serine/arginine repetitive matrix protein 1 isoform X3

Overview
Nameserine/arginine repetitive matrix protein 1 isoform X3
Smed IDSMED30032051
Length (bp)2071
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of serine/arginine repetitive matrix protein 1 isoform X3 (SMED30032051) t-SNE clustered cells

Violin plots show distribution of expression levels for serine/arginine repetitive matrix protein 1 isoform X3 (SMED30032051) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of serine/arginine repetitive matrix protein 1 isoform X3 (SMED30032051) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for serine/arginine repetitive matrix protein 1 isoform X3 (SMED30032051) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032051

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30032051SMESG000018884.1 SmedASXL_012242SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30032051SMESG000018884.1 dd_Smed_v4_9404_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30032051SMESG000018884.1 dd_Smed_v4_9404_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30032051SMESG000018884.1 dd_Smed_v4_9404_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30032051SMESG000018884.1 dd_Smed_v6_9404_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30032051SMESG000018884.1 dd_Smed_v4_9404_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30032051SMESG000018884.1 dd_Smed_v4_9404_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30032051SMESG000018884.1 dd_Smed_v4_9404_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of serine/arginine repetitive matrix protein 1 isoform X3 vs. TrEMBL
Match: gnl|BL_ORD_ID|17247698 (tr|A0A3S1CEZ4|A0A3S1CEZ4_ELYCH EF-hand domain-containing protein (Fragment) OS=Elysia chlorotica OX=188477 GN=EGW08_001373 PE=4 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 3.502e-8
Identity = 40/103 (38.83%), Postives = 59/103 (57.28%), Query Frame = 1
Query:  901 IDNINRQSDSAFNSHFDYEAAYQQSERFNR--PYGRINEYIMGGIPVKFSERYDIQGELQYLKSIILPVKARELYVGRGIQLPSNHATKIPRGKY-LDDNLVG 1200
            +D +N++      + FDY  A + + R     P+    + IMGG  ++F ER+DI  E+Q LKSI +P  A++L+ GRGI LP NH +  PR +   DDN  G
Sbjct:  201 LDGMNQRE--RLQAGFDYMEAMRGTRRRREMVPHRAQLDLIMGGKQIEFEERFDITREIQKLKSIAMPKHAKDLFHGRGIHLPQNHLSLHPRHQAPADDNEFG 301          
BLAST of serine/arginine repetitive matrix protein 1 isoform X3 vs. TrEMBL
Match: gnl|BL_ORD_ID|20322960 (tr|A0A1S3K3U9|A0A1S3K3U9_LINUN uncharacterized protein LOC106178443 isoform X6 OS=Lingula unguis OX=7574 GN=LOC106178443 PE=4 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 8.673e-8
Identity = 67/246 (27.24%), Postives = 107/246 (43.50%), Query Frame = 1
