEDDKYIQWPIKVEVNIGLLNPENG--NLKVNETK---------IIEYQTASFTSKAYFHFHNSSVNKVVVKHDSLVVKC 1195
            N+ Q +Q + ++       E  +++ ++Q   G  +W+++NFS   ++   G    L S  F T    YK+ LR+ +  P+       + + +  +  E D  + WP++  + + +L+   G  +++V ETK          +      F    + H   +   +  VK D L+V+C
Sbjct:  344 NDTQKNQVTELRRKLVSLEESTREL-EAQQYQGIYVWRVENFSHHLRNQEAGQPIVLHSPPFYTGRPGYKLCLRLHLQTPSAPRCSNFISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQVEGQHHIEVMETKPDLQAFQRPTVMRNPKGFGYVTFLHL-QALRQRGFVKEDVLLVRC 518          
BLAST of TRAF-4 vs. Ensembl Zebrafish
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 52.7582 bits (125), Expect = 5.890e-7
Identity = 38/177 (21.47%), Postives = 78/177 (44.07%), Query Frame = 2
Query:  719 NEKQSDQQSRMKTNSTGKRERIKKVPKSQNILGELLWKIDNFSATKKSLMFGDDRWLDSAEFCTSPSRYKMQLRMWIGEPN-------VDILIKMISNEDDKYIQWPIKVEVNIGLLNPENG--NLKVNETK---------IIEYQTASFTSKAYFHFHNSSVNKVVVKHDSLVVKC 1195
            N+ Q +Q + ++       E  +++ ++Q   G  +W+++NFS   ++   G    L S  F T    YK+ LR+ +  P+       + + +  +  E D  + WP++  + + +L+   G  +++V ETK          +      F    + H   +   +  VK D L+V+C
Sbjct:  344 NDTQKNQVTELRRKLVSLEESTREL-EAQQYQGIYVWRVENFSHHLRNQEAGQPIVLHSPPFYTGRPGYKLCLRLHLQTPSAPRCSNFISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQVEGQHHIEVMETKPDLQAFQRPTVMRNPKGFGYVTFLHL-QALRQRGFVKEDVLLVRC 518          
BLAST of TRAF-4 vs. Ensembl Zebrafish
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 52.7582 bits (125), Expect = 5.890e-7
Identity = 38/177 (21.47%), Postives = 78/177 (44.07%), Query Frame = 2
Query:  719 NEKQSDQQSRMKTNSTGKRERIKKVPKSQNILGELLWKIDNFSATKKSLMFGDDRWLDSAEFCTSPSRYKMQLRMWIGEPN-------VDILIKMISNEDDKYIQWPIKVEVNIGLLNPENG--NLKVNETK---------IIEYQTASFTSKAYFHFHNSSVNKVVVKHDSLVVKC 1195
            N+ Q +Q + ++       E  +++ ++Q   G  +W+++NFS   ++   G    L S  F T    YK+ LR+ +  P+       + + +  +  E D  + WP++  + + +L+   G  +++V ETK          +      F    + H   +   +  VK D L+V+C
Sbjct:  344 NDTQKNQVTELRRKLVSLEESTREL-EAQQYQGIYVWRVENFSHHLRNQEAGQPIVLHSPPFYTGRPGYKLCLRLHLQTPSAPRCSNFISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQVEGQHHIEVMETKPDLQAFQRPTVMRNPKGFGYVTFLHL-QALRQRGFVKEDVLLVRC 518          
BLAST of TRAF-4 vs. Ensembl Xenopus
Match: egf (epidermal growth factor [Source:Xenbase;Acc:XB-GENE-951823])

HSP 1 Score: 52.7582 bits (125), Expect = 8.380e-7
Identity = 33/110 (30.00%), Postives = 51/110 (46.36%), Query Frame = 2
Query:   98 INQYDFKFDASRYSDLICGMCGKLLSEAMQSSCSCKFCRRCIEIHCENNSVTCPGLSELCKSTVLDLDEDVIVDHTTNKRISLLKVKCPFDQCPFEDKLIHMESHVKMCD 427
            +  YD +FD    S   C +C   L EA+Q+ C  +FC+ CI     +    CP  +E        ++  +  D+   + I  L+VKCP   C    +L H+E H+  CD
Sbjct:   55 VQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACILKSIRDAGHKCPVDNESL------MENQLFPDNFAKREILSLRVKCPSQGCTETMELRHLERHLVRCD 158          
BLAST of TRAF-4 vs. Ensembl Mouse
Match: Traf6 (TNF receptor-associated factor 6 [Source:MGI Symbol;Acc:MGI:108072])

HSP 1 Score: 51.6026 bits (122), Expect = 1.850e-6
Identity = 34/110 (30.91%), Postives = 51/110 (46.36%), Query Frame = 2
Query:   98 INQYDFKFDASRYSDLICGMCGKLLSEAMQSSCSCKFCRRCIEIHCENNSVTCPGLSELCKSTVLDLDEDVIVDHTTNKRISLLKVKCPFDQCPFEDKLIHMESHVKMCD 427
            I  YD +FD    S   C +C   L EA+Q+ C  +FC+ CI     +    CP  +E+       L+  +  D+   + I  L VKCP   C  + +L H+E H   C+
Sbjct:   53 IQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEIL------LENQLFPDNFAKREILSLTVKCPNKGCLQKMELRHLEDHQVHCE 156          
BLAST of TRAF-4 vs. UniProt/SwissProt
Match: sp|Q6DJN2|TRF6B_XENLA (TNF receptor-associated factor 6-B OS=Xenopus laevis OX=8355 GN=traf6-b PE=2 SV=1)

HSP 1 Score: 55.0694 bits (131), Expect = 9.808e-7
Identity = 33/109 (30.28%), Postives = 51/109 (46.79%), Query Frame = 2
Query:   98 INQYDFKFDASRYSDLICGMCGKLLSEAMQSSCSCKFCRRCIEIHCENNSVTCPGLSELCKSTVLDLDEDVIVDHTTNKRISLLKVKCPFDQCPFEDKLIHMESHVKMC 424
            +  YD +FD    S   C +C   L EA+Q+ C  +FC+ CI     +    CP  +E+       ++  +  D+   + I  LKVKCP   C    +L H+E H+  C
Sbjct:   55 VQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIVKSLRDAGHKCPVDNEIL------MENQLFPDNFAKREILSLKVKCPSQGCTETMELRHLERHLGQC 157          
BLAST of TRAF-4 vs. UniProt/SwissProt
Match: sp|Q3ZCC3|TRAF6_BOVIN (TNF receptor-associated factor 6 OS=Bos taurus OX=9913 GN=TRAF6 PE=2 SV=1)

