5-AMP-activated protein kinase, beta subunit,putative

Overview
Name5-AMP-activated protein kinase, beta subunit,putative
Smed IDSMED30032066
Length (bp)1280
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 5-AMP-activated protein kinase, beta subunit,putative (SMED30032066) t-SNE clustered cells

Violin plots show distribution of expression levels for 5-AMP-activated protein kinase, beta subunit,putative (SMED30032066) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 5-AMP-activated protein kinase, beta subunit,putative (SMED30032066) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 5-AMP-activated protein kinase, beta subunit,putative (SMED30032066) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. Ensembl Human
Match: PRKAB2 (protein kinase AMP-activated non-catalytic subunit beta 2 [Source:HGNC Symbol;Acc:HGNC:9379])

HSP 1 Score: 196.438 bits (498), Expect = 1.891e-59
Identity = 113/242 (46.69%), Postives = 153/242 (63.22%), Query Frame = 1
Query:  397 DGIDSENKTIPTVFKWEGGGKDVFLSGSFNLWKAKIPMVKSKHNFYTIVELPKGEHQYKFIVDGVWKIDNKQHIANNDNGSQNNVISVKSSDFDVLEALK-DDIANSKNSSNNVRQSIVTTVPLKSPGGLNESNKPKDGDNENHLQSSSPPGSYSQELPQKTLLSEIGNEKSPTXXXXXXXXXXVILNKETGVHCDPNLLPQPNHVMINHMYALSIKDGVIVLSAIARYRQKFVSTVMYKPI 1119
            D +    +  PTV +W  GGK+VF+SGSFN W  KIP++KS ++F  I++LP+GEHQYKF VDG W  D  + +  +  G+ NN+I VK SDF+V +ALK D + +S+ S  ++                                SSSPPG Y QE+      SE   E+  +PP+LPP LLQVILNK+T + CDP LLP+PNHVM+NH+YALSIKD V+VLSA  RY++K+V+T++YKPI
Sbjct:   68 DSVKPTQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFDALKLDSMESSETSCRDL--------------------------------SSSPPGPYGQEM--YAFRSE---ERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNHLYALSIKDSVMVLSATHRYKKKYVTTLLYKPI 272          
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. Ensembl Human
Match: PRKAB1 (protein kinase AMP-activated non-catalytic subunit beta 1 [Source:HGNC Symbol;Acc:HGNC:9378])

HSP 1 Score: 192.971 bits (489), Expect = 4.930e-58
Identity = 109/231 (47.19%), Postives = 144/231 (62.34%), Query Frame = 1
Query:  427 PTVFKWEGGGKDVFLSGSFNLWKAKIPMVKSKHNFYTIVELPKGEHQYKFIVDGVWKIDNKQHIANNDNGSQNNVISVKSSDFDVLEALKDDIANSKNSSNNVRQSIVTTVPLKSPGGLNESNKPKDGDNENHLQSSSPPGSYSQELPQKTLLSEIGNEKSPTXXXXXXXXXXVILNKETGVHCDPNLLPQPNHVMINHMYALSIKDGVIVLSAIARYRQKFVSTVMYKPI 1119
            PTVF+W GGGK+V+LSGSFN W +K+P+ +S +NF  I++LP+GEHQYKF VDG W  D  + I  +  G+ NN+I VK +DF+V +AL  D     + S                                   SSSPPG Y QE     +       ++P   +LPP LLQVILNK+TG+ CDP LLP+PNHVM+NH+YALSIKDGV+VLSA  RY++K+V+T++YKPI
Sbjct:   79 PTVFRWTGGGKEVYLSGSFNNW-SKLPLTRSHNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSE---------------------------------LSSSPPGPYHQE---PYVCKPEERFRAPP--ILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI 270          
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. Ensembl Human
Match: PRKAB1 (protein kinase AMP-activated non-catalytic subunit beta 1 [Source:HGNC Symbol;Acc:HGNC:9378])

HSP 1 Score: 192.971 bits (489), Expect = 4.930e-58
Identity = 109/231 (47.19%), Postives = 144/231 (62.34%), Query Frame = 1
Query:  427 PTVFKWEGGGKDVFLSGSFNLWKAKIPMVKSKHNFYTIVELPKGEHQYKFIVDGVWKIDNKQHIANNDNGSQNNVISVKSSDFDVLEALKDDIANSKNSSNNVRQSIVTTVPLKSPGGLNESNKPKDGDNENHLQSSSPPGSYSQELPQKTLLSEIGNEKSPTXXXXXXXXXXVILNKETGVHCDPNLLPQPNHVMINHMYALSIKDGVIVLSAIARYRQKFVSTVMYKPI 1119
            PTVF+W GGGK+V+LSGSFN W +K+P+ +S +NF  I++LP+GEHQYKF VDG W  D  + I  +  G+ NN+I VK +DF+V +AL  D     + S                                   SSSPPG Y QE     +       ++P   +LPP LLQVILNK+TG+ CDP LLP+PNHVM+NH+YALSIKDGV+VLSA  RY++K+V+T++YKPI
Sbjct:   79 PTVFRWTGGGKEVYLSGSFNNW-SKLPLTRSHNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSE---------------------------------LSSSPPGPYHQE---PYVCKPEERFRAPP--ILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI 270          
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. Ensembl Human
Match: PRKAB1 (protein kinase AMP-activated non-catalytic subunit beta 1 [Source:HGNC Symbol;Acc:HGNC:9378])

HSP 1 Score: 102.449 bits (254), Expect = 5.724e-26
Identity = 52/96 (54.17%), Postives = 67/96 (69.79%), Query Frame = 1
Query:  832 SSSPPGSYSQELPQKTLLSEIGNEKSPTXXXXXXXXXXVILNKETGVHCDPNLLPQPNHVMINHMYALSIKDGVIVLSAIARYRQKFVSTVMYKPI 1119
            SSSPPG Y QE     +       ++P           VILNK+TG+ CDP LLP+PNHVM+NH+YALSIKDGV+VLSA  RY++K+V+T++YKPI
Sbjct:   14 SSSPPGPYHQE---PYVCKPEERFRAPPILPPHLLQ--VILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI 104          
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. Ensembl Celegans
Match: aakb-2 (AMP-Activated Kinase Beta subunit [Source:UniProtKB/TrEMBL;Acc:Q9NAH7])

HSP 1 Score: 180.644 bits (457), Expect = 1.021e-53
Identity = 107/250 (42.80%), Postives = 162/250 (64.80%), Query Frame = 1
Query:  382 PSMCLDGIDSENKTIPTVFKWE----GGGKDVFLSGSFNLWKAKIPMVKSKHNFYTIVELPKGEHQYKFIVDGVWKIDNKQHIANNDNGSQNNVISVKSSDFDVLEALKDDIANSKNSSNNVRQSIVTTVPLKSPGGLNESNKPKDGDNENHLQSSSPPGSYSQELPQKTLLSEIGNEKSPTXXXXXXXXXXVILNKETGVHCDPNLLPQPNHVMINHMYALSIKDGVIVLSAIARYRQKFVSTVMYKPI 1119
            P +  DG + ++   P VF+W        + V + GS++ W+ +IPMVKS ++F TI++L  G+++YKF VDG W +D+ Q  A + +G++NN+I+++ SDF V EAL +D  +S  ++  V +            G +ES K  D  N+  L+      S++QE+P   +L      K+  PP++PPQL+QV+LNKET   CDPN+LP+PNHVM+NHMYALSIKD V+VLS+  RYR+KFV+T++YKP+
Sbjct:   47 PMIFDDGNEDKSGECPVVFRWSFTQNAQPRVVHIVGSWDNWQTRIPMVKSTNDFSTIIDLQPGQYEYKFQVDGSWVVDDNQGKAQDVHGNENNMINIQDSDFAVFEALDEDFQSS--TAGEVLR------------GESESTKNHDTPNDRELEKLR---SFTQEIPSMDML-----RKAAGPPVIPPQLMQVLLNKETPESCDPNVLPEPNHVMLNHMYALSIKDSVMVLSSTQRYRKKFVTTLLYKPV 274          
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. Ensembl Celegans
Match: aakb-1 (AMP-Activated Kinase Beta subunit [Source:UniProtKB/TrEMBL;Acc:Q9XUY2])

HSP 1 Score: 179.104 bits (453), Expect = 2.846e-53
Identity = 105/235 (44.68%), Postives = 149/235 (63.40%), Query Frame = 1
Query:  424 IPTVFKWE---GGGKDVFLSGSFNLWKAKIPMVKSKHNFYTIVELPKGEHQYKFIVDGVWKIDNKQHIANNDNGSQNNVISVKSSDFDVLEALKDDIANSKNSSNNVRQSIVTTVPLKSPGGLNESNKPKDGDNENHLQSSSPPGSYSQELPQKTLLSEIGNEKSPTXXXXXXXXXXVILNKETGVHCDPNLLPQPNHVMINHMYALSIKDGVIVLSAIARYRQKFVSTVMYKPI 1119
             P VFKW       + V++ GS++ W  KIP+VKS  +F TIV+L  G+H+YKF+VD  W +D+ Q    N+ G +NNV+ +  +DF+V +AL  D+A+S     N  +++  + P K        + P D + E   Q       + QE P +     +   K+  PP+LPP LLQVILNK+T V CDPN+LP+P+HVM+NH+YALSIKDGV+VLSA  RYR+KFV+T++YKPI
Sbjct:   57 FPVVFKWNINNATPRQVYICGSWDGWNTKIPLVKSTSDFSTIVDLEPGKHEYKFMVDSKWVVDDNQQKTGNNLGGENNVVMIDEADFEVFDALDKDLASS-----NAGEALRNSHPTKE-----SHDTPNDRELEKLHQ-------FGQETPTR-----VDFNKAAAPPVLPPHLLQVILNKDTPVQCDPNVLPEPDHVMLNHLYALSIKDGVMVLSATHRYRKKFVTTLLYKPI 269          
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. Ensembl Celegans
Match: aakb-1 (AMP-Activated Kinase Beta subunit [Source:UniProtKB/TrEMBL;Acc:Q9XUY2])

HSP 1 Score: 179.104 bits (453), Expect = 2.846e-53
Identity = 105/235 (44.68%), Postives = 149/235 (63.40%), Query Frame = 1
Query:  424 IPTVFKWE---GGGKDVFLSGSFNLWKAKIPMVKSKHNFYTIVELPKGEHQYKFIVDGVWKIDNKQHIANNDNGSQNNVISVKSSDFDVLEALKDDIANSKNSSNNVRQSIVTTVPLKSPGGLNESNKPKDGDNENHLQSSSPPGSYSQELPQKTLLSEIGNEKSPTXXXXXXXXXXVILNKETGVHCDPNLLPQPNHVMINHMYALSIKDGVIVLSAIARYRQKFVSTVMYKPI 1119
             P VFKW       + V++ GS++ W  KIP+VKS  +F TIV+L  G+H+YKF+VD  W +D+ Q    N+ G +NNV+ +  +DF+V +AL  D+A+S     N  +++  + P K        + P D + E   Q       + QE P +     +   K+  PP+LPP LLQVILNK+T V CDPN+LP+P+HVM+NH+YALSIKDGV+VLSA  RYR+KFV+T++YKPI
Sbjct:   57 FPVVFKWNINNATPRQVYICGSWDGWNTKIPLVKSTSDFSTIVDLEPGKHEYKFMVDSKWVVDDNQQKTGNNLGGENNVVMIDEADFEVFDALDKDLASS-----NAGEALRNSHPTKE-----SHDTPNDRELEKLHQ-------FGQETPTR-----VDFNKAAAPPVLPPHLLQVILNKDTPVQCDPNVLPEPDHVMLNHLYALSIKDGVMVLSATHRYRKKFVTTLLYKPI 269          
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. Ensembl Fly
Match: alc (gene:FBgn0260972 transcript:FBtr0088625)