Query:  907 NINRQSD-SAFNSHFDYEAAYQQSERFNR--PYGRINEYIMGGIPVKFSERYDIQGELQYLKSIILPVKARELYVGRGIQLPSNHATKIPRGKYLDD---NLVGKSVINSELKIFTP-----------------GGGSLTINTTT----------------PND--GESTQENQVNFIKPSTPEKLQSLEVQKL---NTNEIFENLFNNTDKDTDGFMESQTVKRIILENSNLSVNWKEFLTTVLD 1512
            N+NR+S      +  DY  + +  +R     P+    + +MGG   +F+ER  I  EL  LKSI+LP  AR+LY GRGI+LP+ HA+  PR     D    ++  S  +S +   TP                  G S T+   +                P D  G+ T E+     K +TP  L+ +++      +  E  E +F N D D DG ++   V +++ +   LS   + ++  V D
Sbjct:  201 NLNRESQRERHQAEKDYVESMRGLKRKREVLPHRAPLDLLMGGKRAEFNERESITDELNRLKSIVLPANARDLYHGRGIKLPAQHASVSPRRPMPPDEAMRVLDPSRHSSSIAPRTPRVPVHSDDDDLHDHDHNRGPSRTLPRPSLEVQQTDEDKMEVDPPPEDTTGQKTPESGPAAHKSTTPNPLKGVDLTSAVPQDQREELEVVFKNLDTDNDGHLKYNEVTKVLPQ--GLSNAQQRYIKQVYD 444          
BLAST of serine/arginine repetitive matrix protein 1 isoform X3 vs. TrEMBL
Match: gnl|BL_ORD_ID|20317947 (tr|A0A1S3K3I6|A0A1S3K3I6_LINUN uncharacterized protein LOC106178443 isoform X5 OS=Lingula unguis OX=7574 GN=LOC106178443 PE=4 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 1.091e-7
Identity = 65/260 (25.00%), Postives = 106/260 (40.77%), Query Frame = 1
Query:  907 NINRQSD-SAFNSHFDYEAAYQQSERFNR--PYGRINEYIMGGIPVKFSERYDIQGELQYLKSIILPVKARELYVGRGIQLPSNHATKIPR-----GKYLDDNLVGKSVINSELKIFTPGGGSLTINTTTP-----------------------------------------------NDGESTQENQVNFIKPSTPEKLQSLEVQKL---NTNEIFENLFNNTDKDTDGFMESQTVKRIILENSNLSVNWKEFLTTVLD 1512
            N+NR+S      +  DY  + +  +R     P+    + +MGG   +F+ER  I  EL  LKSI+LP  AR+LY GRGI+LP+ HA+  PR      + + D L+ +   N  + +  P   S +I   TP                                                 G+ T E+     K +TP  L+ +++      +  E  E +F N D D DG ++   V +++ +   LS   + ++  V D
Sbjct:  201 NLNRESQRERHQAEKDYVESMRGLKRKREVLPHRAPLDLLMGGKRAEFNERESITDELNRLKSIVLPANARDLYHGRGIKLPAQHASVSPRRPMPPDEAMIDTLLAERRRNLFMGVLDPSRHSSSIAPRTPRVPVHSDDDDLHDHDHNRGPSRTLPRPSLEVQQTDEDKMEVDPPPEDTTGQKTPESGPAAHKSTTPNPLKGVDLTSAVPQDQREELEVVFKNLDTDNDGHLKYNEVTKVLPQ--GLSNAQQRYIKQVYD 458          
BLAST of serine/arginine repetitive matrix protein 1 isoform X3 vs. TrEMBL
Match: gnl|BL_ORD_ID|22626833 (tr|A0A2C9KLS1|A0A2C9KLS1_BIOGL Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106078796 PE=4 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 1.715e-7
Identity = 29/60 (48.33%), Postives = 42/60 (70.00%), Query Frame = 1
Query: 1009 EYIMGGIPVKFSERYDIQGELQYLKSIILPVKARELYVGRGIQLPSNHATKIPRGKYLDD 1188
            + IMGG  ++F ER+DI  E+Q LK+I +P  A++L+ GRGI+LPSNH +  PR    +D
Sbjct:  140 DLIMGGKQIEFEERFDINREIQKLKAIAMPTHAKDLFHGRGIRLPSNHMSLHPRHPLPND 199          