HSP 1 Score: 53.5286 bits (127), Expect = 2.951e-6
Identity = 34/110 (30.91%), Postives = 52/110 (47.27%), Query Frame = 2
Query:   98 INQYDFKFDASRYSDLICGMCGKLLSEAMQSSCSCKFCRRCIEIHCENNSVTCPGLSELCKSTVLDLDEDVIVDHTTNKRISLLKVKCPFDQCPFEDKLIHMESHVKMCD 427
            I  YD +FD    S   C +C   L EA+Q+ C  +FC+ CI     +    CP  +E+       L+  +  D+   + I  L VKCP + C  + +L H+E H   C+
Sbjct:   54 IQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEIL------LENQLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEEHQAHCE 157          
BLAST of TRAF-4 vs. UniProt/SwissProt
Match: sp|Q3MV19|TRF6A_XENLA (TNF receptor-associated factor 6-A OS=Xenopus laevis OX=8355 GN=traf6-a PE=1 SV=1)

HSP 1 Score: 53.5286 bits (127), Expect = 3.020e-6
Identity = 34/109 (31.19%), Postives = 52/109 (47.71%), Query Frame = 2
Query:   98 INQYDFKFDASRYSDLICGMCGKLLSEAMQSSCSCKFCRRCIEIHCENNSVTCPGLSELCKSTVLDLDEDVIVDHTTNKRISLLKVKCPFDQCPFEDKLIHMESHVKMC 424
            I  YD +FD    S   C +C   L EA+Q+ C  +FC+ CI     N    CP  +E+       +++ +  D+   + I  L+VKCP   C    +L H+E H+  C
Sbjct:   55 IQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACILKSLRNAGHKCPVDNEIL------MEKQLFPDNFAKREILSLRVKCPNLGCTDTMELRHLEHHLVQC 157          
BLAST of TRAF-4 vs. UniProt/SwissProt
Match: sp|Q9Y4K3|TRAF6_HUMAN (TNF receptor-associated factor 6 OS=Homo sapiens OX=9606 GN=TRAF6 PE=1 SV=1)

HSP 1 Score: 53.1434 bits (126), Expect = 3.234e-6
Identity = 34/110 (30.91%), Postives = 52/110 (47.27%), Query Frame = 2
Query:   98 INQYDFKFDASRYSDLICGMCGKLLSEAMQSSCSCKFCRRCIEIHCENNSVTCPGLSELCKSTVLDLDEDVIVDHTTNKRISLLKVKCPFDQCPFEDKLIHMESHVKMCD 427
            I  YD +FD    S   C +C   L EA+Q+ C  +FC+ CI     +    CP  +E+       L+  +  D+   + I  L VKCP + C  + +L H+E H   C+
Sbjct:   53 IQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEIL------LENQLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCE 156          
BLAST of TRAF-4 vs. UniProt/SwissProt
Match: sp|B6CJY4|TRAF6_CERAT (TNF receptor-associated factor 6 OS=Cercocebus atys OX=9531 GN=TRAF6 PE=2 SV=1)