HSP 1 Score: 186.037 bits (471), Expect = 1.894e-56
Identity = 110/241 (45.64%), Postives = 144/241 (59.75%), Query Frame = 1
Query:  397 DGIDSENKTIPTVFKWEGGGKDVFLSGSFNLWKAKIPMVKSKHNFYTIVELPKGEHQYKFIVDGVWKIDNKQHIANNDNGSQNNVISVKSSDFDVLEALKDDIANSKNSSNNVRQSIVTTVPLKSPGGLNESNKPKDGDNENHLQSSSPPGSYSQELPQKTLLSEIGNEKSPTXXXXXXXXXXVILNKETGVHCDPNLLPQPNHVMINHMYALSIKDGVIVLSAIARYRQKFVSTVMYKPI 1119
            D  D     +PTV +W+GGGK+V +SG+F+ WK  + MV+S  NF TI++LP+G+HQYKF VDG WK D K     N  G +NN++SV+ SDF+V +AL  D  N  N +                                          YSQE+PQ         EK   PP+LPP LLQVILNK+T + C+P LLP+PNHVM+NH+YALSIKDGV+VLSA  RYR+K+V+T++YKPI
Sbjct:   25 DEDDIRKTALPTVLRWDGGGKNVTISGTFSDWKP-MAMVRSHQNFVTIIDLPEGDHQYKFCVDGEWKHDPKLKSVENAEGQRNNLVSVRESDFEVFQALAKDSENVTNYAEK---------------------------------------EYSQEVPQVKPW-----EKVSGPPVLPPHLLQVILNKDTPLSCEPTLLPEPNHVMLNHLYALSIKDGVMVLSATHRYRKKYVTTLLYKPI 220          
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. Ensembl Fly
Match: alc (gene:FBgn0260972 transcript:FBtr0088624)

HSP 1 Score: 187.193 bits (474), Expect = 2.845e-55
Identity = 110/241 (45.64%), Postives = 144/241 (59.75%), Query Frame = 1
Query:  397 DGIDSENKTIPTVFKWEGGGKDVFLSGSFNLWKAKIPMVKSKHNFYTIVELPKGEHQYKFIVDGVWKIDNKQHIANNDNGSQNNVISVKSSDFDVLEALKDDIANSKNSSNNVRQSIVTTVPLKSPGGLNESNKPKDGDNENHLQSSSPPGSYSQELPQKTLLSEIGNEKSPTXXXXXXXXXXVILNKETGVHCDPNLLPQPNHVMINHMYALSIKDGVIVLSAIARYRQKFVSTVMYKPI 1119
            D  D     +PTV +W+GGGK+V +SG+F+ WK  + MV+S  NF TI++LP+G+HQYKF VDG WK D K     N  G +NN++SV+ SDF+V +AL  D  N  N +                                          YSQE+PQ         EK   PP+LPP LLQVILNK+T + C+P LLP+PNHVM+NH+YALSIKDGV+VLSA  RYR+K+V+T++YKPI
Sbjct:  146 DEDDIRKTALPTVLRWDGGGKNVTISGTFSDWKP-MAMVRSHQNFVTIIDLPEGDHQYKFCVDGEWKHDPKLKSVENAEGQRNNLVSVRESDFEVFQALAKDSENVTNYAEK---------------------------------------EYSQEVPQVKPW-----EKVSGPPVLPPHLLQVILNKDTPLSCEPTLLPEPNHVMLNHLYALSIKDGVMVLSATHRYRKKYVTTLLYKPI 341          
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. Ensembl Zebrafish
Match: prkab1b (protein kinase, AMP-activated, beta 1 non-catalytic subunit, b [Source:ZFIN;Acc:ZDB-GENE-030131-7172])

HSP 1 Score: 203.371 bits (516), Expect = 1.927e-62
Identity = 112/231 (48.48%), Postives = 149/231 (64.50%), Query Frame = 1
Query:  427 PTVFKWEGGGKDVFLSGSFNLWKAKIPMVKSKHNFYTIVELPKGEHQYKFIVDGVWKIDNKQHIANNDNGSQNNVISVKSSDFDVLEALKDDIANSKNSSNNVRQSIVTTVPLKSPGGLNESNKPKDGDNENHLQSSSPPGSYSQELPQKTLLSEIGNEKSPTXXXXXXXXXXVILNKETGVHCDPNLLPQPNHVMINHMYALSIKDGVIVLSAIARYRQKFVSTVMYKPI 1119
            PTVF+W+G GK+++LSGSFN W  KIP+ KS +NF  I++LP+GEHQYKF VDG W +D K+ +  N +G  NNVI V+ +DF+V +ALK D     + S+                                  SSSPPG Y Q+       S    +K  +PP+LPP LLQV+LNK+TG+ CDP LLP+PNHVM+NH+YALSIKDGV+VLSA  RY++K+V+T++YKPI
Sbjct:   68 PTVFRWKGPGKEIYLSGSFNNWATKIPLNKSHNNFVAIIDLPEGEHQYKFYVDGHWTLDPKEPVVTNKSGVVNNVIKVRKTDFEVFDALKTDSEKCADMSD---------------------------------LSSSPPGPYHQD-----PYSTKSEDKLRSPPILPPHLLQVLLNKDTGISCDPTLLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI 260          
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. Ensembl Zebrafish
Match: prkab1b (protein kinase, AMP-activated, beta 1 non-catalytic subunit, b [Source:ZFIN;Acc:ZDB-GENE-030131-7172])

HSP 1 Score: 203.371 bits (516), Expect = 1.927e-62
Identity = 112/231 (48.48%), Postives = 149/231 (64.50%), Query Frame = 1
Query:  427 PTVFKWEGGGKDVFLSGSFNLWKAKIPMVKSKHNFYTIVELPKGEHQYKFIVDGVWKIDNKQHIANNDNGSQNNVISVKSSDFDVLEALKDDIANSKNSSNNVRQSIVTTVPLKSPGGLNESNKPKDGDNENHLQSSSPPGSYSQELPQKTLLSEIGNEKSPTXXXXXXXXXXVILNKETGVHCDPNLLPQPNHVMINHMYALSIKDGVIVLSAIARYRQKFVSTVMYKPI 1119
            PTVF+W+G GK+++LSGSFN W  KIP+ KS +NF  I++LP+GEHQYKF VDG W +D K+ +  N +G  NNVI V+ +DF+V +ALK D     + S+                                  SSSPPG Y Q+       S    +K  +PP+LPP LLQV+LNK+TG+ CDP LLP+PNHVM+NH+YALSIKDGV+VLSA  RY++K+V+T++YKPI
Sbjct:   68 PTVFRWKGPGKEIYLSGSFNNWATKIPLNKSHNNFVAIIDLPEGEHQYKFYVDGHWTLDPKEPVVTNKSGVVNNVIKVRKTDFEVFDALKTDSEKCADMSD---------------------------------LSSSPPGPYHQD-----PYSTKSEDKLRSPPILPPHLLQVLLNKDTGISCDPTLLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI 260          
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. Ensembl Zebrafish
Match: prkab1a (protein kinase, AMP-activated, beta 1 non-catalytic subunit, a [Source:ZFIN;Acc:ZDB-GENE-040718-377])

HSP 1 Score: 203.371 bits (516), Expect = 2.231e-62
Identity = 117/262 (44.66%), Postives = 163/262 (62.21%), Query Frame = 1
Query:  337 DIEAKFREAKLLESHPSMCLDGID-SENKTIPTVFKWEGGGKDVFLSGSFNLWKAKIPMVKSKHNFYTIVELPKGEHQYKFIVDGVWKIDNKQHIANNDNGSQNNVISVKSSDFDVLEALKDDIANSKNSSNNVRQSIVTTVPLKSPGGLNESNKPKDGDNENHLQSSSPPGSYSQELPQKTLLSEIGNEKSPTXXXXXXXXXXVILNKETGVHCDPNLLPQPNHVMINHMYALSIKDGVIVLSAIARYRQKFVSTVMYKPI 1119
            D++A   + + +E  P   L+G + ++    PTVF+W G GK+V++SGSFN W  KIP+++S++NF  IV+LP+GEHQYKF VDG+W  D  + +  N  G+ NN+I VK +DF+V +AL  D     + S+                                  SSSPPG Y Q+       +    EK  +PP+LPP LLQVILNK+TG+ CDP LLP+PNHVM+NH+YALSIKDGV+VLSA  RY++K+V+T++YKPI
Sbjct:   47 DLKAPLEKEEFIEWRPD--LEGSEKTDTLDRPTVFRWTGAGKEVYISGSFNNWTNKIPLIRSQNNFVAIVDLPEGEHQYKFYVDGLWTHDPTEPVVTNQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDMSD---------------------------------LSSSPPGPYHQD-----AYTPKQEEKFKSPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI 268          
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. Ensembl Zebrafish
Match: CABZ01083448.1 (pep chromosome:GRCz11:2:58739111:58742863:1 gene:ENSDARG00000067817.5 transcript:ENSDART00000097690.5 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CABZ01083448.1)

HSP 1 Score: 144.821 bits (364), Expect = 5.069e-40
Identity = 86/233 (36.91%), Postives = 125/233 (53.65%), Query Frame = 1
Query:  430 TVFKWEGGGKDVFLSGSFNLWKAKIPMVKSKHNFYTIVELPKGEHQYKFIVDGVWKIDNKQ--HIANNDNGSQNNVISVKSSDFDVLEALKDDIANSKNSSNNVRQSIVTTVPLKSPGGLNESNKPKDGDNENHLQSSSPPGSYSQELPQKTLLSEIGNEKSPTXXXXX-XXXXXVILNKETGVHCDPNLLPQPNHVMINHMYALSIKDGVIVLSAIARYRQKFVSTVMYKPI 1119
            TV +W GGG++VF++GSFN W +KIP+ KS ++F  I++LP+GEHQYKF VDG W  D  +   +   +  SQ +VI  K SD  +   L+  +     SS+                                  + S P  +S+      L+  +  E   T   +         LN+   + CDP LLP+PNHVM+NH+YALSIKDGV+VLSA  RY++K+V++++YKPI
Sbjct:   77 TVIRWAGGGREVFITGSFNNWSSKIPLNKSHNDFVAILDLPEGEHQYKFFVDGQWLHDPSEVMMMMMMNQISQRSVI--KRSDVHMFTELQVSLFKCSESSS---------------------------------LTCSRPAQFSK------LVDVVKAETQWTSSFIIPSHFSHRRLNRNFNISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTSLLYKPI 268          
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. Ensembl Zebrafish
Match: prkab1a (protein kinase, AMP-activated, beta 1 non-catalytic subunit, a [Source:ZFIN;Acc:ZDB-GENE-040718-377])

HSP 1 Score: 120.939 bits (302), Expect = 1.182e-31
Identity = 82/213 (38.50%), Postives = 118/213 (55.40%), Query Frame = 1
Query:  337 DIEAKFREAKLLESHPSMCLDGID-SENKTIPTVFKWEGGGKDVFLSGSFNLWKAKIPMVKSKHNFYTIVELPKGEHQYKFIVDGVWKIDNKQHIANNDNGSQNNVISVKSSDFDVLEALKDDIANSKNSSNNVRQSIVTTVPLKSPGGLNESNKPKDGDNENHLQSSSPPGSYSQELPQKTLLSEIGNEKSPTXXXXXXXXXXVILNKETGV 972
            D++A   + + +E  P   L+G + ++    PTVF+W G GK+V++SGSFN W  KIP+++S++NF  IV+LP+GEHQYKF VDG+W  D  + +  N  G+ NN+I VK +DF+V +AL  D     + S+                                  SSSPPG Y Q+       +    EK  +PP+LPP LLQVILNK+TG+
Sbjct:   47 DLKAPLEKEEFIEWRPD--LEGSEKTDTLDRPTVFRWTGAGKEVYISGSFNNWTNKIPLIRSQNNFVAIVDLPEGEHQYKFYVDGLWTHDPTEPVVTNQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDMSD---------------------------------LSSSPPGPYHQD-----AYTPKQEEKFKSPPILPPHLLQVILNKDTGI 219          
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. Ensembl Xenopus
Match: prkab2 (protein kinase, AMP-activated, beta 2 non-catalytic subunit [Source:NCBI gene;Acc:100127782])