BLAST of serine/arginine repetitive matrix protein 1 isoform X3 vs. TrEMBL
Match: gnl|BL_ORD_ID|22606967 (tr|A0A2C9KLS9|A0A2C9KLS9_BIOGL Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106078796 PE=4 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 1.721e-7
Identity = 28/54 (51.85%), Postives = 40/54 (74.07%), Query Frame = 1
Query: 1009 EYIMGGIPVKFSERYDIQGELQYLKSIILPVKARELYVGRGIQLPSNHATKIPR 1170
            + IMGG  ++F ER+DI  E+Q LK+I +P  A++L+ GRGI+LPSNH +  PR
Sbjct:   84 DLIMGGKQIEFEERFDINREIQKLKAIAMPTHAKDLFHGRGIRLPSNHMSLHPR 137          
BLAST of serine/arginine repetitive matrix protein 1 isoform X3 vs. Planmine SMEST
Match: SMESG000018884.1 (SMESG000018884.1)

HSP 1 Score: 1096.26 bits (2834), Expect = 0.000e+0
Identity = 568/577 (98.44%), Postives = 570/577 (98.79%), Query Frame = 1
Query:  133 MATNDKSFNYGLPNRXXXXXXXXXXXXXXXXXXXXXXXFDLCNPVPVTYQRNAFQPSTVSKVIDIPKRLIDGFVDPDSLENQPQRQIILHTGRYAFINNTQVHKNQNERLLAEEDYLKKVKFLKKMSDSRLRMRSQNLILEGENLLSSHQVEKQEPLPFSQNKVKHFFSNIDSLSDLIPPAPTVIETSRMMEREFEFPDSSQPVSMAVQRIRLKDRNTGLETMSSAPVTSDLRSQGNMNLFRQSSSLRFAREKLPPIDNINRQSDSAFNSHFDYEAAYQQSERFNRPYGRINEYIMGGIPVKFSERYDIQGELQYLKSIILPVKARELYVGRGIQLPSNHATKIPRGKYLDDNLVGKSVINSELKIFTPGGGSLTINTTTPNDGESTQENQVNFIKPSTPEKLQSLEVQKLNTNEIFENLFNNTDKDTDGFMESQTVKRIILENSNLSVNWKEFLTTVLDSLNLINENQLKIILETLDYNLKFSVDFPVFEIADAKIFVPVLLNETFQSEDLFTNDQIIHLIGNSSQISLTKQQIDESYEEFLHSISQTEISSHENIQKHHLLLFVPYLLKSFLNKK 1863
            MATNDKSFNYGLPNRFPKLPKKFPLIKKSKISKYASKSFDLCNPVPVTYQRNAFQPSTVSKVIDIPKRLIDGFVDPDSLENQPQRQIILHTGRYAFINNTQVHKNQNERLLAEEDYLKKVKFLKKMSDSRLRMRSQNLILEGENLLSSHQVEKQEPLPFSQNKVKHFFSNIDSLSDLIPPAPTVIETSRMMERE EFPDSSQPVSMAVQRIRLKDRNTGLETMSSAPVTSDLRSQGNMNLFRQSSSLRFAREKLPPIDNINRQSDSAFNSHFDYEAAYQQSERFNRPYGRINEYIMGGIPVKFSERYDIQ ELQYLKSIILPVKARELYVGRGIQLPSNHATKIPRGKYLDDNLVGKSVINSELKIFTPGGGSLTINTTTPNDGESTQENQVNF KPSTPEKLQSLEVQKLNTNEIFENL NNTDKDTDGFMESQTVKRIILEN NLSVNWKEFLTTVLDSLNLINENQLKIILETLDYN KFSVDFPVFEIADAKIFVPVLLNETFQSEDLFTNDQII LIGNSSQISLTKQQIDESYEEFLHSISQTEI+S+ENIQKHHLLLFVPYLLKSFLNKK
Sbjct:    1 MATNDKSFNYGLPNRFPKLPKKFPLIKKSKISKYASKSFDLCNPVPVTYQRNAFQPSTVSKVIDIPKRLIDGFVDPDSLENQPQRQIILHTGRYAFINNTQVHKNQNERLLAEEDYLKKVKFLKKMSDSRLRMRSQNLILEGENLLSSHQVEKQEPLPFSQNKVKHFFSNIDSLSDLIPPAPTVIETSRMMERELEFPDSSQPVSMAVQRIRLKDRNTGLETMSSAPVTSDLRSQGNMNLFRQSSSLRFAREKLPPIDNINRQSDSAFNSHFDYEAAYQQSERFNRPYGRINEYIMGGIPVKFSERYDIQEELQYLKSIILPVKARELYVGRGIQLPSNHATKIPRGKYLDDNLVGKSVINSELKIFTPGGGSLTINTTTPNDGESTQENQVNFTKPSTPEKLQSLEVQKLNTNEIFENLCNNTDKDTDGFMESQTVKRIILENPNLSVNWKEFLTTVLDSLNLINENQLKIILETLDYNHKFSVDFPVFEIADAKIFVPVLLNETFQSEDLFTNDQIIQLIGNSSQISLTKQQIDESYEEFLHSISQTEINSYENIQKHHLLLFVPYLLKSFLNKK 577          