HSP 1 Score: 53.1434 bits (126), Expect = 3.529e-6
Identity = 34/110 (30.91%), Postives = 52/110 (47.27%), Query Frame = 2
Query:   98 INQYDFKFDASRYSDLICGMCGKLLSEAMQSSCSCKFCRRCIEIHCENNSVTCPGLSELCKSTVLDLDEDVIVDHTTNKRISLLKVKCPFDQCPFEDKLIHMESHVKMCD 427
            I  YD +FD    S   C +C   L EA+Q+ C  +FC+ CI     +    CP  +E+       L+  +  D+   + I  L VKCP + C  + +L H+E H   C+
Sbjct:   53 IQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEIL------LENQLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCE 156          
BLAST of TRAF-4 vs. TrEMBL
Match: I1ZID8 (TNF receptor associated factor-2 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 2.897e-14
Identity = 54/183 (29.51%), Postives = 99/183 (54.10%), Query Frame = 2
Query:   62 MSAERFESIWFLINQYDFKFDASRYSDLICGMCGKLLSEAMQSSCSCKFCRRCIEIHCENNSVTCPGLSELCKSTVLDLDEDVIVDHTTNKRISLLKVKCPFDQCPFEDKLIHMESHVKMCDKKPKS-----RQQSXXXXXXXXXXXXXXXXXVIHLKLLIESIDNLRNENKMLSNEIISLKE 595
            M+AE+   I  L+  Y+F+ +     +L C +C  LL  A QS C C+FC +CI  +    ++ CPG +  CK   L +  ++  D+  N++I+ ++VKCP + C    +L+ +E H+++C  K ++        ++  +   +L N +Q     H KL+I+ I N+RN+   L+ + + L+E
Sbjct:    1 MTAEK---INRLLITYNFEVEGGVPDNLKCDLCKNLLVNACQSRCGCRFCSKCIMEYVSRGNLYCPGGTSECKEENLTICSNIHTDYRVNRKIAKMRVKCPEETCKVYCELVDIEEHLRLCTMKSQNCPFFVLGCNQPKMVIQDLTNHLQNGTFQHSKLIIDIISNMRNDFFGLTTKEVELRE 180          
BLAST of TRAF-4 vs. TrEMBL
Match: T1E101 (TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 4.896e-14
Identity = 105/445 (23.60%), Postives = 194/445 (43.60%), Query Frame = 2
Query:   62 MSAERFESIWFLINQYDFK-FDASRYSDLICGMCGKLLSEAMQSSCSCKFCRRCIEIHCENNSVTCPGLSELCKSTVLDLDEDVIVDHTTNKRIS----------------LLKVKCPFDQCPFE-------------DKLIHMESHVKMCDKKPKSRQQ----SXXXXXXXXXXXXXXXXXVIHLKLLIES---------------IDNLRNENKML----------SNEIISL-----KETQKLSQISMEKFRKQIEKMNEKMDQI----IENQ-KTLSVK-FEENFNEKQSDQQSRMKTNSTGKRERIKKVPKSQNILGELLWKIDNFSATKKSLMFGDDRWLDSAEFCTSPSRYKMQLRMWIGEPNVDILIKMISNEDDKYIQWPIKVEVNIGLLNPENGNLKVNETKIIEYQTASFTSKAYFHFHNSSVNKVVVKHDSLV 1186
            M   + +++  L+++Y+ K  D S  +DL+C +C KL+ +A +S+C C +C  CI I+   N   CPG    CK   L+L+ DV  +   + RIS                LL++K   D+C  E             + L+  E    + D+  +  Q                NE    ++ HLK ++                 I+ LRN++ M+           NE+I+L      E +KL    ++ FR++IE M   ++ +    I+NQ K L  + F    N   ++++   K N+  +  ++       N+  + +W+I+ +S  ++++    D + DS +       YK  L ++I   N+ +   ++  E D +++WP++  V + ++  E  +LK ++T + +Y T     KA F       N   +  DSLV
Sbjct:    1 MIPSKLDNVQELLSKYNVKRVDESVNNDLLCILCNKLMRDACESACGCHYCYTCIRIYLSQNHNYCPGDKTECKEDYLNLEGDVFRNIRLSTRISRIVVKCPNIRCNYTSELLRLKEHLDKCTPESVECPCVTIGCEEEPLLKDEMAKHLTDQVLRHTQLIMSFCNELKSEINHNNETTKEDISHLKEVLRVQKALNDEKTAQMEFLIEELRNKDNMILVLSQDIQEVKNEMITLLTSKESELKKLKS-DIQIFRQEIEFMKNDLEVVGSTDIKNQVKDLKKEIFGIKMNIDSNNEERERKMNNLIRLNKL-----CPNVDMDFMWRIEEYSKKRRTVT---DVYSDSFQ----SHNYKFCLNLYIYGDNLGLWCVIMKGEKDDFLEWPMRRTVTLSII--EQDSLKTHKTTVFQYDTYQRNKKA-FDRPKDERNDYCIGTDSLV 429          
BLAST of TRAF-4 vs. TrEMBL
Match: E0VE99 (Uncharacterized protein OS=Pediculus humanus subsp. corporis OX=121224 GN=8234062 PE=4 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 4.873e-12
Identity = 92/384 (23.96%), Postives = 160/384 (41.67%), Query Frame = 2
Query:  149 CGMCGKLLSEAMQSSCSCKFCRRCIEIHCENNSVTCPGLSELCKSTVLDLDEDVIVDHTTNKRISLLKVKCPFDQCPFEDKLIHMESHVKM-------CDKK----------PKSRQQSXXXXXXXXXXXXXXXXXVIHLKLLIESIDNLRNENKMLSNEIISLKETQKLSQISMEKFRKQIEKMNEKMDQIIENQKTLSVKFE-----ENFNEKQSDQQSRMKTNSTGKRERIKKVPKSQNILGELLWKIDNFSATKKSLMFGDDRWLDSAEFCTSPSRYKMQLRMWIGEPNVD---ILIKMISNEDDKYIQWPIKVEVNIGLLNPENGNLKVNETKIIEYQTASF-------TSKAYFHFHNSSVNKVV----VKHDSLVVK 1192
            C +C   L E + +SC  +FC  C+ +  E+   +CP         +L+   D+  DH T + I      C    C  E  L  M+ HV           KK          P      ++++    L + ++ +  +HL L+  S  NLR +          LK T K+S   + +     E   +  D+  +N   +   +E     E    +Q+ Q  ++K       +RI++V   ++  G+ LW+ID+F     S+  GD R   S  F TSP+ YK+  R+ +   + D   +LI ++    D  + WP    +   +++P +  L + ET +      SF        +KA+ +    S+NK+     +  DSL+VK
Sbjct:   19 CPICLSCLKEPVLTSCGHRFCSSCLNLWLESKGESCP-----VDGGILNKKLDLFPDHFTRREILNRTTICKL--CKLEIGLSEMDEHVSSHHHHSSRASKKVSEDNGKGCCPFGTFGCDVDVTENTLKDHLEKDLNLHLNLVANSHLNLREK---------LLKNTDKMSDDVLAQESLMWEPQEKGKDR--QNASLMRALYERVVVLEQRCHEQNAQMEKLKGRLEESNDRIREV-SLRHACGQYLWRIDDFGKKIGSMKSGDKRVFFSEGFYTSPNGYKICGRINLSPVDSDMLSLLIHIMQTPHDHTLVWPFTGRIQFAIVHPTDSKLTIAETIMSRPDLDSFKKPARDINTKAFGYPQFISINKIFNNGYLIDDSLIVK 383          
BLAST of TRAF-4 vs. TrEMBL
Match: A0A0C9PK53 (Traf6_0 protein OS=Fopius arisanus OX=64838 GN=Traf6_1 PE=4 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 5.862e-12
Identity = 84/328 (25.61%), Postives = 148/328 (45.12%), Query Frame = 2
Query:  149 CGMCGKLLSEAMQSSCSCKFCRRCIEIHCENNSVTCPGLSELCKSTVLDLDEDVIVDHTTNKRISLLKVKCPFDQ--CPFEDKLIHMESHVKMCDKKPKSRQQSXXXXXXXXXXXXXXXXXVIHLKLLIESIDN--LRNENKMLSNEIISLKETQKLSQISM--------EKFRKQIEKMNEKMDQIIENQKTLSVKFEENFNEKQSDQQSRMKTNSTGKRERIKKVPKS--QNILGELLWKIDNFSATKKSLMFGDDRWLDSAEFCTSPSRYKMQLRMWIGEPNVD---ILIKMISNEDDKYIQWPIKVEVNIGLLNPENGNLKVNE 1081
            C +C   + + + +SC  +FC +C+    E  S +CP  S   K      + D+ +D  T + IS  K KCP+ Q  C  E   I M+SH+  C+ K  + +  ++  +   +       E   L+  +E   N  L    K +   IIS  E  K ++ S          + + Q EK    ++Q++++     V  E+  N +QS   S  KT     +  +        +N  G  +W+ID F+  K + M  +   L S EF T  + YK+  RM I + N+D   I++ ++ +E+D  + WP    ++  L++PE+ +  + E
Sbjct:   35 CPICLSCMRDPILTSCGHRFCSKCLHKWLEEKSNSCPVDSTPLKPE----NGDLFLDRYTKREISQYKTKCPYHQFGCDVELSPIDMDSHINDCEFKKNASRDDKIYCDFKYVGCTEAFEEREDLQRHLEVNHNIHLMMMGKTMEQMIISQSEVNKNARDSKLWDPPPKNNREQLQPEKSQSNVEQLLKDLYERIVVLEQQ-NREQSIIISNQKTTIMSIQNSLTHFGDESLRNCNGIYIWRIDGFTQ-KITEMMAESMMLYSDEFYTHKNGYKVCGRMNISKKNIDFLSIVLHLVPSENDDALDWPFIGVISFILVHPEDSDKSIRE 356          
BLAST of TRAF-4 vs. TrEMBL
Match: T1DBK6 (TRAF-4 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 1.799e-11
Identity = 38/98 (38.78%), Postives = 57/98 (58.16%), Query Frame = 2
Query:  140 DLICGMCGKLLSEAMQSSCSCKFCRRCIEIHCENNSVTCPGLSELCKSTVLDLDEDVIVDHTTNKRISLLKVKCPFDQCPFEDKLIHMESHVKMCDKK 433
            +L C MC  +L +A+Q+ C C++C+ CI+ + EN    C    E C+S +       I D  TNK ISLLKVKC ++ C FED L  ++ H+  C+ +
Sbjct:   28 NLKCVMCQDILLDAIQTDCGCRYCKECIDNYLENGEKECVAEYEDCRSVI----TSYIYDRATNKEISLLKVKCLYEGCVFEDTLKSIKGHLDFCEYR 121          
BLAST of TRAF-4 vs. Ensembl Cavefish
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:103021325])