HSP 1 Score: 198.364 bits (503), Expect = 2.884e-60
Identity = 116/247 (46.96%), Postives = 155/247 (62.75%), Query Frame = 1
Query:  382 PSMCLDGIDSENKTIPTVFKWEGGGKDVFLSGSFNLWKAKIPMVKSKHNFYTIVELPKGEHQYKFIVDGVWKIDNKQHIANNDNGSQNNVISVKSSDFDVLEALK-DDIANSKNSSNNVRQSIVTTVPLKSPGGLNESNKPKDGDNENHLQSSSPPGSYSQELPQKTLLSEIGNEKSPTXXXXXXXXXXVILNKETGVHCDPNLLPQPNHVMINHMYALSIKDGVIVLSAIARYRQKFVSTVMYKPI 1119
            P    D   S  +  PTV +W  GGK+VF+SGSFN W AKIP++KS ++F  I++LP+GEHQYKF VDG W  D  + +  +  G+ NN+I VK SDF+V +ALK D + +S  S+ ++                                SSSPPG Y QE     L +    E+  +PP+LPP LLQVILNK+T + CDP LLP+PNHVM+NH+YALSIKDGV+VLSA  RY++K+V+T++YKPI
Sbjct:   62 PQESEDPGKSAQQGRPTVIRWTEGGKEVFISGSFNNWTAKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFDALKLDSMESSDTSARDL--------------------------------SSSPPGLYGQE-----LYAYKPEERYKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI 271          
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. Ensembl Xenopus
Match: PRKAB1 (protein kinase, AMP-activated, beta 1 non-catalytic subunit [Source:NCBI gene;Acc:100380160])

HSP 1 Score: 162.155 bits (409), Expect = 1.258e-46
Identity = 95/206 (46.12%), Postives = 128/206 (62.14%), Query Frame = 1
Query:  427 PTVFKWEGGGKDVFLSGSFNLWKAKIPMVKSKHNFYTIVELPKGEHQYKFIVDGVWKIDNKQHIANNDNGSQNNVISVKSSDFDVLEALKDDIANSKNSSNNVRQSIVTTVPLKSPGGLNESNKPKDGDNENHLQSSSPPGSYSQELPQKTLLSEIGNEKSPTXXXXXXXXXXVILNKETGVHCDPNLLPQPNHVMINHMYALSIK 1044
            PTVF+W GGGK+++LSG+FN W AKIP+++S +NF+ I++LP+GEHQYKF+VDG W  D  + +  +  G+ NN+I V+ +DF+V +AL  D     + S+                                  SSSPPG Y Q+ P    L     E+  TPP+LPP LLQVILNK+TG+ CDP LLP+PNHVM+NH+YALSIK
Sbjct:   75 PTVFRWTGGGKEIYLSGTFNNW-AKIPLIRSHNNFFAILDLPEGEHQYKFLVDGQWTHDPAEPVTTSQLGTVNNIIQVQKTDFEVFDALMVDSQKGSDISD---------------------------------LSSSPPGPYQQD-PYNCKL----EERFKTPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIK 241          
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. Ensembl Xenopus
Match: PRKAB1 (protein kinase, AMP-activated, beta 1 non-catalytic subunit [Source:NCBI gene;Acc:100380160])

HSP 1 Score: 105.916 bits (263), Expect = 3.004e-27
Identity = 62/96 (64.58%), Postives = 77/96 (80.21%), Query Frame = 1
Query:  832 SSSPPGSYSQELPQKTLLSEIGNEKSPTXXXXXXXXXXVILNKETGVHCDPNLLPQPNHVMINHMYALSIKDGVIVLSAIARYRQKFVSTVMYKPI 1119
            SSSPPG Y Q+ P    L     E+  TPP+LPP LLQVILNK+TG+ CDP LLP+PNHVM+NH+YALSIKDGV+VLSA  RY++K+V+T++YKPI
Sbjct:   14 SSSPPGPYQQD-PYNCKL----EERFKTPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI 104          
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. Ensembl Mouse
Match: Prkab2 (protein kinase, AMP-activated, beta 2 non-catalytic subunit [Source:MGI Symbol;Acc:MGI:1336185])

HSP 1 Score: 196.438 bits (498), Expect = 1.577e-59
Identity = 113/242 (46.69%), Postives = 153/242 (63.22%), Query Frame = 1
Query:  397 DGIDSENKTIPTVFKWEGGGKDVFLSGSFNLWKAKIPMVKSKHNFYTIVELPKGEHQYKFIVDGVWKIDNKQHIANNDNGSQNNVISVKSSDFDVLEALK-DDIANSKNSSNNVRQSIVTTVPLKSPGGLNESNKPKDGDNENHLQSSSPPGSYSQELPQKTLLSEIGNEKSPTXXXXXXXXXXVILNKETGVHCDPNLLPQPNHVMINHMYALSIKDGVIVLSAIARYRQKFVSTVMYKPI 1119
            D +    +  PTV +W  GGK+VF+SGSFN W  KIP++KS ++F  I++LP+GEHQYKF VDG W  D  + +  +  G+ NN+I VK SDF+V +ALK D + +S+ S  ++                                SSSPPG Y QE+      SE   E+  +PP+LPP LLQVILNK+T + CDP LLP+PNHVM+NH+YALSIKD V+VLSA  RY++K+V+T++YKPI
Sbjct:   67 DSVKPAQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFDALKLDSMESSETSCRDL--------------------------------SSSPPGPYGQEM--YVFRSE---ERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNHLYALSIKDSVMVLSATHRYKKKYVTTLLYKPI 271          
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. Ensembl Mouse
Match: Prkab1 (protein kinase, AMP-activated, beta 1 non-catalytic subunit [Source:MGI Symbol;Acc:MGI:1336167])

HSP 1 Score: 195.667 bits (496), Expect = 2.475e-59
Identity = 112/231 (48.48%), Postives = 148/231 (64.07%), Query Frame = 1
Query:  427 PTVFKWEGGGKDVFLSGSFNLWKAKIPMVKSKHNFYTIVELPKGEHQYKFIVDGVWKIDNKQHIANNDNGSQNNVISVKSSDFDVLEALKDDIANSKNSSNNVRQSIVTTVPLKSPGGLNESNKPKDGDNENHLQSSSPPGSYSQELPQKTLLSEIGNEKSPTXXXXXXXXXXVILNKETGVHCDPNLLPQPNHVMINHMYALSIKDGVIVLSAIARYRQKFVSTVMYKPI 1119
            PTVF+W GGGK+V+LSGSFN W +K+P+ +S++NF  I++LP+GEHQYKF VDG W  D  + I  +  G+ NN+I VK +DF+V +AL  D     + S                                   SSSPPG Y QE      +S+   E+   PP+LPP LLQVILNK+TG+ CDP LLP+PNHVM+NH+YALSIKDGV+VLSA  RY++K+V+T++YKPI
Sbjct:   79 PTVFRWTGGGKEVYLSGSFNNW-SKLPLTRSQNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSE---------------------------------LSSSPPGPYHQE----PYMSK-PEERFKAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI 270          
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. Ensembl Mouse
Match: Prkab1 (protein kinase, AMP-activated, beta 1 non-catalytic subunit [Source:MGI Symbol;Acc:MGI:1336167])

HSP 1 Score: 195.667 bits (496), Expect = 2.475e-59
Identity = 112/231 (48.48%), Postives = 148/231 (64.07%), Query Frame = 1
Query:  427 PTVFKWEGGGKDVFLSGSFNLWKAKIPMVKSKHNFYTIVELPKGEHQYKFIVDGVWKIDNKQHIANNDNGSQNNVISVKSSDFDVLEALKDDIANSKNSSNNVRQSIVTTVPLKSPGGLNESNKPKDGDNENHLQSSSPPGSYSQELPQKTLLSEIGNEKSPTXXXXXXXXXXVILNKETGVHCDPNLLPQPNHVMINHMYALSIKDGVIVLSAIARYRQKFVSTVMYKPI 1119
            PTVF+W GGGK+V+LSGSFN W +K+P+ +S++NF  I++LP+GEHQYKF VDG W  D  + I  +  G+ NN+I VK +DF+V +AL  D     + S                                   SSSPPG Y QE      +S+   E+   PP+LPP LLQVILNK+TG+ CDP LLP+PNHVM+NH+YALSIKDGV+VLSA  RY++K+V+T++YKPI
Sbjct:   79 PTVFRWTGGGKEVYLSGSFNNW-SKLPLTRSQNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSE---------------------------------LSSSPPGPYHQE----PYMSK-PEERFKAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI 270          
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. Ensembl Mouse
Match: Prkab2 (protein kinase, AMP-activated, beta 2 non-catalytic subunit [Source:MGI Symbol;Acc:MGI:1336185])

HSP 1 Score: 114.005 bits (284), Expect = 2.043e-29
Identity = 54/113 (47.79%), Postives = 74/113 (65.49%), Query Frame = 1
Query:  397 DGIDSENKTIPTVFKWEGGGKDVFLSGSFNLWKAKIPMVKSKHNFYTIVELPKGEHQYKFIVDGVWKIDNKQHIANNDNGSQNNVISVKSSDFDVLEALKDDIANSKNSSNNV 735
            D +    +  PTV +W  GGK+VF+SGSFN W  KIP++KS ++F  I++LP+GEHQYKF VDG W  D  + +  +  G+ NN+I VK SDF+V +ALK D   S  +S  V
Sbjct:   67 DSVKPAQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFDALKLDSMESSETSCRV 179          
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. Ensembl Mouse
Match: Prkab1 (protein kinase, AMP-activated, beta 1 non-catalytic subunit [Source:MGI Symbol;Acc:MGI:1336167])

HSP 1 Score: 90.8929 bits (224), Expect = 4.552e-21
Identity = 37/59 (62.71%), Postives = 49/59 (83.05%), Query Frame = 1
Query:  427 PTVFKWEGGGKDVFLSGSFNLWKAKIPMVKSKHNFYTIVELPKGEHQYKFIVDGVWKID 603
            PTVF+W GGGK+V+LSGSFN W +K+P+ +S++NF  I++LP+GEHQYKF VDG W  D
Sbjct:   79 PTVFRWTGGGKEVYLSGSFNNW-SKLPLTRSQNNFVAILDLPEGEHQYKFFVDGQWTHD 136          
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. UniProt/SwissProt
Match: sp|O43741|AAKB2_HUMAN (5'-AMP-activated protein kinase subunit beta-2 OS=Homo sapiens OX=9606 GN=PRKAB2 PE=1 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 9.079e-59
Identity = 113/242 (46.69%), Postives = 153/242 (63.22%), Query Frame = 1
Query:  397 DGIDSENKTIPTVFKWEGGGKDVFLSGSFNLWKAKIPMVKSKHNFYTIVELPKGEHQYKFIVDGVWKIDNKQHIANNDNGSQNNVISVKSSDFDVLEALK-DDIANSKNSSNNVRQSIVTTVPLKSPGGLNESNKPKDGDNENHLQSSSPPGSYSQELPQKTLLSEIGNEKSPTXXXXXXXXXXVILNKETGVHCDPNLLPQPNHVMINHMYALSIKDGVIVLSAIARYRQKFVSTVMYKPI 1119
            D +    +  PTV +W  GGK+VF+SGSFN W  KIP++KS ++F  I++LP+GEHQYKF VDG W  D  + +  +  G+ NN+I VK SDF+V +ALK D + +S+ S  ++                                SSSPPG Y QE+      SE   E+  +PP+LPP LLQVILNK+T + CDP LLP+PNHVM+NH+YALSIKD V+VLSA  RY++K+V+T++YKPI
Sbjct:   68 DSVKPTQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFDALKLDSMESSETSCRDL--------------------------------SSSPPGPYGQEM--YAFRSE---ERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNHLYALSIKDSVMVLSATHRYKKKYVTTLLYKPI 272          
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. UniProt/SwissProt
Match: sp|Q6PAM0|AAKB2_MOUSE (5'-AMP-activated protein kinase subunit beta-2 OS=Mus musculus OX=10090 GN=Prkab2 PE=1 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 1.103e-58
Identity = 113/242 (46.69%), Postives = 153/242 (63.22%), Query Frame = 1
Query:  397 DGIDSENKTIPTVFKWEGGGKDVFLSGSFNLWKAKIPMVKSKHNFYTIVELPKGEHQYKFIVDGVWKIDNKQHIANNDNGSQNNVISVKSSDFDVLEALK-DDIANSKNSSNNVRQSIVTTVPLKSPGGLNESNKPKDGDNENHLQSSSPPGSYSQELPQKTLLSEIGNEKSPTXXXXXXXXXXVILNKETGVHCDPNLLPQPNHVMINHMYALSIKDGVIVLSAIARYRQKFVSTVMYKPI 1119
            D +    +  PTV +W  GGK+VF+SGSFN W  KIP++KS ++F  I++LP+GEHQYKF VDG W  D  + +  +  G+ NN+I VK SDF+V +ALK D + +S+ S  ++                                SSSPPG Y QE+      SE   E+  +PP+LPP LLQVILNK+T + CDP LLP+PNHVM+NH+YALSIKD V+VLSA  RY++K+V+T++YKPI
Sbjct:   67 DSVKPAQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFDALKLDSMESSETSCRDL--------------------------------SSSPPGPYGQEM--YVFRSE---ERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNHLYALSIKDSVMVLSATHRYKKKYVTTLLYKPI 271          
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. UniProt/SwissProt
Match: sp|Q9R078|AAKB1_MOUSE (5'-AMP-activated protein kinase subunit beta-1 OS=Mus musculus OX=10090 GN=Prkab1 PE=1 SV=2)

HSP 1 Score: 195.667 bits (496), Expect = 1.731e-58
Identity = 112/231 (48.48%), Postives = 148/231 (64.07%), Query Frame = 1
Query:  427 PTVFKWEGGGKDVFLSGSFNLWKAKIPMVKSKHNFYTIVELPKGEHQYKFIVDGVWKIDNKQHIANNDNGSQNNVISVKSSDFDVLEALKDDIANSKNSSNNVRQSIVTTVPLKSPGGLNESNKPKDGDNENHLQSSSPPGSYSQELPQKTLLSEIGNEKSPTXXXXXXXXXXVILNKETGVHCDPNLLPQPNHVMINHMYALSIKDGVIVLSAIARYRQKFVSTVMYKPI 1119
            PTVF+W GGGK+V+LSGSFN W +K+P+ +S++NF  I++LP+GEHQYKF VDG W  D  + I  +  G+ NN+I VK +DF+V +AL  D     + S                                   SSSPPG Y QE      +S+   E+   PP+LPP LLQVILNK+TG+ CDP LLP+PNHVM+NH+YALSIKDGV+VLSA  RY++K+V+T++YKPI
Sbjct:   79 PTVFRWTGGGKEVYLSGSFNNW-SKLPLTRSQNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSE---------------------------------LSSSPPGPYHQE----PYMSK-PEERFKAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI 270          
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. UniProt/SwissProt
Match: sp|P80386|AAKB1_RAT (5'-AMP-activated protein kinase subunit beta-1 OS=Rattus norvegicus OX=10116 GN=Prkab1 PE=1 SV=4)

HSP 1 Score: 195.667 bits (496), Expect = 2.032e-58
Identity = 112/231 (48.48%), Postives = 148/231 (64.07%), Query Frame = 1
Query:  427 PTVFKWEGGGKDVFLSGSFNLWKAKIPMVKSKHNFYTIVELPKGEHQYKFIVDGVWKIDNKQHIANNDNGSQNNVISVKSSDFDVLEALKDDIANSKNSSNNVRQSIVTTVPLKSPGGLNESNKPKDGDNENHLQSSSPPGSYSQELPQKTLLSEIGNEKSPTXXXXXXXXXXVILNKETGVHCDPNLLPQPNHVMINHMYALSIKDGVIVLSAIARYRQKFVSTVMYKPI 1119
            PTVF+W GGGK+V+LSGSFN W +K+P+ +S++NF  I++LP+GEHQYKF VDG W  D  + I  +  G+ NN+I VK +DF+V +AL  D     + S                                   SSSPPG Y QE      +S+   E+   PP+LPP LLQVILNK+TG+ CDP LLP+PNHVM+NH+YALSIKDGV+VLSA  RY++K+V+T++YKPI
Sbjct:   79 PTVFRWTGGGKEVYLSGSFNNW-SKLPLTRSQNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSE---------------------------------LSSSPPGPYHQE----PYISK-PEERFKAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI 270          
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. UniProt/SwissProt
Match: sp|Q9QZH4|AAKB2_RAT (5'-AMP-activated protein kinase subunit beta-2 OS=Rattus norvegicus OX=10116 GN=Prkab2 PE=1 SV=1)

HSP 1 Score: 194.512 bits (493), Expect = 4.564e-58
Identity = 112/242 (46.28%), Postives = 152/242 (62.81%), Query Frame = 1
Query:  397 DGIDSENKTIPTVFKWEGGGKDVFLSGSFNLWKAKIPMVKSKHNFYTIVELPKGEHQYKFIVDGVWKIDNKQHIANNDNGSQNNVISVKSSDFDVLEALK-DDIANSKNSSNNVRQSIVTTVPLKSPGGLNESNKPKDGDNENHLQSSSPPGSYSQELPQKTLLSEIGNEKSPTXXXXXXXXXXVILNKETGVHCDPNLLPQPNHVMINHMYALSIKDGVIVLSAIARYRQKFVSTVMYKPI 1119
            D +    +  PTV +W  GGK+VF+SGSFN W  KIP++KS ++F  I++LP+GEHQYKF VDG W  D  + +  +  G+ NN+I VK SDF+V +ALK D + +S+ S  ++                                SSSPPG Y QE+      SE   E+  +PP+LPP LLQVILNK+T + CDP LLP+PNHVM+NH+YALS KD V+VLSA  RY++K+V+T++YKPI
Sbjct:   67 DSVKPTQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFDALKLDSMESSETSCRDL--------------------------------SSSPPGPYGQEM--YVFRSE---ERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNHLYALSTKDSVMVLSATHRYKKKYVTTLLYKPI 271          
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. TrEMBL
Match: A0A1S8WHQ6 (5'-AMP-activated protein kinase, beta subunit, complex-interacting region OS=Opisthorchis viverrini OX=6198 GN=X801_10251 PE=4 SV=1)

HSP 1 Score: 284.263 bits (726), Expect = 1.909e-89
Identity = 173/355 (48.73%), Postives = 223/355 (62.82%), Query Frame = 1
Query:  139 MGNAPSGSKRRGSNEEEVGINRDILSFGQNIHTGNHSAKKKLIVQPTQDVYEIDAISKILSEADVSD-IEAKFREAKLLES------HPSMCLDGI-DSENKTIPTVFKWEGGGKDVFLSGSFNLWKAKIPMVKSKHNFYTIVELPKGEHQYKFIVDGVWKIDNKQHIANNDNGSQNNVISVKSSDFDVLEALKDDIANSKN------SSNNVRQSIVTTVPLKSPGGLNESNKPKDGDNENHLQSSSPPGSYSQELP---QKTLLSEIG-----------NEKSPTXXXXXXXXXXVILNKETGVHCDPNLLPQPNHVMINHMYALSIKDGVIVLSAIARYRQKFVSTVMYKPI 1119
            MGN   G KRR S EE+             + +GN  A K+ +   +QD    D++  IL+E    D I  + R+++L         +    +DG+ D+  + +PTVFKWEGGGKDV++SG+FN WK+KIPMV+SKHNFYTIV+LP GEHQYKFIVDG WK+D  Q +  +  G QNNVI V+ SDFDVL AL  D+A+S+       S+N +  +  +  P +   G +    P D D+   +  SSPPG Y + +P      + +  G            +K PTPPLLPPQLLQVILN++T V CDPNLLPQP+HVM+NHMYALSIKDGVIVLSAI RYRQKFVSTV+YKPI
Sbjct:    1 MGNTSGGHKRRSSLEED-------------LSSGN--AVKRQMFHESQDYPGDDSVISILTEGVAIDAIAEQLRDSRLCSLGDKGMLYVGGGMDGVEDNVPQNVPTVFKWEGGGKDVYISGTFNGWKSKIPMVRSKHNFYTIVDLPLGEHQYKFIVDGQWKLDQNQPVMASATGIQNNVIQVRESDFDVLTALSYDMASSRGGTGGDESTNTMGSTATSGTPQRGETGTHHEVGPVDSDS-FLMGGSSPPGDYGRFIPPNLSAAVQASTGPTHHSPHSSSDPKKMPTPPLLPPQLLQVILNRDTNVQCDPNLLPQPDHVMVNHMYALSIKDGVIVLSAITRYRQKFVSTVLYKPI 339          
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. TrEMBL
Match: A0A074Z4A1 (AMPKBI domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_09888 PE=4 SV=1)

HSP 1 Score: 279.256 bits (713), Expect = 1.607e-87
Identity = 173/357 (48.46%), Postives = 223/357 (62.46%), Query Frame = 1
Query:  139 MGNAPSGSKRRGSNEEEVGINRDILSFGQNIHTGNHSAKKKLIVQPTQDVYEIDAISKILSEADVSD-IEAKFREAKLLES------HPSMCLDGI-DSENKTIPTVFKWEGGGKDVFLSGSFNLWKAKIPMVKS--KHNFYTIVELPKGEHQYKFIVDGVWKIDNKQHIANNDNGSQNNVISVKSSDFDVLEALKDDIANSKN------SSNNVRQSIVTTVPLKSPGGLNESNKPKDGDNENHLQSSSPPGSYSQELP---QKTLLSEIGN-----------EKSPTXXXXXXXXXXVILNKETGVHCDPNLLPQPNHVMINHMYALSIKDGVIVLSAIARYRQKFVSTVMYKPI 1119
            MGN   G KRR S EE+             + +GN  A K+ +   +QD    D++  IL+E    D I  + R+++L         +    +DG+ D+  + +PTVFKWEGGGKDV++SG+FN WK+KIPMV+S  KHNFYTIV+LP GEHQYKFIVDG WK+D  Q +  +  G QNNVI V+ SDFDVL AL  D+A+S+       S+N +  +  +  P +   G +    P D D+   +  SSPPG Y + +P      + +  G            +K PTPPLLPPQLLQVILN++T V CDPNLLPQP+HVM+NHMYALSIKDGVIVLSAI RYRQKFVSTV+YKPI
Sbjct:    1 MGNTSGGHKRRSSLEED-------------LSSGN--AVKRQMFHESQDYPGDDSVISILTEGVAIDAIAEQLRDSRLCSLGDKGMLYVGGGMDGVEDNVPQNVPTVFKWEGGGKDVYISGTFNGWKSKIPMVRSSSKHNFYTIVDLPLGEHQYKFIVDGQWKLDQNQPVMASATGIQNNVIQVRESDFDVLTALSYDMASSRGGTGGDESTNTMGSTATSGTPQRGETGTHHEVGPVDSDSF-LMGGSSPPGDYGRFIPPNLSAAVQASTGPTHHSPHSSSDPKKMPTPPLLPPQLLQVILNRDTNVQCDPNLLPQPDHVMVNHMYALSIKDGVIVLSAITRYRQKFVSTVLYKPI 341          
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. TrEMBL
Match: A0A4S2LIV9 (AMPKBI domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_006869 PE=4 SV=1)

HSP 1 Score: 275.018 bits (702), Expect = 8.962e-86
Identity = 170/357 (47.62%), Postives = 222/357 (62.18%), Query Frame = 1
Query:  139 MGNAPSGSKRRGSNEEEVGINRDILSFGQNIHTGNHSAKKKLIVQPTQDVYEIDAISKILSEADVSD-IEAKFREAKLLES------HPSMCLDGI-DSENKTIPTVFKWEGGGKDVFLSGSFNLWKAKIPMVKS--KHNFYTIVELPKGEHQYKFIVDGVWKIDNKQHIANNDNGSQNNVISVKSSDFDVLEALKDDIANSKN------SSNNVRQSIVTTVPLKSPGGLNESNKPKDGDNENHLQSSSPPGSYSQELP---QKTLLSEIGN-----------EKSPTXXXXXXXXXXVILNKETGVHCDPNLLPQPNHVMINHMYALSIKDGVIVLSAIARYRQKFVSTVMYKPI 1119
            MGN   G KRR S +E+               +G ++ K+++  +P QD    D++  IL+E    D I  + R+++L         +    +DG+ D+  + +PTVFKWEGGGKDV++SG+FN WK+KIPMV+S  KHNFYTIV+LP GEHQYKFIVDG WK+D  Q +  +  G QNNVI V+ SDFDVL AL  D+A+S+       S+N +     +  P +   G +      D D+   +  SSPPG Y + +P      + +  G            +K PTPPLLPPQLLQVILN++T V CDPNLLPQP+HVM+NHMYALSIKDGVIVLSAI RYRQKFVSTV+YKPI
Sbjct:    1 MGNTSGGHKRRSSLDEDF--------------SGGNAVKRQMFHEP-QDYPGDDSVISILTEGVAIDAIAEQLRDSRLCSLGDKGMLYVGGGMDGVEDNVPQNVPTVFKWEGGGKDVYISGTFNGWKSKIPMVRSSSKHNFYTIVDLPLGEHQYKFIVDGQWKLDQNQPVMASATGIQNNVIQVRESDFDVLTALSYDMASSRGGTGVDESTNTISSMATSGTPQRGETGAHHEVGLVDSDS-FLMGGSSPPGEYGRFIPPNLSAAVQASTGPTHHSPHSSSDPKKMPTPPLLPPQLLQVILNRDTNVQCDPNLLPQPDHVMVNHMYALSIKDGVIVLSAITRYRQKFVSTVLYKPI 341          
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. TrEMBL
Match: A0A068WKH4 (AMPK beta subunit OS=Echinococcus granulosus OX=6210 GN=EgrG_000423400 PE=4 SV=1)

HSP 1 Score: 273.478 bits (698), Expect = 1.737e-85
Identity = 166/344 (48.26%), Postives = 218/344 (63.37%), Query Frame = 1
Query:  139 MGNAPSGSKRRGSNEEEVGINRDILSFGQNIHTGNHSAKKKLIVQPTQDVYEIDAISKILSEA-DVSDIEAKFREAKLLES--HPSMCLDGIDS------------ENKTIPTVFKWEGGGKDVFLSGSFNLWKAKIPMVKSKHNFYTIVELPKGEHQYKFIVDGVWKIDNKQHIANNDNGSQNNVISVKSSDFDVLEALKD-DIANSKNSSNNVRQSIVTTVPLKSPGGLNESNKPKDGDNENHLQSSSPPGSYSQELPQKTLLSEIG-NEKSPTXXXXXXXXXXVILNKETGVHCDPNLLPQPNHVMINHMYALSIKDGVIVLSAIARYRQKFVSTVMYKPI 1119
            MGN P  SKRR S EEE   +  ++S         +  K+K I+Q +Q V + D +  IL+E   +  I  + R +++ ++   P + +D + S             + T+PTVFKWEGGGK+V++SG+FN WK+KIPMVKSK NFYTI++LP+GEHQYKFIVDG WK+   Q    +  G QNN+I+V  SDFDV+EAL + D   + +S       ++ + PL   GG      P  G       + +PP   +    Q T L+ +G + KS  PPLLPPQLLQVILN++T   CDPNLLPQPNHVM+NHMYALSIKDGVIVLSAI+RYRQKFVSTV+YKPI
Sbjct:    1 MGNTPGTSKRRSSIEEEYTGSVGVMS------NPYYPPKRKFILQASQAVNDDDPVVSILTEGHTIEAIANQLRNSRIQDAPERPCVFMDVVGSPESSGDTTDETPSHTTLPTVFKWEGGGKEVYISGTFNGWKSKIPMVKSKQNFYTIIDLPEGEHQYKFIVDGQWKLGKNQPTTTSPTGVQNNIITVNMSDFDVIEALTNMDAVPTGSSPPGEYGQVIPSNPLTGLGG------PGSG------VACAPPHIGASSNTQPTALTTLGVDAKSSKPPLLPPQLLQVILNRDTNAQCDPNLLPQPNHVMLNHMYALSIKDGVIVLSAISRYRQKFVSTVLYKPI 326          
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. TrEMBL
Match: A0A068XX85 (AMPK beta subunit OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000423400 PE=4 SV=1)

HSP 1 Score: 271.937 bits (694), Expect = 8.603e-85
Identity = 168/344 (48.84%), Postives = 218/344 (63.37%), Query Frame = 1
Query:  139 MGNAPSGSKRRGSNEEEVGINRDILSFGQNIHTGNHSAKKKLIVQPTQDVYEIDAISKILSEA-DVSDIEAKFREAKLLES--HPSMCLDGIDS------------ENKTIPTVFKWEGGGKDVFLSGSFNLWKAKIPMVKSKHNFYTIVELPKGEHQYKFIVDGVWKIDNKQHIANNDNGSQNNVISVKSSDFDVLEALKD-DIANSKNSSNNVRQSIVTTVPLKSPGGLNESNKPKDGDNENHLQSSSPPGSYSQELPQKTLLSEIG-NEKSPTXXXXXXXXXXVILNKETGVHCDPNLLPQPNHVMINHMYALSIKDGVIVLSAIARYRQKFVSTVMYKPI 1119
            MGN P  SKRR S EEE   +  ++S         +  K+K I+Q +Q V + D I  IL+E   +  I  + R +++ ++   P + +D + S             + T+PTVFKWEGGGK+V++SG+FN WK+KIPMVKSK NFYTI++LP+GEHQYKFIVDG WK+   Q    +  G QNN+I+V  SDFDV+EAL + D   + +S       ++ + PL   GG      P  G     +  +SP    S    Q T L+ +G + KS  PPLLPPQLLQVILN++T   CDPNLLPQPNHVM+NHMYALSIKDGVIVLSAI+RYRQKFVSTV+YKPI
Sbjct:    1 MGNTPGTSKRRSSIEEEYTGSVGVMS------NPYYPPKRKFILQASQAVNDDDPIVSILTEGHTIEAIANQLRNSRIQDAPERPCVFMDVVGSPELSGDTSDETPSHTTLPTVFKWEGGGKEVYISGTFNGWKSKIPMVKSKQNFYTIIDLPEGEHQYKFIVDGQWKLGKNQPTTTSPTGVQNNIITVNMSDFDVIEALTNMDAVPTGSSPPGEYGQVIPSNPLTGLGG------PGSG-----VACASPHIGASSNT-QPTALTTLGVDTKSSKPPLLPPQLLQVILNRDTNAQCDPNLLPQPNHVMLNHMYALSIKDGVIVLSAISRYRQKFVSTVLYKPI 326          
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. Ensembl Cavefish
Match: prkab1b (5'-AMP-activated protein kinase subunit beta-1 [Source:NCBI gene;Acc:103026611])

HSP 1 Score: 202.216 bits (513), Expect = 4.833e-62
Identity = 112/231 (48.48%), Postives = 146/231 (63.20%), Query Frame = 1
Query:  427 PTVFKWEGGGKDVFLSGSFNLWKAKIPMVKSKHNFYTIVELPKGEHQYKFIVDGVWKIDNKQHIANNDNGSQNNVISVKSSDFDVLEALKDDIANSKNSSNNVRQSIVTTVPLKSPGGLNESNKPKDGDNENHLQSSSPPGSYSQELPQKTLLSEIGNEKSPTXXXXXXXXXXVILNKETGVHCDPNLLPQPNHVMINHMYALSIKDGVIVLSAIARYRQKFVSTVMYKPI 1119
            PTVF+W G  KDV++SGSFN W  KIP+ KS  NF  +V+LP+GEHQYKF VDG W +D KQ +  + +G+ NN+I VK +DF+V +ALK D     + S+                                  S SPPG Y QE       S    ++  +PP+LPP LLQV+LNK+TGV CDP LLP+PNHVM+NH+YALSIKDGV+VLSA  RY++K+V+T++YKPI
Sbjct:   66 PTVFRWTGPAKDVYVSGSFNNWANKIPLSKSHSNFVAVVDLPEGEHQYKFYVDGNWTLDPKQPVVTSKSGTVNNIIQVKKTDFEVFDALKTDSEKCADMSD---------------------------------MSGSPPGPYHQE-----PYSTKSEDRLRSPPILPPHLLQVLLNKDTGVSCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI 258          
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. Ensembl Cavefish
Match: prkab1a (5'-AMP-activated protein kinase subunit beta-1-like [Source:NCBI gene;Acc:111195052])

HSP 1 Score: 200.29 bits (508), Expect = 3.783e-61
Identity = 117/261 (44.83%), Postives = 159/261 (60.92%), Query Frame = 1
Query:  337 DIEAKFREAKLLESHPSMCLDGIDSENKTIPTVFKWEGGGKDVFLSGSFNLWKAKIPMVKSKHNFYTIVELPKGEHQYKFIVDGVWKIDNKQHIANNDNGSQNNVISVKSSDFDVLEALKDDIANSKNSSNNVRQSIVTTVPLKSPGGLNESNKPKDGDNENHLQSSSPPGSYSQELPQKTLLSEIGNEKSPTXXXXXXXXXXVILNKETGVHCDPNLLPQPNHVMINHMYALSIKDGVIVLSAIARYRQKFVSTVMYKPI 1119
            D++A   + + L+      L+G D      PTVF+W G G++V++SGSFN W  KIP+ +S++NF  IV+LP+GEHQYKF VDG W  D  + +  N  G+ NN+I VK +DF+V +AL  D     + S+                                  SSSPPG Y Q+     L     +EK  +PP+LPP LLQVILNK+TG+ CDP LLP+PNHVM+NH+YALSIKDGV+VLSA  RY++K+V+T++YKPI
Sbjct:   48 DMKAPLEKEEFLDWRQE--LEGGDKGLLARPTVFRWTGSGREVYISGSFNNWTNKIPLTRSQNNFVAIVDLPEGEHQYKFYVDGQWTHDPTEPVVTNQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDMSD---------------------------------LSSSPPGPYHQDAYVPKL-----DEKFKSPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI 268          
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. Ensembl Cavefish
Match: PRKAB2 (5'-AMP-activated protein kinase subunit beta-2-like [Source:NCBI gene;Acc:103047649])

HSP 1 Score: 189.889 bits (481), Expect = 3.147e-57
Identity = 106/231 (45.89%), Postives = 145/231 (62.77%), Query Frame = 1
Query:  427 PTVFKWEGGGKDVFLSGSFNLWKAKIPMVKSKHNFYTIVELPKGEHQYKFIVDGVWKIDNKQHIANNDNGSQNNVISVKSSDFDVLEALKDDIANSKNSSNNVRQSIVTTVPLKSPGGLNESNKPKDGDNENHLQSSSPPGSYSQELPQKTLLSEIGNEKSPTXXXXXXXXXXVILNKETGVHCDPNLLPQPNHVMINHMYALSIKDGVIVLSAIARYRQKFVSTVMYKPI 1119
            PTV +W GGGK+V+++GSFN W  KIP+ KS ++F  I++LP+GEHQYKF VDG W  D  + +  +  G+ NN+I VK SDF+V +AL+ D     ++S+                                  SSSPPG Y QE+    +       K+P   +LPP LLQVILNK+T + CDP LLP+PNHVM+NH+YALSIKDGV+VLSA  RY++K+V++++YKPI
Sbjct:   75 PTVIRWGGGGKEVYIAGSFNNWSTKIPLNKSHNDFVAILDLPEGEHQYKFFVDGQWLHDPSEPVVTSQMGTINNLIQVKKSDFEVFDALQVDSLECSDTSD---------------------------------LSSSPPGPYGQEV---YMFRPEERFKAPP--ILPPHLLQVILNKDTNISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTSLLYKPI 267          
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. Ensembl Cavefish
Match: prkab1b (5'-AMP-activated protein kinase subunit beta-1 [Source:NCBI gene;Acc:103026611])

HSP 1 Score: 184.882 bits (468), Expect = 3.414e-55
Identity = 106/225 (47.11%), Postives = 137/225 (60.89%), Query Frame = 1
Query:  427 PTVFKWEGGGKDVFLSGSFNLWKAKIPMVKSKHNFYTIVELPKGEHQYKFIVDGVWKIDNKQHIANNDNGSQNNVISVKSSDFDVLEALKDDIANSKNSSNNVRQSIVTTVPLKSPGGLNESNKPKDGDNENHLQSSSPPGSYSQELPQKTLLSEIGNEKSPTXXXXXXXXXXVILNKETGVHCDPNLLPQPNHVMINHMYALSIKDGVIVLSAIARYRQKFVST 1101
            PTVF+W G  KDV++SGSFN W  KIP+ KS  NF  +V+LP+GEHQYKF VDG W +D KQ +  + +G+ NN+I VK +DF+V +ALK D     + S+                                  S SPPG Y QE       S    ++  +PP+LPP LLQV+LNK+TGV CDP LLP+PNHVM+NH+YALSIKDGV+VLSA  RY++   S+
Sbjct:   66 PTVFRWTGPAKDVYVSGSFNNWANKIPLSKSHSNFVAVVDLPEGEHQYKFYVDGNWTLDPKQPVVTSKSGTVNNIIQVKKTDFEVFDALKTDSEKCADMSD---------------------------------MSGSPPGPYHQE-----PYSTKSEDRLRSPPILPPHLLQVLLNKDTGVSCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKNAASS 252          
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. Ensembl Cavefish
Match: prkab1a (5'-AMP-activated protein kinase subunit beta-1-like [Source:NCBI gene;Acc:111195052])