The following BLAST results are available for this feature:
BLAST of serine/arginine repetitive matrix protein 1 isoform X3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of serine/arginine repetitive matrix protein 1 isoform X3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of serine/arginine repetitive matrix protein 1 isoform X3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of serine/arginine repetitive matrix protein 1 isoform X3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of serine/arginine repetitive matrix protein 1 isoform X3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of serine/arginine repetitive matrix protein 1 isoform X3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of serine/arginine repetitive matrix protein 1 isoform X3 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of serine/arginine repetitive matrix protein 1 isoform X3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|172476983.502e-838.83tr|A0A3S1CEZ4|A0A3S1CEZ4_ELYCH EF-hand domain-cont... [more]
gnl|BL_ORD_ID|203229608.673e-827.24tr|A0A1S3K3U9|A0A1S3K3U9_LINUN uncharacterized pro... [more]
gnl|BL_ORD_ID|203179471.091e-725.00tr|A0A1S3K3I6|A0A1S3K3I6_LINUN uncharacterized pro... [more]
gnl|BL_ORD_ID|226268331.715e-748.33tr|A0A2C9KLS1|A0A2C9KLS1_BIOGL Uncharacterized pro... [more]
gnl|BL_ORD_ID|226069671.721e-751.85tr|A0A2C9KLS9|A0A2C9KLS9_BIOGL Uncharacterized pro... [more]
back to top
BLAST of serine/arginine repetitive matrix protein 1 isoform X3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of serine/arginine repetitive matrix protein 1 isoform X3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of serine/arginine repetitive matrix protein 1 isoform X3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of serine/arginine repetitive matrix protein 1 isoform X3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of serine/arginine repetitive matrix protein 1 isoform X3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of serine/arginine repetitive matrix protein 1 isoform X3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000018884.10.000e+098.44SMESG000018884.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032051 ID=SMED30032051|Name=serine/arginine repetitive matrix protein 1 isoform X3|organism=Schmidtea mediterranea sexual|type=transcript|length=2071bp
AAATATTATATCACTAACGACGACCTTAAATAATTTAAATAAAATTAAGC
TAAAGTTTTATTGGGCGGGTTGGTCAATATGACCTGAAATACGCGCCAAT
TATAAAAAGTAAAAGTTATATTTAATTACAATATGGCTACAAATGATAAA
TCATTCAATTATGGCCTTCCAAACCGATTTCCGAAATTACCAAAAAAATT
TCCATTGATAAAAAAATCAAAAATTTCCAAATATGCGTCAAAAAGTTTTG
ATTTGTGCAATCCAGTTCCAGTTACTTATCAAAGAAATGCGTTCCAACCG