HSP 1 Score: 55.8398 bits (133), Expect = 5.686e-8
Identity = 43/209 (20.57%), Postives = 95/209 (45.45%), Query Frame = 2
Query:  620 MEKFRKQIEKMNEKMDQIIENQKTLSVKFEENFNEKQSDQQSRMKTNSTGKRERIKKVPKSQNILGELLWKIDNFSATKKSLMFGDDRWLDSAEFCTSPSRYKMQLRMWIGEPN-------VDILIKMISNEDDKYIQWPIKVEVNIGLLNPENG--NLKVNETK----IIEYQTASFTSKAY----FHFHNSSVNKVVVKHDSLVVKC 1195
            +++ R+ + ++  ++ +     + LS++     NE QS Q + ++       E ++++ ++Q   G  +W+++ FS   ++   G    L S  F T    YK+ LR+ +  PN       + + +  +  E D  + WP++  + + +L+   G  +++V ETK      +  T     K +    F    +   +  V+ D L+V+C
Sbjct:  316 LQQMRETVLELESRLVRQDHKLRELSIR-----NETQSTQMTELRKKLASLEESMREL-QAQQYQGVYVWRLEGFSTHIRNQEAGHPVVLHSPPFYTGRPGYKLCLRLHLQTPNAPRCSNYISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQAEGQHHVEVMETKPDLQAFQRPTVQRNPKGFGYVTFMQLQALHQRGFVRDDVLMVRC 518          
BLAST of TRAF-4 vs. Ensembl Cavefish
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:103021325])

HSP 1 Score: 55.8398 bits (133), Expect = 5.686e-8
Identity = 43/209 (20.57%), Postives = 95/209 (45.45%), Query Frame = 2
Query:  620 MEKFRKQIEKMNEKMDQIIENQKTLSVKFEENFNEKQSDQQSRMKTNSTGKRERIKKVPKSQNILGELLWKIDNFSATKKSLMFGDDRWLDSAEFCTSPSRYKMQLRMWIGEPN-------VDILIKMISNEDDKYIQWPIKVEVNIGLLNPENG--NLKVNETK----IIEYQTASFTSKAY----FHFHNSSVNKVVVKHDSLVVKC 1195
            +++ R+ + ++  ++ +     + LS++     NE QS Q + ++       E ++++ ++Q   G  +W+++ FS   ++   G    L S  F T    YK+ LR+ +  PN       + + +  +  E D  + WP++  + + +L+   G  +++V ETK      +  T     K +    F    +   +  V+ D L+V+C
Sbjct:  316 LQQMRETVLELESRLVRQDHKLRELSIR-----NETQSTQMTELRKKLASLEESMREL-QAQQYQGVYVWRLEGFSTHIRNQEAGHPVVLHSPPFYTGRPGYKLCLRLHLQTPNAPRCSNYISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQAEGQHHVEVMETKPDLQAFQRPTVQRNPKGFGYVTFMQLQALHQRGFVRDDVLMVRC 518          
BLAST of TRAF-4 vs. Ensembl Cavefish
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:103021325])

HSP 1 Score: 55.4546 bits (132), Expect = 6.754e-8
Identity = 43/209 (20.57%), Postives = 95/209 (45.45%), Query Frame = 2
Query:  620 MEKFRKQIEKMNEKMDQIIENQKTLSVKFEENFNEKQSDQQSRMKTNSTGKRERIKKVPKSQNILGELLWKIDNFSATKKSLMFGDDRWLDSAEFCTSPSRYKMQLRMWIGEPN-------VDILIKMISNEDDKYIQWPIKVEVNIGLLNPENG--NLKVNETK----IIEYQTASFTSKAY----FHFHNSSVNKVVVKHDSLVVKC 1195
            +++ R+ + ++  ++ +     + LS++     NE QS Q + ++       E ++++ ++Q   G  +W+++ FS   ++   G    L S  F T    YK+ LR+ +  PN       + + +  +  E D  + WP++  + + +L+   G  +++V ETK      +  T     K +    F    +   +  V+ D L+V+C
Sbjct:  292 LQQMRETVLELESRLVRQDHKLRELSIR-----NETQSTQMTELRKKLASLEESMREL-QAQQYQGVYVWRLEGFSTHIRNQEAGHPVVLHSPPFYTGRPGYKLCLRLHLQTPNAPRCSNYISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQAEGQHHVEVMETKPDLQAFQRPTVQRNPKGFGYVTFMQLQALHQRGFVRDDVLMVRC 494          
BLAST of TRAF-4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002130.1 (pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 gene:ENSPMAG00000001936.1 transcript:ENSPMAT00000002130.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.5286 bits (127), Expect = 4.789e-8
Identity = 31/119 (26.05%), Postives = 55/119 (46.22%), Query Frame = 2
Query:  776 ERIKKVPKSQNILGELLWKIDNFSATKKSLMFGDDRWLDSAEFCTSPSRYKMQLRMWIGEPNVD------ILIKMISNEDDKYIQWPIKVEVNIGLLNPENGNLKVNETKIIEYQTASF 1114
            ER  +V ++    G+L+WKI +++  K+    G    L S  F TSP  YKM  R ++    V       +   ++  E D  ++WP +  V + LL+       +++T   +  + SF
Sbjct:  255 ERRLQVLETAGYSGKLVWKIRDYARRKQEAASGRTLSLYSQPFYTSPFGYKMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLEWPFRRRVTLSLLDQGAARRHLSDTFTPDPASGSF 373          
BLAST of TRAF-4 vs. Ensembl Nematostella
Match: EDO41243 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4Z7])

HSP 1 Score: 51.6026 bits (122), Expect = 4.202e-7
Identity = 33/108 (30.56%), Postives = 51/108 (47.22%), Query Frame = 2
Query:  107 YDFKFDASRYSDLICGMCGKLLSEAMQSSCSCKFCRRCIEIHCENNS-VTCPGLSELCKSTVLDLDEDVIVDHTTNKRISLLKVKCPFDQCPFEDKLIHMESHVKMCD 427
            YD +F  +   +  C +C   L   +Q+ C  +FC+ C++      S   CP   E      LDL +DV +D    + I    VKCP   C +E +L  +E+H + CD
Sbjct:   11 YDSEFVIAVAEEYTCRICHLPLRVPVQTKCGHRFCKECLDEASRRKSRAECPMDRE-----PLDLKKDVFLDKAAERTILSFLVKCPCKGCKWEAELRDLEAHARNCD 113          
BLAST of TRAF-4 vs. Ensembl Nematostella
Match: EDO48394 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJK8])

HSP 1 Score: 50.8322 bits (120), Expect = 8.460e-7
Identity = 35/125 (28.00%), Postives = 61/125 (48.80%), Query Frame = 2
Query:   62 MSAERFESIWFLINQYDFKFDASRYSDLICGMCGKLLSEAMQSSCSCKFCRRCIEIHCENNS-VTCPGLSELCKSTVLDLDEDVIVDHTTNKRISLLKVKCPFDQCPFEDKLIHMESHVKMCDKK 433
             + E F+   F+I   D         +LIC +C  +++E + +SC   +C+ CIE  C     VTCP  +E  K +       +  D  T++ +  L+VKC  + C ++ +L   + H+K+C  K
Sbjct:   10 YAGEGFDLDQFIIPPND---------ELICAICHMVVNEPVLTSCGHSYCKYCIEKWCNGKEVVTCPVDNEQLKPS------QIFPDKKTDRIVLSLEVKCTNNPCRWKGELRQKQKHLKICSHK 119          
BLAST of TRAF-4 vs. Ensembl Nematostella
Match: EDO27426 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9A1])

HSP 1 Score: 48.1358 bits (113), Expect = 1.153e-6
Identity = 33/111 (29.73%), Postives = 51/111 (45.95%), Query Frame = 2
Query:  101 NQYDFKFDASRYSDLICGMCGKLLSEAMQSSCSCKFCRRCI-EIHCENNSVTCPGLSELCKSTVLDLDEDVIVDHTTNKRISLLKVKCPFDQCPFEDKLIHMESHVKMCDK 430
            + YD +F  +   +  C +C   L   +Q+ C  +FC+ C+ E     +   CP   E      LDL +DV +D    + I    VKCP   C +E +L  +E  +K C K
Sbjct:    9 SGYDSEFVIAVAEEYTCRICHLPLRVPVQTKCGHRFCKECLDEASRRKSRAECPMDRE-----PLDLKKDVFLDKAAERTILSFLVKCPCKGCKWEAELRDLEVSMKGCGK 114          
BLAST of TRAF-4 vs. Ensembl Nematostella
Match: EDO38901 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBN3])

HSP 1 Score: 46.9802 bits (110), Expect = 3.825e-6
Identity = 32/117 (27.35%), Postives = 54/117 (46.15%), Query Frame = 2
Query:   95 LINQYDFKFDASRYSD-------LICGMCGKLLSEAMQSSCSCKFCRRCIEIHCENNSVTCPGLSELCKSTVLDLDEDVIVDHTTNKRISLLKVKCPFDQ--CPFEDKLIHMESHVK 418
            ++ Q+DF     +Y+D         C  CG +L +A+Q+ C  ++C  CI       S  C   S +C STV  +      D   ++ +  L V C      CP+E +L H ++H++
Sbjct:   16 MVLQFDFAMVGYKYTDKDTIEASHRCSKCGFILKDAVQTDCGHRYCLSCISPLVSQGSTRC---SAVCNSTV--VKSKWFRDKIADREVLDLPVHCVNQHLGCPWEGELRHRQAHIE 127          
BLAST of TRAF-4 vs. Ensembl Medaka
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:101161132])

HSP 1 Score: 53.5286 bits (127), Expect = 3.073e-7
Identity = 34/110 (30.91%), Postives = 52/110 (47.27%), Query Frame = 2
Query:   98 INQYDFKFDASRYSDLICGMCGKLLSEAMQSSCSCKFCRRCIEIHCENNSVTCPGLSELCKSTVLDLDED-VIVDHTTNKRISLLKVKCPFDQCPFEDKLIHMESHVKMC 424
            +  YD +FD    S   C +C   L  A+Q+ C  +FC+ CIE    +    CP  +E+       L ED +  D+   + I  L V+CP   C  + +L H+E H+  C
Sbjct:   61 LQGYDVEFDPPLESKYECPICLMALRNAIQTRCGHRFCKSCIEKSIRDTGQRCPVDNEM-------LSEDQLFPDNFAKREILSLTVRCPNSDCGEKMELRHLEKHLAQC 163          
BLAST of TRAF-4 vs. Planmine SMEST
Match: SMESG000015063.1 (SMESG000015063.1)

HSP 1 Score: 751.51 bits (1939), Expect = 0.000e+0
Identity = 387/389 (99.49%), Postives = 387/389 (99.49%), Query Frame = 2
Query:   62 MSAERFESIWFLINQYDFKFDASRYSDLICGMCGKLLSEAMQSSCSCKFCRRCIEIHCENNSVTCPGLSELCKSTVLDLDEDVIVDHTTNKRISLLKVKCPFDQCPFEDKLIHMESHVKMCDKKPKSRQQSXXXXXXXXXXXXXXXXXVIHLKLLIESIDNLRNENKMLSNEIISLKETQKLSQISMEKFRKQIEKMNEKMDQIIENQKTLSVKFEENFNEKQSDQQSRMKTNSTGKRERIKKVPKSQNILGELLWKIDNFSATKKSLMFGDDRWLDSAEFCTSPSRYKMQLRMWIGEPNVDILIKMISNEDDKYIQWPIKVEVNIGLLNPENGNLKVNETKIIEYQTASFTSKAYFHFHNSSVNKVVVKHDSLVVKCLAKDLIVDNRK 1228
            MSAERFESIWFLINQYDFKFDASRYSDLICGMCGKLLSEAMQSSCSCKFCRRCIEIHCENNSVTCPGLSELCKSTVLDLDEDVIVDHTTNKRISLLKVKCPFDQCPFEDKLI MESHVKMCDKKPKSRQQSELNLENAELINEIQINEVIHLKLLIESIDNLRNENKMLSNEIISLKETQKLSQISMEKFRKQIEKMNEKMDQIIENQKTLSVKFEENFNEKQSDQQSRMKTNSTGKRERIKKVPKSQNILGELLWKIDNFSATKKSLMFGDDRWLDSAEFCTSPSRYKMQLRMWIGEPNVDILIKMISNEDDKYIQWPIKVEV IGLLNPENGNLKVNETKIIEYQTASFTSKAYFHFHNSSVNKVVVKHDSLVVKCLAKDLIVDNRK
Sbjct:    1 MSAERFESIWFLINQYDFKFDASRYSDLICGMCGKLLSEAMQSSCSCKFCRRCIEIHCENNSVTCPGLSELCKSTVLDLDEDVIVDHTTNKRISLLKVKCPFDQCPFEDKLIQMESHVKMCDKKPKSRQQSELNLENAELINEIQINEVIHLKLLIESIDNLRNENKMLSNEIISLKETQKLSQISMEKFRKQIEKMNEKMDQIIENQKTLSVKFEENFNEKQSDQQSRMKTNSTGKRERIKKVPKSQNILGELLWKIDNFSATKKSLMFGDDRWLDSAEFCTSPSRYKMQLRMWIGEPNVDILIKMISNEDDKYIQWPIKVEVTIGLLNPENGNLKVNETKIIEYQTASFTSKAYFHFHNSSVNKVVVKHDSLVVKCLAKDLIVDNRK 389          
BLAST of TRAF-4 vs. Planmine SMEST
Match: SMESG000015063.1 (SMESG000015063.1)

HSP 1 Score: 738.799 bits (1906), Expect = 0.000e+0
Identity = 383/389 (98.46%), Postives = 383/389 (98.46%), Query Frame = 2
Query:   62 MSAERFESIWFLINQYDFKFDASRYSDLICGMCGKLLSEAMQSSCSCKFCRRCIEIHCENNSVTCPGLSELCKSTVLDLDEDVIVDHTTNKRISLLKVKCPFDQCPFEDKLIHMESHVKMCDKKPKSRQQSXXXXXXXXXXXXXXXXXVIHLKLLIESIDNLRNENKMLSNEIISLKETQKLSQISMEKFRKQIEKMNEKMDQIIENQKTLSVKFEENFNEKQSDQQSRMKTNSTGKRERIKKVPKSQNILGELLWKIDNFSATKKSLMFGDDRWLDSAEFCTSPSRYKMQLRMWIGEPNVDILIKMISNEDDKYIQWPIKVEVNIGLLNPENGNLKVNETKIIEYQTASFTSKAYFHFHNSSVNKVVVKHDSLVVKCLAKDLIVDNRK 1228
            MSAERFESIWFLINQYDFKFDASRYSDLICGMCGKLLSEAMQSSCSCKFCRRCIEIHCENNSVTCPGLSELCKSTVLDLDEDVIVDHTTNKRISLLKVKCPFDQCPFEDKLI MESHVKMCDKKPKSRQQSELNLENAELINEIQINEVIHLKLLIESIDNLRNENKMLSNEIISLKETQ    ISMEKFRKQIEKMNEKMDQIIENQKTLSVKFEENFNEKQSDQQSRMKTNSTGKRERIKKVPKSQNILGELLWKIDNFSATKKSLMFGDDRWLDSAEFCTSPSRYKMQLRMWIGEPNVDILIKMISNEDDKYIQWPIKVEV IGLLNPENGNLKVNETKIIEYQTASFTSKAYFHFHNSSVNKVVVKHDSLVVKCLAKDLIVDNRK
Sbjct:    1 MSAERFESIWFLINQYDFKFDASRYSDLICGMCGKLLSEAMQSSCSCKFCRRCIEIHCENNSVTCPGLSELCKSTVLDLDEDVIVDHTTNKRISLLKVKCPFDQCPFEDKLIQMESHVKMCDKKPKSRQQSELNLENAELINEIQINEVIHLKLLIESIDNLRNENKMLSNEIISLKETQ----ISMEKFRKQIEKMNEKMDQIIENQKTLSVKFEENFNEKQSDQQSRMKTNSTGKRERIKKVPKSQNILGELLWKIDNFSATKKSLMFGDDRWLDSAEFCTSPSRYKMQLRMWIGEPNVDILIKMISNEDDKYIQWPIKVEVTIGLLNPENGNLKVNETKIIEYQTASFTSKAYFHFHNSSVNKVVVKHDSLVVKCLAKDLIVDNRK 385          
BLAST of TRAF-4 vs. Planmine SMEST
Match: SMESG000026595.1 (SMESG000026595.1)

HSP 1 Score: 151.754 bits (382), Expect = 6.648e-41
Identity = 105/376 (27.93%), Postives = 184/376 (48.94%), Query Frame = 2
Query:   62 MSAERFESIWFLINQYDFKFDASRYSDLICGMCGKLLSEAMQSSCSCKFCRRCIEIHCENNSVTCPGLSELCKSTVLDLDEDVIVDHTTNKRISLLKVKCPFDQCPFEDKLIHMESHVKMCDKKPKSRQQ-----SXXXXXXXXXXXXXXXXXVIHLKLLIESIDNLRNENKMLSNEIISLKETQKLSQISMEKFRK-------QIEKMNEKMDQIIENQKTLSVKFEE----NFNEKQSDQQSRMKT--------NSTGKRERIKKVPKSQNI----------------LGELLWKIDNFSATKKSLMFGDDRWLDSAEFCTSPSRYKMQLRMWIGEPNVDILIKMISNEDDKYIQWPIKVEVNIGLLNPENGNL 1069
            M  E FE +W L+ + DF + +   +DL+C +C KL+++A Q+ C C++C  CIE + +  S  CPG S+ C+  +++  +D+I+D+  N +IS + VKCP   C F+++L  +E+H++ C++ P S        ++  +   E+ + +  +   H KLLI+ I+NLRNE + + NE+I  K   + S + M +  K       +IE +N K+D +     +L ++ +       + K+S  +S            N   + ++I  +  +  I                LGEL WKID  S          + W  S  F +    YKM L +  GE  V++   ++  E+D  + WP K  V I  ++  NG +
Sbjct:    1 MINEIFEDVWQLMKEIDFVYKSEIPNDLMCNICNKLMTKASQAQCGCRYCSDCIESYLDGKSKFCPGKSKFCQVKLINFKKDIIIDYAVNVKISEIIVKCPRINCEFQEQLSTIENHMRTCNENPTSCPYFEFGCNKFEVLRNEISDHLYTDSYSHNKLLIDFINNLRNEIESIKNEMIEFKTENRFSHVRMVESNKNESLNKSEIENLNLKIDSLTNENLSLKIEIDRISKSIVDIKESIDKSYHSISEIDDSTKNCPIRGDQIDNLCNATEIISLDSDEEFDFGNEKCLGELDWKIDKLSQRPV------NSWKYSRPFYSQEFGYKMCLSLNFGENAVNVYFHLLRGENDDQLSWPFKCVVTIAAIDQPNGQI 370          
BLAST of TRAF-4 vs. Planmine SMEST
Match: SMESG000015001.1 (SMESG000015001.1)

HSP 1 Score: 147.902 bits (372), Expect = 9.799e-40
Identity = 115/404 (28.47%), Postives = 189/404 (46.78%), Query Frame = 2
Query:   77 FESIWFLINQYDFKFDASRYSDLICGMCGKLLSEAMQSSCSCKFCRRCIEIHCENNSVTCPGLSELCKSTVLDLDEDVIVDHTTNKRISLLKVKCPFDQCPFEDKLIHMESHVKMCDKKPKS-----RQQSXXXXXXXXXXXXXXXXXVIHLKLLIESIDNLRNENKMLSNEIISLKETQKLSQISMEKFRKQIEKMNEK--------------MDQIIENQKTLSVKFEENFNEKQSDQQSRMKTNSTGKRERIKKVPKSQ-----NILGELLWKIDNFSATKKSLMFGDDRWLDSAEFCTSPSRYKMQLRMWIGEPNVDILIKMISNEDDKYIQWPIKVEVNIGLLNPENGNLKVNETKIIEYQTASFTSKAYFHFHNSSVNKVVVKHDS-------LVVKC 1195
            F S+W ++ +  F+FD    SDLIC +C  L+ +A  S C C+FC  CIE +   N+  CPG +  C    +  ++++  DH  N RIS   VKCP + C F D+L  +ESH+KMC+K   S         +  + N E+   +  +   H KLLI+ I+NLRNE + +   I  ++  +  S+  + K +K+I  + ++              +D++    +T+  KF+    + Q+  +  +K    G R+ + K+   Q        G L WKI+N S    +L+F       S  F +    YKM L + +      I   ++  E D  + WP +  V I  ++PENGN+  ++T      T+        +  N+ +N + V  DS       L VKC
Sbjct:    2 FASLWKVMKENKFEFDDEISSDLICKICKCLIIKACNSPCGCRFCFDCIEHYLNGNNKFCPGAARFCHLQTIHFEKNISEDHPANFRISETVVKCPRENCQFTDELGMIESHMKMCNKGRISCPFLGIGCGKNEIINEEMQAHLNEDNYYHTKLLIDLINNLRNEMESMKLNICEMERKEIESKGEIAKLKKEILAVKDENRFFRSGNEANVKLIDEMRRQIETIQTKFQPQIEDNQNYDKENIK---AGLRKTVSKIQGIQAKFEIENFGILEWKIENLSQKFDTLLF-------SEPFYSGRPGYKMCLSINVKSNENYINFHLMVGETDTKLTWPFRSAVTIDAIDPENGNILRSKTMKYSDNTSHSVWLQPVNERNNGINIITVPSDSRAIINDKLTVKC 395          
BLAST of TRAF-4 vs. Planmine SMEST
Match: SMESG000072893.1 (SMESG000072893.1)

HSP 1 Score: 145.206 bits (365), Expect = 1.323e-38
Identity = 104/413 (25.18%), Postives = 194/413 (46.97%), Query Frame = 2
Query:   77 FESIWFLINQYDFKFDASRYSDLICGMCGKLLSEAMQSSCSCKFCRRCIEIHCENNSVTCPGLSELCKSTVLDLDEDVIVDHTTNKRISLLKVKCPFDQCPFEDKLIHMESHVKMCDKKP-----KSRQQSXXXXXXXXXXXXXXXXXVIHLKLLIESIDNLRNENKMLSNEIISLKETQKLSQISMEKFRK-------QIEKMNEKMDQIIENQKTLSVKFEENFNEKQSDQQSRMKTNSTGKRERIKKVPKSQNIL------------GELLWKIDNFSATKKSLMFGDDRWLDSAEFCTSPSRYKMQLRMWIGEPNVDIL---IKMISNEDDKYIQWPIKVEVNIGLLNPENGNLKVNETKIIEYQTA--------SFTSKAYFHFHNSSVNKVVVKHDSLVVKCLAKDL 1210
            F ++W ++ +  F+ D   +S+L C +C  L+ +A  + C C+FC  CIE + E +   CPG +E C+  +++   D   DH  N RIS + VKCP   C  + +LI ME H+  CDK+P      +   +   + + E+   +      H KLLI  ++++R+EN  L   I  ++  +  +       R        +I+   E ++QI    +T+ +K+++  ++ + + + + +  +   + +I +      ++            G   W+ID+ S  K+         + S  F + P  YKM L ++   PN D++     ++  E D  ++WP K  V + ++NPENGN     +K I+Y             + + Y  ++  S+N    K+D L++KC+ K L
Sbjct:    2 FTNLWKIMRENKFESDNLFHSELKCSICKCLMIKACHAPCGCRFCSDCIEQYLEGSDKFCPGEAEYCQGQMINFINDATEDHPINLRISKVIVKCPRQNCEIKTELIKMEEHMNNCDKRPISCPFNTIGCAINEVASDEMNAHLNETNYCHSKLLIGRMESMRSENMELRQRISHMEMNEACNTAERNDIRYENRSMKIEIDANAEVINQIRMQIETIEIKYQKQISDWKQNCEQQQREENKNFQLQIDQCANEMRLIQTKLGNKDFIKSGIFEWEIDSLSQQKRR------EHIYSKPFHSGPYDYKMCLSIYFDVPNRDLIYFDFYLMRGEFDHKLEWPFKYAVTVDVINPENGNSYC--SKSIKYSDCPDHAGWRKPSSDRNYSIYYYYSLNYAAPKNDKLLIKCIIKKL 406          
The following BLAST results are available for this feature:
BLAST of TRAF-4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
TRAF66.734e-730.91TNF receptor associated factor 6 [Source:HGNC Symb... [more]
TRAF66.734e-730.91TNF receptor associated factor 6 [Source:HGNC Symb... [more]
back to top
BLAST of TRAF-4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TRAF-4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Traf67.310e-622.22gene:FBgn0265464 transcript:FBtr0071188[more]
back to top
BLAST of TRAF-4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
traf65.890e-721.47TNF receptor-associated factor 6 [Source:NCBI gene... [more]
traf65.890e-721.47TNF receptor-associated factor 6 [Source:NCBI gene... [more]
traf65.890e-721.47TNF receptor-associated factor 6 [Source:NCBI gene... [more]
back to top
BLAST of TRAF-4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
egf8.380e-730.00epidermal growth factor [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of TRAF-4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Traf61.850e-630.91TNF receptor-associated factor 6 [Source:MGI Symbo... [more]
back to top
BLAST of TRAF-4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6DJN2|TRF6B_XENLA9.808e-730.28TNF receptor-associated factor 6-B OS=Xenopus laev... [more]
sp|Q3ZCC3|TRAF6_BOVIN2.951e-630.91TNF receptor-associated factor 6 OS=Bos taurus OX=... [more]
sp|Q3MV19|TRF6A_XENLA3.020e-631.19TNF receptor-associated factor 6-A OS=Xenopus laev... [more]
sp|Q9Y4K3|TRAF6_HUMAN3.234e-630.91TNF receptor-associated factor 6 OS=Homo sapiens O... [more]
sp|B6CJY4|TRAF6_CERAT3.529e-630.91TNF receptor-associated factor 6 OS=Cercocebus aty... [more]
back to top
BLAST of TRAF-4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZID82.897e-1429.51TNF receptor associated factor-2 (Fragment) OS=Sch... [more]
T1E1014.896e-1423.60TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
E0VE994.873e-1223.96Uncharacterized protein OS=Pediculus humanus subsp... [more]
A0A0C9PK535.862e-1225.61Traf6_0 protein OS=Fopius arisanus OX=64838 GN=Tra... [more]
T1DBK61.799e-1138.78TRAF-4 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
back to top
BLAST of TRAF-4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
traf65.686e-820.57TNF receptor associated factor 6 [Source:NCBI gene... [more]
traf65.686e-820.57TNF receptor associated factor 6 [Source:NCBI gene... [more]
traf66.754e-820.57TNF receptor associated factor 6 [Source:NCBI gene... [more]
back to top
BLAST of TRAF-4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000002130.14.789e-826.05pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 g... [more]
back to top
BLAST of TRAF-4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TRAF-4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO412434.202e-730.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO483948.460e-728.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO274261.153e-629.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO389013.825e-627.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TRAF-4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
traf63.073e-730.91TNF receptor associated factor 6 [Source:NCBI gene... [more]
back to top
BLAST of TRAF-4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000015063.10.000e+099.49SMESG000015063.1[more]
SMESG000015063.10.000e+098.46SMESG000015063.1[more]
SMESG000026595.16.648e-4127.93SMESG000026595.1[more]
SMESG000015001.19.799e-4028.47SMESG000015001.1[more]
SMESG000072893.11.323e-3825.18SMESG000072893.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032067 ID=SMED30032067|Name=TRAF-4|organism=Schmidtea mediterranea sexual|type=transcript|length=1416bp
TAATAATTCCAAACTAATTTTAAATAAACCTGTTTAATAAATAAATTAAT
TAAAAACATTAATGTCAGCTGAAAGATTTGAATCCATTTGGTTTCTAATA
AACCAATACGATTTTAAGTTTGACGCAAGTCGGTATAGCGATCTTATTTG
CGGCATGTGCGGAAAGCTGCTTAGTGAAGCGATGCAGTCGTCATGCTCAT
GCAAATTCTGTCGGAGATGCATTGAAATCCATTGTGAAAATAATAGTGTC
ACTTGTCCAGGTCTTTCGGAACTCTGCAAATCAACAGTTCTCGACCTAGA
TGAAGACGTTATTGTTGATCATACAACAAATAAACGGATATCCTTGCTTA
AGGTGAAATGCCCATTCGATCAATGCCCGTTCGAGGATAAACTTATCCAT
ATGGAATCCCACGTGAAGATGTGCGATAAAAAGCCAAAAAGTCGACAACA
ATCCGAATTGAACCTGGAAAATGCCGAACTGATCAATGAGATTCAAATCA
ATGAGGTGATCCATTTGAAACTGCTGATCGAATCAATTGATAATTTACGG
AATGAAAACAAAATGCTCAGCAATGAAATAATCTCTCTCAAAGAAACCCA
AAAATTATCTCAGATTTCTATGGAAAAATTCCGAAAGCAAATCGAAAAAA
TGAATGAGAAAATGGATCAAATCATTGAAAATCAAAAAACCTTGAGTGTA
AAGTTCGAAGAAAATTTCAATGAAAAGCAATCTGACCAGCAATCTCGGAT
GAAAACCAACTCAACTGGGAAAAGGGAAAGGATAAAAAAAGTTCCAAAAT
CCCAAAATATCCTGGGAGAACTCTTGTGGAAAATAGACAACTTTAGTGCC
ACCAAAAAGAGTTTAATGTTCGGAGATGACCGATGGCTTGACAGTGCTGA
ATTTTGCACATCACCCAGCAGGTATAAAATGCAACTTCGAATGTGGATAG
GAGAACCGAATGTTGACATTTTGATAAAAATGATCTCAAACGAAGATGAC
AAATATATTCAATGGCCGATTAAAGTAGAGGTAAACATAGGACTTTTAAA
CCCTGAAAATGGAAATTTGAAAGTTAATGAAACGAAGATTATTGAATATC
AAACCGCTTCTTTCACTTCAAAGGCTTATTTCCATTTCCATAACTCATCT
GTGAATAAGGTTGTAGTGAAACATGATAGTTTGGTGGTAAAGTGTTTGGC
TAAGGATTTAATTGTCGATAATCGTAAATAACGCGTTGTTTAAATGAACA
TATTCTTGTGCGACAGCTGGCTTGGAAAATTTTGAAATTCTCTTTTTCAT
TACACATTGCATCAAACTTTTTTTAACCGATTTATATTCACATTTTAAAT
AAATTAAAATTATTTATCGATTTTTAGATTTTTCTAATATTTATTTGTTT
TTATGAATTGACTAAA
back to top

protein sequence of SMED30032067-orf-1

>SMED30032067-orf-1 ID=SMED30032067-orf-1|Name=SMED30032067-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=390bp
MSAERFESIWFLINQYDFKFDASRYSDLICGMCGKLLSEAMQSSCSCKFC
RRCIEIHCENNSVTCPGLSELCKSTVLDLDEDVIVDHTTNKRISLLKVKC
PFDQCPFEDKLIHMESHVKMCDKKPKSRQQSELNLENAELINEIQINEVI
HLKLLIESIDNLRNENKMLSNEIISLKETQKLSQISMEKFRKQIEKMNEK
MDQIIENQKTLSVKFEENFNEKQSDQQSRMKTNSTGKRERIKKVPKSQNI
LGELLWKIDNFSATKKSLMFGDDRWLDSAEFCTSPSRYKMQLRMWIGEPN
VDILIKMISNEDDKYIQWPIKVEVNIGLLNPENGNLKVNETKIIEYQTAS
FTSKAYFHFHNSSVNKVVVKHDSLVVKCLAKDLIVDNRK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005164tumor necrosis factor receptor binding
GO:0005515protein binding
GO:0004842ubiquitin-protein transferase activity
GO:0008270zinc ion binding
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0042981regulation of apoptotic process
GO:0043123positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0006955immune response
GO:0007165signal transduction
GO:0016567protein ubiquitination
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR043211TNF_rcpt-assoc_TRAF
IPR013083Znf_RING/FYVE/PHD
IPR008974TRAF-like
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 187..214
NoneNo IPR availableCOILSCoilCoilcoord: 152..179
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 219..241
NoneNo IPR availablePANTHERPTHR10131:SF129TNF RECEPTOR-ASSOCIATED FACTOR 6coord: 171..378
coord: 13..136
NoneNo IPR availableCDDcd16449RING-HCcoord: 30..66
e-value: 5.20831E-6
score: 40.9137
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 12..67
IPR008974TRAF-likeGENE3DG3DSA:2.60.210.10coord: 213..382
e-value: 6.0E-16
score: 60.4
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 254..338
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 12..132
e-value: 6.4E-13
score: 50.7
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 13..136
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 171..378