HSP 1 Score: 164.081 bits (414), Expect = 1.625e-47
Identity = 102/238 (42.86%), Postives = 137/238 (57.56%), Query Frame = 1
Query:  337 DIEAKFREAKLLESHPSMCLDGIDSENKTIPTVFKWEGGGKDVFLSGSFNLWKAKIPMVKSKHNFYTIVELPKGEHQYKFIVDGVWKIDNKQHIANNDNGSQNNVISVKSSDFDVLEALKDDIANSKNSSNNVRQSIVTTVPLKSPGGLNESNKPKDGDNENHLQSSSPPGSYSQELPQKTLLSEIGNEKSPTXXXXXXXXXXVILNKETGVHCDPNLLPQPNHVMINHMYALSIKDG 1050
            D++A   + + L+      L+G D      PTVF+W G G++V++SGSFN W  KIP+ +S++NF  IV+LP+GEHQYKF VDG W  D  + +  N  G+ NN+I VK +DF+V +AL  D     + S+                                  SSSPPG Y Q+     L     +EK  +PP+LPP LLQVILNK+TG+ CDP LLP+PNHVM+NH+YALSIK G
Sbjct:   48 DMKAPLEKEEFLDWRQE--LEGGDKGLLARPTVFRWTGSGREVYISGSFNNWTNKIPLTRSQNNFVAIVDLPEGEHQYKFYVDGQWTHDPTEPVVTNQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDMSD---------------------------------LSSSPPGPYHQDAYVPKL-----DEKFKSPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKVG 245          
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. Ensembl Yeast
Match: SIP2 (One of three beta subunits of the Snf1 kinase complex; involved in the response to glucose starvation; null mutants exhibit accelerated aging; N-myristoylprotein localized to the cytoplasm and the plasma membrane; SIP2 has a paralog, GAL83, that arose from the whole genome duplication [Source:SGD;Acc:S000003176])

HSP 1 Score: 89.3521 bits (220), Expect = 7.085e-20
Identity = 77/256 (30.08%), Postives = 121/256 (47.27%), Query Frame = 1
Query:  424 IPTVFKWEGGGKDVFLSGSFNLWKAKIPMVKSKHN---FYTIVELPKGEHQYKFIVDGVWKIDNKQHIANNDNGSQNNVISVKSSDFDVL-EALKDDIANSKNSSNNVRQSIVTTVPLKSPGGLNESNKPKDGDNENHLQ-SSSPPGSYSQELPQ------------KTLLSEIGNEKSP--TXXXXXXXXXXVILNKETGVHCDPN-----LLPQPNHVMINHMYALSIKDGVIVLSAIARYRQKFVSTVMYKPI 1119
            +P   +W+ GG  V+++GSF  W+  I ++    N   F+  + L  G H+++FIVD   ++ +    A +  G+  N I V+  + +   E ++   A+S     + R SI   +  K P          DG    H   S  PP  Y+ ++P              TL  +  N  +   TPP LPPQL  VILNK        N      LP PNHV++NH+   SIK   + +++I RY+QK+V+ ++Y PI
Sbjct:  164 VPVEIRWQQGGSKVYVTGSFTKWRKMIGLIPDSDNNGSFHVKLRLLPGTHRFRFIVDNELRVSDFLPTATDQMGNFVNYIEVRQPEKNPTNEKIRSKEADSMRPPTSDRSSIALQI-GKDPDDFG------DGYTRFHEDLSPRPPLEYTTDIPAVFTDPSVMERYYYTLDRQQSNTDTSWLTPPQLPPQLENVILNKYYATQDQFNENNSGALPIPNHVVLNHLVTSSIKHNTLCVASIVRYKQKYVTQILYTPI 412          
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. Ensembl Yeast
Match: GAL83 (One of three possible beta-subunits of the Snf1 kinase complex; allows nuclear localization of the Snf1 kinase complex in the presence of a nonfermentable carbon source; necessary and sufficient for phosphorylation of the Mig2p transcription factor in response to alkaline stress; functionally redundant with SIP1 and SIP2 for the phosphorylation of Mig1p in response to glucose deprivation; contains a glycogen-binding domain [Source:SGD;Acc:S000000829])

HSP 1 Score: 82.4185 bits (202), Expect = 1.243e-17
Identity = 76/269 (28.25%), Postives = 126/269 (46.84%), Query Frame = 1
Query:  391 CLDGIDSENKTIPTVFKWEGGGKDVFLSGSFNLWKAKI---PMVKSKHNFYTIVELPKGEHQYKFIVDGVWKIDNKQHIANNDNGSQNNVISVKSSDFDVLEALKDDIANSKNSSNNVRQSIVTTVPL--KSPGGLNESNKPKD-GDNENHLQSSSPPG---SYSQELPQ------------KTLLSEIGNEKSP---TXXXXXXXXXXVILNKETGVHCD--PNLLPQPNHVMINHMYALSIKDGVIVLSAIARYRQKFVSTVMYKPI 1119
             ++G        P    W+ GG  V+++GSF  W+  I   P+       +  ++LP G H+++FIVD   +  +    A +  G+  N + V S+  D     +  +A  K  +N+V  S ++  P+  +S   L    +P D GD        +P      Y+Q++P              TL  +  N ++    TPP LPP L  VILN  +    D     LP PNHV++NH+   SIK   + +++I RY+QK+V+ ++Y P+
Sbjct:  151 TVEGKKGRAMMFPVDITWQQGGNKVYVTGSFTGWRKMIGLVPVPGQPGLMHVKLQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYMEV-SAPPDWGNEPQQHLAEKK--ANHVDDSKLSKRPMSARSRIALEIEKEPDDMGDGYTRFHDETPAKPNLEYTQDIPAVFTDPNVMEQYYLTLDQQQNNHQNMAWLTPPQLPPHLENVILNSYSNAQTDNTSGALPIPNHVILNHLATSSIKHNTLCVASIVRYKQKYVTQILYTPL 416          
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. Ensembl Yeast
Match: CRP1 (Protein that binds to cruciform DNA structures; CRP1 has a paralog, MDG1, that arose from the whole genome duplication [Source:SGD;Acc:S000001189])

HSP 1 Score: 59.6918 bits (143), Expect = 3.226e-10
Identity = 30/84 (35.71%), Postives = 48/84 (57.14%), Query Frame = 1
Query:  433 VFKWEGGGKDVFLSGSFNLWKAKIPMVKS-KHNFYTIVELPKG----EHQYKFIVDGVWKIDN---KQHIANNDNGSQNNVISV 660
             F W  G KDV L+G+F+ W+  +P+VK+ K NF   + +         Q+KFIVDGVW + +   K+H++    G +NN + +
Sbjct:   10 TFSWPAGPKDVILTGTFDDWRGTLPLVKTAKGNFEITMPVKLANKDDTFQFKFIVDGVWCVSDSYKKEHVS---EGIENNFLQI 90          
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. Ensembl Yeast
Match: MDG1 (Plasma membrane protein; involved in G-protein mediated pheromone signaling pathway; overproduction suppresses bem1 mutations; MDG1 has a paralog, CRP1, that arose from the whole genome duplication [Source:SGD;Acc:S000005117])

HSP 1 Score: 58.9214 bits (141), Expect = 5.283e-10
Identity = 29/80 (36.25%), Postives = 44/80 (55.00%), Query Frame = 1
Query:  433 VFKWEGGGKDVFLSGSFNLWKAKIPMVKSKHNFYTIV-----ELPKGEHQYKFIVDGVWKIDNKQHIANNDNGSQNNVIS 657
             FKW  G + + L+G+F+ WK  +PMVK     + I      + P  +  +KFIVDG W + +K +  N D G +NN I+
Sbjct:    9 TFKWPKGPEAIILTGTFDDWKGTLPMVKDPSGAFEITLPVTFDSPSSKFYFKFIVDGQW-LPSKDYKVNIDEGVENNFIT 87          
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. Ensembl Nematostella
Match: EDO33540 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRX9])

HSP 1 Score: 183.726 bits (465), Expect = 3.775e-55
Identity = 109/236 (46.19%), Postives = 143/236 (60.59%), Query Frame = 1
Query:  421 TIPTVFKWEGGGKDVFLSGSFNLWKAKIPMVKSKHNFYTIVELPKGEHQYKFIVDGVWKIDNKQHIANNDNGSQNNVISVKSSDFDVLEALKDDIANSKNSSNNVRQSIVTTVPLKSPGGLNESNKPKDGDNENHLQSSSPPGSYSQELPQ---KTLLSEIGNEKSPTXXXXXXXXXXVILNKETGVHCDPNLLPQPNHVMINHMYALSIKDGVIVLSAIARYRQKFVSTVMYKPI 1119
            TIPTV +WE GG+ V LSGSFN WK +IPM  S + F  I+ELP+G+H+YKF VDG W  D      N++ G +NNVISV+ +D DV +AL  D   S NS +           +KS  G                   SPPG+Y Q +P      ++ +  N   P   +LPP LL VILNK+   H DP+LLP+P++V +NH+YALSIKDGV+ LSA  RYR+KFV+T++YKPI
Sbjct:   68 TIPTVIRWENGGRKVLLSGSFNDWKTRIPMNYSNNEFTAIIELPEGDHEYKFCVDGRWVHDPNGPTTNDNFGGRNNVISVRKTDMDVFDALDTDANLSINSGS-----------IKSVSG-------------------SPPGTYGQIIPSHVTPVIVRDGTNASVPP--ILPPHLLHVILNKDIVDHDDPSLLPEPDYVSLNHLYALSIKDGVMTLSATFRYREKFVTTLLYKPI 271          
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. Ensembl Medaka
Match: prkab1b (5'-AMP-activated protein kinase subunit beta-1 [Source:NCBI gene;Acc:101165238])

HSP 1 Score: 200.675 bits (509), Expect = 2.012e-61
Identity = 110/231 (47.62%), Postives = 145/231 (62.77%), Query Frame = 1
Query:  427 PTVFKWEGGGKDVFLSGSFNLWKAKIPMVKSKHNFYTIVELPKGEHQYKFIVDGVWKIDNKQHIANNDNGSQNNVISVKSSDFDVLEALKDDIANSKNSSNNVRQSIVTTVPLKSPGGLNESNKPKDGDNENHLQSSSPPGSYSQELPQKTLLSEIGNEKSPTXXXXXXXXXXVILNKETGVHCDPNLLPQPNHVMINHMYALSIKDGVIVLSAIARYRQKFVSTVMYKPI 1119
            PTVF+W G  K+VF+SGSFN W  KIP+ +S+ NF  IV+LP+G+HQYKF VDG W +D    +A +  GS NNVI VK +DF+V +AL+ D  +S + S+                                  SSSPPG Y Q      ++      K P   +LPP LLQV+LNK+TG+ CDP LLP+PNHVM+NH+YALSIKDGV+VLSA  RY++K+V+T++YKPI
Sbjct:   73 PTVFRWAGAAKEVFVSGSFNNWATKIPLNRSQKNFVAIVDLPEGDHQYKFCVDGQWTLDPAGAVATSKTGSVNNVIQVKRTDFEVFDALRIDSEDSADMSD---------------------------------LSSSPPGPYQQ---NAYVMKPEDKLKQPP--ILPPHLLQVLLNKDTGISCDPTLLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI 265          
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. Ensembl Medaka
Match: prkab1b (5'-AMP-activated protein kinase subunit beta-1 [Source:NCBI gene;Acc:101165238])

HSP 1 Score: 200.675 bits (509), Expect = 2.012e-61
Identity = 110/231 (47.62%), Postives = 145/231 (62.77%), Query Frame = 1
Query:  427 PTVFKWEGGGKDVFLSGSFNLWKAKIPMVKSKHNFYTIVELPKGEHQYKFIVDGVWKIDNKQHIANNDNGSQNNVISVKSSDFDVLEALKDDIANSKNSSNNVRQSIVTTVPLKSPGGLNESNKPKDGDNENHLQSSSPPGSYSQELPQKTLLSEIGNEKSPTXXXXXXXXXXVILNKETGVHCDPNLLPQPNHVMINHMYALSIKDGVIVLSAIARYRQKFVSTVMYKPI 1119
            PTVF+W G  K+VF+SGSFN W  KIP+ +S+ NF  IV+LP+G+HQYKF VDG W +D    +A +  GS NNVI VK +DF+V +AL+ D  +S + S+                                  SSSPPG Y Q      ++      K P   +LPP LLQV+LNK+TG+ CDP LLP+PNHVM+NH+YALSIKDGV+VLSA  RY++K+V+T++YKPI
Sbjct:   73 PTVFRWAGAAKEVFVSGSFNNWATKIPLNRSQKNFVAIVDLPEGDHQYKFCVDGQWTLDPAGAVATSKTGSVNNVIQVKRTDFEVFDALRIDSEDSADMSD---------------------------------LSSSPPGPYQQ---NAYVMKPEDKLKQPP--ILPPHLLQVLLNKDTGISCDPTLLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI 265          
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. Ensembl Medaka
Match: PRKAB2 (5'-AMP-activated protein kinase subunit beta-2 [Source:NCBI gene;Acc:101166167])

HSP 1 Score: 190.274 bits (482), Expect = 2.390e-57
Identity = 108/241 (44.81%), Postives = 148/241 (61.41%), Query Frame = 1
Query:  397 DGIDSENKTIPTVFKWEGGGKDVFLSGSFNLWKAKIPMVKSKHNFYTIVELPKGEHQYKFIVDGVWKIDNKQHIANNDNGSQNNVISVKSSDFDVLEALKDDIANSKNSSNNVRQSIVTTVPLKSPGGLNESNKPKDGDNENHLQSSSPPGSYSQELPQKTLLSEIGNEKSPTXXXXXXXXXXVILNKETGVHCDPNLLPQPNHVMINHMYALSIKDGVIVLSAIARYRQKFVSTVMYKPI 1119
            D + + ++  PTV +W GGGK+V+++GSFN W  KIP+ KS ++F  I++LP+GEHQYKF VDG W  D  + +  +  G+ NN+I VK SDF+V +AL+ D     ++S+                                  SSSPPG Y QE  Q     E   +  P    LPP LLQVILNK+T + CDP LLP+PNHVM+NH+YALSIKDGV+VLSA  RY++K+V++++YKPI
Sbjct:   66 DLVKTASQARPTVIRWGGGGKEVYIAGSFNNWNTKIPLNKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIQVKKSDFEVFDALQVDSLECSDTSD---------------------------------LSSSPPGPYGQE--QYIFRPEKHFKAPPI---LPPHLLQVILNKDTNISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTSLLYKPI 268          
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. Ensembl Medaka
Match: prkab1a (5'-AMP-activated protein kinase subunit beta-1 [Source:NCBI gene;Acc:101155912])

HSP 1 Score: 188.348 bits (477), Expect = 1.444e-56
Identity = 112/233 (48.07%), Postives = 150/233 (64.38%), Query Frame = 1
Query:  427 PTVFKWEGGGKDVFLSGSFNLWKAKIPMVKSKHNFYTIVELPKGEHQYKFIVDGVWKIDNKQHIANNDNGSQNNVISVKSSDFDVLEALKDDIANSKNSSNNVRQSIVTTVPLKSPGGLNESNKPKDGDNENHLQSSSPPGSYSQE--LPQKTLLSEIGNEKSPTXXXXXXXXXXVILNKETGVHCDPNLLPQPNHVMINHMYALSIKDGVIVLSAIARYRQKFVSTVMYKPI 1119
            PTVF+W G GK+VF+SGSFN W  KIP+++S++ F  IV+LP+GEHQYKF VDG W  D  + +  +  G+ NN+I VK +DF+V +AL  D   S + S+                                  SSSPPG Y Q+  +P++        EK  +PP+LPP LLQVILNK+TG+ CDP LLP+PNHVM+NH+YALSIKDGV+VLSA  RY++K+V+T++YKPI
Sbjct:   77 PTVFRWTGDGKEVFVSGSFNNWANKIPLIRSQNTFVAIVDLPEGEHQYKFYVDGQWTHDPTEPVITSQLGTVNNIIQVKKTDFEVFDALMVDSQKSSDMSDL---------------------------------SSSPPGPYHQDPYVPKQ-------EEKFKSPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI 269          
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. Ensembl Medaka
Match: prkab1a (5'-AMP-activated protein kinase subunit beta-1 [Source:NCBI gene;Acc:101155912])

HSP 1 Score: 140.969 bits (354), Expect = 1.573e-39
Identity = 92/202 (45.54%), Postives = 124/202 (61.39%), Query Frame = 1
Query:  520 KHNFYTIVELPKGEHQYKFIVDGVWKIDNKQHIANNDNGSQNNVISVKSSDFDVLEALKDDIANSKNSSNNVRQSIVTTVPLKSPGGLNESNKPKDGDNENHLQSSSPPGSYSQE--LPQKTLLSEIGNEKSPTXXXXXXXXXXVILNKETGVHCDPNLLPQPNHVMINHMYALSIKDGVIVLSAIARYRQKFVSTVMYKPI 1119
            ++ F  IV+LP+GEHQYKF VDG W  D  + +  +  G+ NN+I VK +DF+V +AL  D   S + S+                                  SSSPPG Y Q+  +P++        EK  +PP+LPP LLQVILNK+TG+ CDP LLP+PNHVM+NH+YALSIKDGV+VLSA  RY++K+V+T++YKPI
Sbjct:   24 QNTFVAIVDLPEGEHQYKFYVDGQWTHDPTEPVITSQLGTVNNIIQVKKTDFEVFDALMVDSQKSSDMSDL---------------------------------SSSPPGPYHQDPYVPKQ-------EEKFKSPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI 185          
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. Planmine SMEST
Match: SMESG000080480.1 (SMESG000080480.1)

HSP 1 Score: 644.04 bits (1660), Expect = 0.000e+0
Identity = 327/327 (100.00%), Postives = 327/327 (100.00%), Query Frame = 1
Query:  139 MGNAPSGSKRRGSNEEEVGINRDILSFGQNIHTGNHSAKKKLIVQPTQDVYEIDAISKILSEADVSDIEAKFREAKLLESHPSMCLDGIDSENKTIPTVFKWEGGGKDVFLSGSFNLWKAKIPMVKSKHNFYTIVELPKGEHQYKFIVDGVWKIDNKQHIANNDNGSQNNVISVKSSDFDVLEALKDDIANSKNSSNNVRQSIVTTVPLKSPGGLNESNKPKDGDNENHLQSSSPPGSYSQELPQKTLLSEIGNEKSPTXXXXXXXXXXVILNKETGVHCDPNLLPQPNHVMINHMYALSIKDGVIVLSAIARYRQKFVSTVMYKPI 1119
            MGNAPSGSKRRGSNEEEVGINRDILSFGQNIHTGNHSAKKKLIVQPTQDVYEIDAISKILSEADVSDIEAKFREAKLLESHPSMCLDGIDSENKTIPTVFKWEGGGKDVFLSGSFNLWKAKIPMVKSKHNFYTIVELPKGEHQYKFIVDGVWKIDNKQHIANNDNGSQNNVISVKSSDFDVLEALKDDIANSKNSSNNVRQSIVTTVPLKSPGGLNESNKPKDGDNENHLQSSSPPGSYSQELPQKTLLSEIGNEKSPTPPLLPPQLLQVILNKETGVHCDPNLLPQPNHVMINHMYALSIKDGVIVLSAIARYRQKFVSTVMYKPI
Sbjct:    1 MGNAPSGSKRRGSNEEEVGINRDILSFGQNIHTGNHSAKKKLIVQPTQDVYEIDAISKILSEADVSDIEAKFREAKLLESHPSMCLDGIDSENKTIPTVFKWEGGGKDVFLSGSFNLWKAKIPMVKSKHNFYTIVELPKGEHQYKFIVDGVWKIDNKQHIANNDNGSQNNVISVKSSDFDVLEALKDDIANSKNSSNNVRQSIVTTVPLKSPGGLNESNKPKDGDNENHLQSSSPPGSYSQELPQKTLLSEIGNEKSPTPPLLPPQLLQVILNKETGVHCDPNLLPQPNHVMINHMYALSIKDGVIVLSAIARYRQKFVSTVMYKPI 327          
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. Planmine SMEST
Match: SMESG000018914.1 (SMESG000018914.1)

HSP 1 Score: 129.028 bits (323), Expect = 2.943e-34
Identity = 92/239 (38.49%), Postives = 117/239 (48.95%), Query Frame = 1
Query:  406 DSENKTIPTVFKWEGGGKDVFLSGSFNLWKAKIPMVKSKHNFYTIVELPKGEHQYKFIVDGVWKIDNKQHIANNDNGSQNNVISVKSSDFDVLEALKDDIANSKNSSNNVRQSIVTTVPLKSPGGLNESNKPKDGDNENHLQSSSPPGSYSQELPQKTLLSEIGNE-KSPTXXXXXXXXXXVILNKETGVHCDPNLLPQPNHVMINHMYALSIKDGVIVLSAIARYRQKFVSTVMYKPI 1119
            D +   IPTVF+W G G+ +++SGSFN WK KIPM KS   +YTI+    G   YKF VDG W  D  Q    N  G+ NN + V   D ++  AL  D   S+ SS                            D+E      +P   Y Q  PQ+     IG +  S TP  LPP L + +LN E     DP LL  P +V INH+YA SI  G+  LS   RYR KF++T+ YKPI
Sbjct:   68 DDKTTGIPTVFRWHGKGEKIYISGSFNNWKEKIPMKKSDTVYYTIINCLPGHQSYKFHVDGEWVHDTAQPTEANSFGTMNNWLEVVQEDDNLELALSHDEKFSRKSS----------------------------DSE---FVENPNAEYGQIFPQRP-NPLIGTKVTSVTPNFLPPYLNETVLNLEDSQKIDPILLRTPVYVQINHLYASSITSGIAALSVTIRYRTKFITTIFYKPI 274          
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. Planmine SMEST
Match: SMESG000037698.1 (SMESG000037698.1)

HSP 1 Score: 94.7449 bits (234), Expect = 7.615e-23
Identity = 59/185 (31.89%), Postives = 92/185 (49.73%), Query Frame = 1
Query:  568 YKFIVDGVWKIDNKQHIANNDNGSQNNVISVKSSDFDVLEALKDDIANSKNSSNNVRQSIVTTVPLKSPGGLNESNKPKDGDNENHLQSSSPPGSYSQELPQKTLLS-EIGNEKSPTXXXXXXXXXXVILNKETGVHCDPNLLPQPNHVMINHMYALSIKDGVIVLSAIARYRQKFVSTVMYKPI 1119
            YK+ +DG W  D  Q +  N  G+ +N++ VK +D   ++    D ++S         S      + +P                 ++  SP G YSQ +P++T+   +I   + P+           IL+  T  + +P+LLP P HV +NHMYA SIKDG+I LSA  RYR KF++ ++YK I
Sbjct:    2 YKYFIDGNWYHDPSQEVVQNTFGTFDNIVHVKEADSTSIDEFFGDDSDSS--------SFYQAPSISNPD----------------MKRLSPTGDYSQNVPRRTITDYDIVPMQFPSYLNES------ILDAATQSNLEPSLLPHPQHVQLNHMYASSIKDGLICLSATIRYRSKFITIILYKTI 156          
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. Planmine SMEST
Match: SMESG000031764.1 (SMESG000031764.1)

HSP 1 Score: 61.6178 bits (148), Expect = 2.817e-11
Identity = 39/127 (30.71%), Postives = 61/127 (48.03%), Query Frame = 1
Query:  292 EIDAISKILSEADVSDIEAKFREAKLLESHPSMCLDGIDSENKTIPTVFKWEGGGKDVFLSGSFNLWKAKIPM--------VKSKHN------------FYTIVELPKGEHQYKFIVDGVWKIDNKQ 612
            E D+I + + +  +S++  +       E H          E+  IP +F+W  GGK V+++GSFN WK KI +         + + N            FY I+ LP G + YKFIVD  W ID+++
Sbjct:   29 EADSIQEPMDDEKLSELFNRLTTNASQEFH----------ESGKIPILFQWPYGGKHVYVTGSFNNWKEKIKLKQISTEYFTRGRMNRFVSRLNTKPNTFYAIISLPVGVYNYKFIVDDKWIIDSQK 145          
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. Planmine SMEST
Match: SMESG000031764.1 (SMESG000031764.1)

HSP 1 Score: 62.3882 bits (150), Expect = 5.990e-11
Identity = 33/87 (37.93%), Postives = 47/87 (54.02%), Query Frame = 1
Query:  412 ENKTIPTVFKWEGGGKDVFLSGSFNLWKAKIPM--------VKSKHN------------FYTIVELPKGEHQYKFIVDGVWKIDNKQ 612
            E+  IP +F+W  GGK V+++GSFN WK KI +         + + N            FY I+ LP G + YKFIVD  W ID+++
Sbjct:  123 ESGKIPILFQWPYGGKHVYVTGSFNNWKEKIKLKQISTEYFTRGRMNRFVSRLNTKPNTFYAIISLPVGVYNYKFIVDDKWIIDSQK 209          
The following BLAST results are available for this feature:
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
PRKAB21.891e-5946.69protein kinase AMP-activated non-catalytic subunit... [more]
PRKAB14.930e-5847.19protein kinase AMP-activated non-catalytic subunit... [more]
PRKAB14.930e-5847.19protein kinase AMP-activated non-catalytic subunit... [more]
PRKAB15.724e-2654.17protein kinase AMP-activated non-catalytic subunit... [more]
back to top
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
aakb-21.021e-5342.80AMP-Activated Kinase Beta subunit [Source:UniProt... [more]
aakb-12.846e-5344.68AMP-Activated Kinase Beta subunit [Source:UniProt... [more]
aakb-12.846e-5344.68AMP-Activated Kinase Beta subunit [Source:UniProt... [more]
back to top
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
alc1.894e-5645.64gene:FBgn0260972 transcript:FBtr0088625[more]
alc2.845e-5545.64gene:FBgn0260972 transcript:FBtr0088624[more]
back to top
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkab1b1.927e-6248.48protein kinase, AMP-activated, beta 1 non-catalyti... [more]
prkab1b1.927e-6248.48protein kinase, AMP-activated, beta 1 non-catalyti... [more]
prkab1a2.231e-6244.66protein kinase, AMP-activated, beta 1 non-catalyti... [more]
CABZ01083448.15.069e-4036.91pep chromosome:GRCz11:2:58739111:58742863:1 gene:E... [more]
prkab1a1.182e-3138.50protein kinase, AMP-activated, beta 1 non-catalyti... [more]
back to top
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
prkab22.884e-6046.96protein kinase, AMP-activated, beta 2 non-catalyti... [more]
PRKAB11.258e-4646.12protein kinase, AMP-activated, beta 1 non-catalyti... [more]
PRKAB13.004e-2764.58protein kinase, AMP-activated, beta 1 non-catalyti... [more]
back to top
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Prkab21.577e-5946.69protein kinase, AMP-activated, beta 2 non-catalyti... [more]
Prkab12.475e-5948.48protein kinase, AMP-activated, beta 1 non-catalyti... [more]
Prkab12.475e-5948.48protein kinase, AMP-activated, beta 1 non-catalyti... [more]
Prkab22.043e-2947.79protein kinase, AMP-activated, beta 2 non-catalyti... [more]
Prkab14.552e-2162.71protein kinase, AMP-activated, beta 1 non-catalyti... [more]
back to top
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O43741|AAKB2_HUMAN9.079e-5946.695'-AMP-activated protein kinase subunit beta-2 OS=... [more]
sp|Q6PAM0|AAKB2_MOUSE1.103e-5846.695'-AMP-activated protein kinase subunit beta-2 OS=... [more]
sp|Q9R078|AAKB1_MOUSE1.731e-5848.485'-AMP-activated protein kinase subunit beta-1 OS=... [more]
sp|P80386|AAKB1_RAT2.032e-5848.485'-AMP-activated protein kinase subunit beta-1 OS=... [more]
sp|Q9QZH4|AAKB2_RAT4.564e-5846.285'-AMP-activated protein kinase subunit beta-2 OS=... [more]
back to top
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S8WHQ61.909e-8948.735'-AMP-activated protein kinase, beta subunit, com... [more]
A0A074Z4A11.607e-8748.46AMPKBI domain-containing protein OS=Opisthorchis v... [more]
A0A4S2LIV98.962e-8647.62AMPKBI domain-containing protein OS=Opisthorchis f... [more]
A0A068WKH41.737e-8548.26AMPK beta subunit OS=Echinococcus granulosus OX=62... [more]
A0A068XX858.603e-8548.84AMPK beta subunit OS=Echinococcus multilocularis O... [more]
back to top
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkab1b4.833e-6248.485'-AMP-activated protein kinase subunit beta-1 [So... [more]
prkab1a3.783e-6144.835'-AMP-activated protein kinase subunit beta-1-lik... [more]
PRKAB23.147e-5745.895'-AMP-activated protein kinase subunit beta-2-lik... [more]
prkab1b3.414e-5547.115'-AMP-activated protein kinase subunit beta-1 [So... [more]
prkab1a1.625e-4742.865'-AMP-activated protein kinase subunit beta-1-lik... [more]
back to top
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
SIP27.085e-2030.08One of three beta subunits of the Snf1 kinase comp... [more]
GAL831.243e-1728.25One of three possible beta-subunits of the Snf1 ki... [more]
CRP13.226e-1035.71Protein that binds to cruciform DNA structures; CR... [more]
MDG15.283e-1036.25Plasma membrane protein; involved in G-protein med... [more]
back to top
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO335403.775e-5546.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkab1b2.012e-6147.625'-AMP-activated protein kinase subunit beta-1 [So... [more]
prkab1b2.012e-6147.625'-AMP-activated protein kinase subunit beta-1 [So... [more]
PRKAB22.390e-5744.815'-AMP-activated protein kinase subunit beta-2 [So... [more]
prkab1a1.444e-5648.075'-AMP-activated protein kinase subunit beta-1 [So... [more]
prkab1a1.573e-3945.545'-AMP-activated protein kinase subunit beta-1 [So... [more]
back to top
BLAST of 5-AMP-activated protein kinase, beta subunit,putative vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000080480.10.000e+0100.00SMESG000080480.1[more]
SMESG000018914.12.943e-3438.49SMESG000018914.1[more]
SMESG000037698.17.615e-2331.89SMESG000037698.1[more]
SMESG000031764.12.817e-1130.71SMESG000031764.1[more]
SMESG000031764.15.990e-1137.93SMESG000031764.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032066 ID=SMED30032066|Name=5-AMP-activated protein kinase, beta subunit,putative|organism=Schmidtea mediterranea sexual|type=transcript|length=1280bp
GAAATTTGGTTGTTTAAATAATTACTTGTAATTAAATAATTCCTTAAAAT
TTGACGTTAAAATAATAATTTGAAATTAAATTTATTATAAATTTAATAAT
ATTAATTGATGTTATATTAACCAAGTAATTTATCTCTAATGGGTAATGCT
CCTAGTGGTAGTAAAAGAAGAGGTTCTAATGAAGAAGAAGTTGGTATAAA
TAGAGATATTTTATCTTTTGGACAAAACATACATACTGGAAATCATTCAG
CCAAAAAAAAATTAATCGTTCAACCTACTCAAGATGTTTATGAAATAGAC
GCTATTTCTAAAATTCTTTCTGAAGCTGATGTTTCGGATATTGAAGCTAA
ATTTAGAGAAGCCAAATTACTTGAATCACATCCATCAATGTGTTTAGATG
GGATTGATTCTGAAAATAAAACAATACCTACCGTTTTTAAATGGGAAGGT
GGTGGCAAAGACGTATTTTTAAGTGGTAGCTTCAATTTGTGGAAAGCTAA
AATTCCGATGGTTAAAAGCAAACACAATTTTTATACAATTGTTGAATTGC
CAAAAGGTGAACATCAATATAAATTCATAGTTGATGGAGTTTGGAAAATT
GACAATAAGCAACATATAGCTAACAATGATAACGGGTCGCAAAACAATGT
AATCTCAGTGAAGTCTAGTGATTTTGATGTTCTTGAAGCTCTTAAGGATG
ATATTGCTAATTCTAAGAATAGTTCCAACAATGTCCGACAGAGTATTGTA
ACAACTGTCCCATTAAAATCTCCAGGTGGTTTAAACGAATCCAATAAACC
CAAAGATGGAGATAATGAAAATCATTTGCAAAGTAGTTCTCCGCCTGGTA
GTTACAGCCAAGAACTACCTCAAAAAACTCTTTTATCTGAAATTGGAAAT
GAAAAATCTCCAACCCCGCCACTTTTGCCTCCTCAATTGCTTCAAGTAAT
TTTAAACAAAGAAACTGGGGTTCATTGTGACCCTAATTTATTACCACAAC
CGAATCATGTCATGATTAATCATATGTACGCTTTATCGATAAAAGATGGA
GTTATTGTCTTAAGTGCGATTGCGCGATACCGACAGAAGTTCGTTTCAAC
TGTCATGTACAAGCCAATCTAAGTGAACGGTGCAATCTTTATATTTATCT
TTACGATTGTTTATATATATCATTTCGGTTAAATTAGAATTAAATTTTCA
TTTCTCTTATAAAAATTACACATTGGAATTATTAAATTGCACCATTTACA
AATGATACTTAATTTATTTTTTTGTGGTTT
back to top

protein sequence of SMED30032066-orf-1

>SMED30032066-orf-1 ID=SMED30032066-orf-1|Name=SMED30032066-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=328bp
MGNAPSGSKRRGSNEEEVGINRDILSFGQNIHTGNHSAKKKLIVQPTQDV
YEIDAISKILSEADVSDIEAKFREAKLLESHPSMCLDGIDSENKTIPTVF
KWEGGGKDVFLSGSFNLWKAKIPMVKSKHNFYTIVELPKGEHQYKFIVDG
VWKIDNKQHIANNDNGSQNNVISVKSSDFDVLEALKDDIANSKNSSNNVR
QSIVTTVPLKSPGGLNESNKPKDGDNENHLQSSSPPGSYSQELPQKTLLS
EIGNEKSPTPPLLPPQLLQVILNKETGVHCDPNLLPQPNHVMINHMYALS
IKDGVIVLSAIARYRQKFVSTVMYKPI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0050790regulation of catalytic activity
GO:0016310phosphorylation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000074oocyte
PLANA:0000208testis
PLANA:0000231vitelline gland
Vocabulary: INTERPRO
TermDefinition
IPR013783Ig-like_fold
IPR039160AMPKB
IPR037256ASC_dom_sf
IPR006828ASC_dom
IPR032640AMPK1_CBM
IPR014756Ig_E-set
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0016301kinase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 182..202
NoneNo IPR availableGENE3DG3DSA:3.30.160.760coord: 238..327
e-value: 1.6E-30
score: 106.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 193..213
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 228..242
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 193..242
NoneNo IPR availablePANTHERPTHR103435'-AMP-ACTIVATED PROTEIN KINASE , BETA SUBUNITcoord: 33..198
NoneNo IPR availablePANTHERPTHR103435'-AMP-ACTIVATED PROTEIN KINASE , BETA SUBUNITcoord: 229..327
NoneNo IPR availableCDDcd02859E_set_AMPKbeta_like_Ncoord: 97..174
e-value: 1.75551E-31
score: 111.152
IPR006828Association with the SNF1 complex (ASC) domainSMARTSM01010AMPKBI_2coord: 232..327
e-value: 1.5E-42
score: 157.3
IPR006828Association with the SNF1 complex (ASC) domainPFAMPF04739AMPKBIcoord: 257..326
e-value: 1.1E-24
score: 86.4
IPR032640AMP-activated protein kinase, glycogen-binding domainPFAMPF16561AMPK1_CBMcoord: 96..179
e-value: 7.4E-33
score: 112.6
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 88..182
e-value: 4.8E-30
score: 105.4
IPR0391605'-AMP-activated protein kinase subunit betaPANTHERPTHR10343:SF835'-AMP-ACTIVATED PROTEIN KINASE SUBUNIT BETA-2coord: 229..327
IPR0391605'-AMP-activated protein kinase subunit betaPANTHERPTHR10343:SF835'-AMP-ACTIVATED PROTEIN KINASE SUBUNIT BETA-2coord: 33..198
IPR037256ASC domain superfamilySUPERFAMILYSSF160219AMPKBI-likecoord: 230..327
IPR014756Immunoglobulin E-setSUPERFAMILYSSF81296E set domainscoord: 94..175