AGCACAGTATCGAAAGTAATCGACATTCCCAAACGGCTGATAGACGGATT
TGTAGATCCAGATAGTTTGGAAAATCAGCCTCAAAGACAAATAATTCTCC
ATACTGGAAGATATGCTTTCATCAATAATACACAAGTACACAAAAATCAA
AATGAACGCTTGCTTGCCGAAGAAGATTACTTGAAAAAAGTGAAATTTTT
AAAAAAAATGTCAGACAGCCGGTTGAGAATGAGAAGTCAAAATCTTATTT
TAGAAGGGGAAAATTTACTTTCTAGTCACCAAGTGGAAAAACAAGAACCG
CTTCCTTTTTCTCAGAACAAAGTTAAACATTTCTTTAGTAACATTGATAG
CCTTTCTGATCTGATTCCACCGGCGCCTACTGTAATAGAAACATCACGAA
TGATGGAAAGAGAATTCGAGTTTCCGGATTCTTCACAACCAGTTTCTATG
GCTGTTCAAAGGATTCGATTAAAAGACAGAAATACCGGACTAGAAACCAT
GTCGAGTGCACCCGTTACCAGCGATTTAAGATCCCAGGGAAATATGAATT
TATTTCGTCAGAGTTCAAGTTTGAGATTTGCAAGGGAAAAGCTGCCGCCC
ATTGATAATATTAACAGGCAAAGTGACAGTGCATTCAATAGCCACTTTGA
TTATGAAGCTGCATATCAACAATCTGAAAGGTTTAATAGACCTTATGGTC
GAATTAATGAATACATAATGGGTGGAATACCAGTAAAGTTTTCAGAAAGA
TATGATATTCAAGGAGAACTTCAATACTTGAAATCAATTATTCTTCCTGT
TAAAGCCAGAGAACTTTATGTTGGTCGTGGAATACAATTACCTTCAAATC
ATGCAACAAAAATTCCAAGAGGAAAATATTTAGATGATAATTTAGTCGGA
AAATCAGTAATTAACTCAGAATTGAAAATATTCACTCCGGGGGGAGGAAG
TCTGACAATTAATACAACTACTCCCAACGATGGGGAATCAACACAGGAAA
ATCAAGTAAATTTCATCAAACCTTCAACCCCTGAAAAACTGCAGTCCTTA
GAAGTCCAGAAATTAAATACAAATGAAATATTCGAAAATCTCTTCAATAA
TACCGATAAAGATACCGATGGGTTTATGGAATCGCAAACTGTAAAGAGAA
TTATCTTAGAAAATTCAAATTTATCAGTCAACTGGAAAGAATTTTTGACA
ACTGTTTTAGATTCACTAAATTTAATAAACGAAAACCAATTGAAAATTAT
TCTCGAAACCCTGGATTACAACCTTAAGTTTTCCGTGGATTTTCCTGTTT
TCGAAATTGCAGATGCAAAAATATTTGTCCCAGTTTTGCTTAATGAAACT
TTTCAATCCGAAGACCTTTTTACAAATGATCAAATCATTCACCTTATTGG
TAATTCATCTCAGATTTCCCTGACTAAACAACAAATTGATGAATCTTATG
AAGAGTTTTTACATAGTATATCTCAAACAGAAATCAGTAGCCACGAAAAT
ATTCAAAAACATCATTTATTATTATTTGTACCATATTTATTAAAAAGTTT
TCTAAACAAAAAATAGTTTCAAACTGGTTTGAAGTGAGTTTTAGAGAAAT
TGTGTACATTATTATTGCGTGGTTTTATATAGGTTTCAGTAGTTGTTTTT
GTGTGGATTTTATACTTTTGTATTTTTATTCATAAATCTTTGATTCATAA
TGATCGTTATTCATAACACCGAAATTCCTAATGATCGTTATTCATAAAAC
TGTGATTCATAAAATCAAATA
back to top

protein sequence of SMED30032051-orf-1

>SMED30032051-orf-1 ID=SMED30032051-orf-1|Name=SMED30032051-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=578bp
MATNDKSFNYGLPNRFPKLPKKFPLIKKSKISKYASKSFDLCNPVPVTYQ
RNAFQPSTVSKVIDIPKRLIDGFVDPDSLENQPQRQIILHTGRYAFINNT
QVHKNQNERLLAEEDYLKKVKFLKKMSDSRLRMRSQNLILEGENLLSSHQ
VEKQEPLPFSQNKVKHFFSNIDSLSDLIPPAPTVIETSRMMEREFEFPDS
SQPVSMAVQRIRLKDRNTGLETMSSAPVTSDLRSQGNMNLFRQSSSLRFA
REKLPPIDNINRQSDSAFNSHFDYEAAYQQSERFNRPYGRINEYIMGGIP
VKFSERYDIQGELQYLKSIILPVKARELYVGRGIQLPSNHATKIPRGKYL
DDNLVGKSVINSELKIFTPGGGSLTINTTTPNDGESTQENQVNFIKPSTP
EKLQSLEVQKLNTNEIFENLFNNTDKDTDGFMESQTVKRIILENSNLSVN
WKEFLTTVLDSLNLINENQLKIILETLDYNLKFSVDFPVFEIADAKIFVP
VLLNETFQSEDLFTNDQIIHLIGNSSQISLTKQQIDESYEEFLHSISQTE
ISSHENIQKHHLLLFVPYLLKSFLNKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell