TFIIH basal transcription factor complex helicase XPB subunit

Overview
NameTFIIH basal transcription factor complex helicase XPB subunit
Smed IDSMED30032044
Length (bp)2390
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TFIIH basal transcription factor complex helicase XPB subunit (SMED30032044) t-SNE clustered cells

Violin plots show distribution of expression levels for TFIIH basal transcription factor complex helicase XPB subunit (SMED30032044) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TFIIH basal transcription factor complex helicase XPB subunit (SMED30032044) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TFIIH basal transcription factor complex helicase XPB subunit (SMED30032044) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032044

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30032044SMESG000032343.1 SmedASXL_018029SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30032044SMESG000032343.1 SmedASXL_018029SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TFIIH basal transcription factor complex helicase XPB subunit vs. Ensembl Human
Match: ERCC3 (ERCC excision repair 3, TFIIH core complex helicase subunit [Source:HGNC Symbol;Acc:HGNC:3435])

HSP 1 Score: 782.711 bits (2020), Expect = 0.000e+0
Identity = 388/736 (52.72%), Postives = 513/736 (69.70%), Query Frame = 1
Query:  175 VDENGAKDY-TSLELKKDHFNRPIWVAPDGCIYFETFNKLKKITQEFLITIAEPVSRPEHVHTYKLTDTSLYAAVSGGLKSEDIMRYLDKLCKTKLPENIVSFIKTATSNYGKANLVLRHGRLKIESKNLEQLRFLISDPKIKECLIKDSTG--LPIIHKE-------SDDLEDISNPFTNELD--RNDSDLAPDIIEFYKNIDRVVEENSSIIDNPVELLKKEKVAYSVEILESHLEKVKKRCIDLRSTLLSEYDFRNDNANPDIKMDLKPTTSLRPYQEKSLRKMFGHNRARSGIIVLPCGAGKTLVGVTAACTIRKRCIVFCTGGVAVEQWRNHFLNYTTIEEKKICRFTGSTKDPAKNTDVFVTTYNIIGYSGKRSYETKETLEWIKQQEWGLIILDEVHTIPAKTFRSVLQVIHGHCMLGLTATLVREDNKINDLNFLVGPKLYEADWMELQDKGYIARVQCVEVRCTMTPEFYWEYLKAPQNRKMLIYVMNPEKIRRCEYLIKYHEKRGDKIIVFSDNLFALRTYAGLMKRLYLEGDTSHEERIKVMDNFKQNPNVNTIFVSKMADVALDLPEATVLIQISSQGASRRQEAQRLGRITRAKKGMRPDEVNAFFYTLVSSDTTEQWFSVKRQQFLKDQGYAFKVVTELDGMNKEDLMFNNKAAQAELLAKVLTAHENDCEIEGKPAK--SASIKLPSKAETLSNMMAKKRKLHFSGGDGPVYMDTGAPSSR 2340
            VDE GAKDY   + LK DH +RP+WVAPDG I+ E F+ + K  Q+FL+ IAEPV RP HVH YKLT  SLYAAVS GL++ DI  YL KL KT +P+ I+ FIK  T +YGK  LVL+H R  +ES + + ++ L+ DP I+EC +++S G    +I +        S   E    P T+ +   +  SD+  D+ +FY+ +D+          +  E  + + V++  E+ +  +E+++KRCI L   LL+EYDFRND+ NPDI +DLKPT  LRPYQEKSLRKMFG+ RARSG+IVLPCGAGK+LVGVTAACT+RKRC+V     V+VEQW+  F  ++TI++ +ICRFT   KD      V ++TY+++G++ KRS+E +  +EW+K QEWGL+ILDEVHTIPAK FR VL ++  HC LGLTATLVRED+KI DLNFL+GPKLYEA+WMELQ+ GYIA+VQC EV C M+PEFY EY+     +++L+Y MNP K R C++LIK+HE+R DKIIVF+DN+FAL+ YA  + + Y+ G TS  ER++++ NFK NP +NTIF+SK+ D + DLPEA VLIQISS G SRRQEAQRLGR+ RAKKGM  +E NAFFY+LVS DT E  +S KRQ+FL DQGY+FKV+T+L GM +EDL F+ K  Q +LL KVL A + D E E    +  S S +   +  T+S+M         SG D  VYM+  +  S+
Sbjct:   53 VDEYGAKDYRLQMPLKDDHTSRPLWVAPDGHIFLEAFSPVYKYAQDFLVAIAEPVCRPTHVHEYKLTAYSLYAAVSVGLQTSDITEYLRKLSKTGVPDGIMQFIKLCTVSYGKVKLVLKHNRYFVESCHPDVIQHLLQDPVIRECRLRNSEGEATELITETFTSKSAISKTAESSGGPSTSRVTDPQGKSDIPMDLFDFYEQMDK----------DEEEEEETQTVSF--EVKQEMIEELQKRCIHLEYPLLAEYDFRNDSVNPDINIDLKPTAVLRPYQEKSLRKMFGNGRARSGVIVLPCGAGKSLVGVTAACTVRKRCLVLGNSAVSVEQWKAQFKMWSTIDDSQICRFTSDAKDKPIGCSVAISTYSMLGHTTKRSWEAERVMEWLKTQEWGLMILDEVHTIPAKMFRRVLTIVQAHCKLGLTATLVREDDKIVDLNFLIGPKLYEANWMELQNNGYIAKVQCAEVWCPMSPEFYREYVAIKTKKRILLYTMNPNKFRACQFLIKFHERRNDKIIVFADNVFALKEYAIRLNKPYIYGPTSQGERMQILQNFKHNPKINTIFISKVGDTSFDLPEANVLIQISSHGGSRRQEAQRLGRVLRAKKGMVAEEYNAFFYSLVSQDTQEMAYSTKRQRFLVDQGYSFKVITKLAGMEEEDLAFSTKEEQQQLLQKVLAATDLDAEEEVVAGEFGSRSSQASRRFGTMSSM---------SGADDTVYMEYHSSRSK 767          
BLAST of TFIIH basal transcription factor complex helicase XPB subunit vs. Ensembl Human
Match: ERCC3 (ERCC excision repair 3, TFIIH core complex helicase subunit [Source:HGNC Symbol;Acc:HGNC:3435])

HSP 1 Score: 769.229 bits (1985), Expect = 0.000e+0
Identity = 388/761 (50.99%), Postives = 513/761 (67.41%), Query Frame = 1
Query:  175 VDENGAKDY-TSLELKKDHFNRPIWVAPDGCIYFETFNKLKKITQEFLITIAEPVSRPEHVHTYKLTDTSLYAAVSGGLKSEDIMRYLDKLCKTKLPENIVSFIKTATSNYGKANLVLRHGRLKIESKNLEQLRFLISDPKIKECLIKDSTG--LPIIHKE-------SDDLEDISNPFTNELD--RNDSDLAPDIIEFYKNIDRVVEENSSIIDNPVELLKKEKVAYSVEILESHLEKVKKRCIDLRSTLLSEYDFRNDNANPDIKMDLKPTTSLRPYQEKSLRKMFGHNRARSGIIVLPCGAGKTLVGVTAACTIRKRCIVFCTGGVAVEQWRNHFLNYTTIEEKKICRFTGSTKDPAKNTDVFVTTYNIIGYSGKRSYETKETLEWIKQQEWGLIILDEVHTIP-------------------------AKTFRSVLQVIHGHCMLGLTATLVREDNKINDLNFLVGPKLYEADWMELQDKGYIARVQCVEVRCTMTPEFYWEYLKAPQNRKMLIYVMNPEKIRRCEYLIKYHEKRGDKIIVFSDNLFALRTYAGLMKRLYLEGDTSHEERIKVMDNFKQNPNVNTIFVSKMADVALDLPEATVLIQISSQGASRRQEAQRLGRITRAKKGMRPDEVNAFFYTLVSSDTTEQWFSVKRQQFLKDQGYAFKVVTELDGMNKEDLMFNNKAAQAELLAKVLTAHENDCEIEGKPAK--SASIKLPSKAETLSNMMAKKRKLHFSGGDGPVYMDTGAPSSR 2340
            VDE GAKDY   + LK DH +RP+WVAPDG I+ E F+ + K  Q+FL+ IAEPV RP HVH YKLT  SLYAAVS GL++ DI  YL KL KT +P+ I+ FIK  T +YGK  LVL+H R  +ES + + ++ L+ DP I+EC +++S G    +I +        S   E    P T+ +   +  SD+  D+ +FY+ +D+          +  E  + + V++  E+ +  +E+++KRCI L   LL+EYDFRND+ NPDI +DLKPT  LRPYQEKSLRKMFG+ RARSG+IVLPCGAGK+LVGVTAACT+RKRC+V     V+VEQW+  F  ++TI++ +ICRFT   KD      V ++TY+++G++ KRS+E +  +EW+K QEWGL+ILDEVHTIP                         AK FR VL ++  HC LGLTATLVRED+KI DLNFL+GPKLYEA+WMELQ+ GYIA+VQC EV C M+PEFY EY+     +++L+Y MNP K R C++LIK+HE+R DKIIVF+DN+FAL+ YA  + + Y+ G TS  ER++++ NFK NP +NTIF+SK+ D + DLPEA VLIQISS G SRRQEAQRLGR+ RAKKGM  +E NAFFY+LVS DT E  +S KRQ+FL DQGY+FKV+T+L GM +EDL F+ K  Q +LL KVL A + D E E    +  S S +   +  T+S+M         SG D  VYM+  +  S+
Sbjct:   53 VDEYGAKDYRLQMPLKDDHTSRPLWVAPDGHIFLEAFSPVYKYAQDFLVAIAEPVCRPTHVHEYKLTAYSLYAAVSVGLQTSDITEYLRKLSKTGVPDGIMQFIKLCTVSYGKVKLVLKHNRYFVESCHPDVIQHLLQDPVIRECRLRNSEGEATELITETFTSKSAISKTAESSGGPSTSRVTDPQGKSDIPMDLFDFYEQMDK----------DEEEEEETQTVSF--EVKQEMIEELQKRCIHLEYPLLAEYDFRNDSVNPDINIDLKPTAVLRPYQEKSLRKMFGNGRARSGVIVLPCGAGKSLVGVTAACTVRKRCLVLGNSAVSVEQWKAQFKMWSTIDDSQICRFTSDAKDKPIGCSVAISTYSMLGHTTKRSWEAERVMEWLKTQEWGLMILDEVHTIPGLKVMVKHLPSHSCLEPASVVLKPKAKMFRRVLTIVQAHCKLGLTATLVREDDKIVDLNFLIGPKLYEANWMELQNNGYIAKVQCAEVWCPMSPEFYREYVAIKTKKRILLYTMNPNKFRACQFLIKFHERRNDKIIVFADNVFALKEYAIRLNKPYIYGPTSQGERMQILQNFKHNPKINTIFISKVGDTSFDLPEANVLIQISSHGGSRRQEAQRLGRVLRAKKGMVAEEYNAFFYSLVSQDTQEMAYSTKRQRFLVDQGYSFKVITKLAGMEEEDLAFSTKEEQQQLLQKVLAATDLDAEEEVVAGEFGSRSSQASRRFGTMSSM---------SGADDTVYMEYHSSRSK 792          
BLAST of TFIIH basal transcription factor complex helicase XPB subunit vs. Ensembl Human
Match: ERCC3 (ERCC excision repair 3, TFIIH core complex helicase subunit [Source:HGNC Symbol;Acc:HGNC:3435])

HSP 1 Score: 403.29 bits (1035), Expect = 2.854e-133
Identity = 202/408 (49.51%), Postives = 276/408 (67.65%), Query Frame = 1
Query:  175 VDENGAKDY-TSLELKKDHFNRPIWVAPDGCIYFETFNKLKKITQEFLITIAEPVSRPEHVHTYKLTDTSLYAAVSGGLKSEDIMRYLDKLCKTKLPENIVSFIKTATSNYGKANLVLRHGRLKIESKNLEQLRFLISDPKIKECLIKDSTG--LPIIHKE-------SDDLEDISNPFTNELD--RNDSDLAPDIIEFYKNIDRVVEENSSIIDNPVELLKKEKVAYSVEILESHLEKVKKRCIDLRSTLLSEYDFRNDNANPDIKMDLKPTTSLRPYQEKSLRKMFGHNRARSGIIVLPCGAGKTLVGVTAACTIRKRCIVFCTGGVAVEQWRNHFLNYTTIEEKKICRFTGSTKDPAKNTDVFVTTYNIIGYSGKRSYETKETLEWIKQQEWGLIILDEVHTIPA 1362
            VDE GAKDY   + LK DH +RP+WVAPDG I+ E F+ + K  Q+FL+ IAEPV RP HVH YKLT  SLYAAVS GL++ DI  YL KL KT +P+ I+ FIK  T +YGK  LVL+H R  +ES + + ++ L+ DP I+EC +++S G    +I +        S   E    P T+ +   +  SD+  D+ +FY+ +D+          +  E  + + V++  E+ +  +E+++KRCI L   LL+EYDFRND+ NPDI +DLKPT  LRPYQEKSLRKMFG+ RARSG+IVLPCGAGK+LVGVTAACT+RKRC+V     V+VEQW+  F  ++TI++ +ICRFT   KD      V ++TY+++G++ KRS+E +  +EW+K QEWGL+ILDEVHTIP 
Sbjct:    5 VDEYGAKDYRLQMPLKDDHTSRPLWVAPDGHIFLEAFSPVYKYAQDFLVAIAEPVCRPTHVHEYKLTAYSLYAAVSVGLQTSDITEYLRKLSKTGVPDGIMQFIKLCTVSYGKVKLVLKHNRYFVESCHPDVIQHLLQDPVIRECRLRNSEGEATELITETFTSKSAISKTAESSGGPSTSRVTDPQGKSDIPMDLFDFYEQMDK----------DEEEEEETQTVSF--EVKQEMIEELQKRCIHLEYPLLAEYDFRNDSVNPDINIDLKPTAVLRPYQEKSLRKMFGNGRARSGVIVLPCGAGKSLVGVTAACTVRKRCLVLGNSAVSVEQWKAQFKMWSTIDDSQICRFTSDAKDKPIGCSVAISTYSMLGHTTKRSWEAERVMEWLKTQEWGLMILDEVHTIPG 400          
BLAST of TFIIH basal transcription factor complex helicase XPB subunit vs. Ensembl Human
Match: ERCC3 (ERCC excision repair 3, TFIIH core complex helicase subunit [Source:HGNC Symbol;Acc:HGNC:3435])

HSP 1 Score: 402.905 bits (1034), Expect = 1.514e-132
Identity = 202/407 (49.63%), Postives = 276/407 (67.81%), Query Frame = 1
Query:  175 VDENGAKDY-TSLELKKDHFNRPIWVAPDGCIYFETFNKLKKITQEFLITIAEPVSRPEHVHTYKLTDTSLYAAVSGGLKSEDIMRYLDKLCKTKLPENIVSFIKTATSNYGKANLVLRHGRLKIESKNLEQLRFLISDPKIKECLIKDSTG--LPIIHKE-------SDDLEDISNPFTNEL--DRNDSDLAPDIIEFYKNIDRVVEENSSIIDNPVELLKKEKVAYSVEILESHLEKVKKRCIDLRSTLLSEYDFRNDNANPDIKMDLKPTTSLRPYQEKSLRKMFGHNRARSGIIVLPCGAGKTLVGVTAACTIRKRCIVFCTGGVAVEQWRNHFLNYTTIEEKKICRFTGSTKDPAKNTDVFVTTYNIIGYSGKRSYETKETLEWIKQQEWGLIILDEVHTIP 1359
            VDE GAKDY   + LK DH +RP+WVAPDG I+ E F+ + K  Q+FL+ IAEPV RP HVH YKLT  SLYAAVS GL++ DI  YL KL KT +P+ I+ FIK  T +YGK  LVL+H R  +ES + + ++ L+ DP I+EC +++S G    +I +        S   E    P T+ +   +  SD+  D+ +FY+ +D+          +  E  + + V++  E+ +  +E+++KRCI L   LL+EYDFRND+ NPDI +DLKPT  LRPYQEKSLRKMFG+ RARSG+IVLPCGAGK+LVGVTAACT+RKRC+V     V+VEQW+  F  ++TI++ +ICRFT   KD      V ++TY+++G++ KRS+E +  +EW+K QEWGL+ILDEVHTIP
Sbjct:   53 VDEYGAKDYRLQMPLKDDHTSRPLWVAPDGHIFLEAFSPVYKYAQDFLVAIAEPVCRPTHVHEYKLTAYSLYAAVSVGLQTSDITEYLRKLSKTGVPDGIMQFIKLCTVSYGKVKLVLKHNRYFVESCHPDVIQHLLQDPVIRECRLRNSEGEATELITETFTSKSAISKTAESSGGPSTSRVTDPQGKSDIPMDLFDFYEQMDK----------DEEEEEETQTVSF--EVKQEMIEELQKRCIHLEYPLLAEYDFRNDSVNPDINIDLKPTAVLRPYQEKSLRKMFGNGRARSGVIVLPCGAGKSLVGVTAACTVRKRCLVLGNSAVSVEQWKAQFKMWSTIDDSQICRFTSDAKDKPIGCSVAISTYSMLGHTTKRSWEAERVMEWLKTQEWGLMILDEVHTIP 447          
BLAST of TFIIH basal transcription factor complex helicase XPB subunit vs. Ensembl Human
Match: ERCC3 (ERCC excision repair 3, TFIIH core complex helicase subunit [Source:HGNC Symbol;Acc:HGNC:3435])

HSP 1 Score: 236.498 bits (602), Expect = 6.988e-73
Identity = 103/155 (66.45%), Postives = 128/155 (82.58%), Query Frame = 1
Query: 1270 KRSYETKETLEWIKQQEWGLIILDEVHTIPAKTFRSVLQVIHGHCMLGLTATLVREDNKINDLNFLVGPKLYEADWMELQDKGYIARVQCVEVRCTMTPEFYWEYLKAPQNRKMLIYVMNPEKIRRCEYLIKYHEKRGDKIIVFSDNLFALRTYA 1734
            KRS+E +  +EW+K QEWGL+ILDEVHTIPAK FR VL ++  HC LGLTATLVRED+KI DLNFL+GPKLYEA+WMELQ+ GYIA+VQC EV C M+PEFY EY+     +++L+Y MNP K R C++LIK+HE+R DKIIVF+DN+FAL+ YA
Sbjct:    3 KRSWEAERVMEWLKTQEWGLMILDEVHTIPAKMFRRVLTIVQAHCKLGLTATLVREDDKIVDLNFLIGPKLYEANWMELQNNGYIAKVQCAEVWCPMSPEFYREYVAIKTKKRILLYTMNPNKFRACQFLIKFHERRNDKIIVFADNVFALKEYA 157          
BLAST of TFIIH basal transcription factor complex helicase XPB subunit vs. Ensembl Celegans
Match: xpb-1 (XPB (Xeroderma Pigmentosum complementation group B) related [Source:UniProtKB/TrEMBL;Acc:Q95PZ4])

HSP 1 Score: 727.628 bits (1877), Expect = 0.000e+0
Identity = 381/761 (50.07%), Postives = 518/761 (68.07%), Query Frame = 1
Query:  139 SGENALIQDNYPVDENGAKDY-TSLELKKDHFNRPIWVAPDGCIYFETFNKLKKITQEFLITIAEPVSRPEHVHTYKLTDTSLYAAVSGGLKSEDIMRYLDKLCKTKLPENIVSFIKTATSNYGKANLVLRHGRLKIESKNLEQLRFLISDPKIKECLIKDSTGLPIIHKESDDLEDISNPFTNELDRN----------------DSDLAPDIIEFYKNIDRVVEENSSIIDNPVELLKKEKVAYSVEILESHLEKVKKRCIDLRSTLLSEYDFRNDNANPDIKMDLKPTTSLRPYQEKSLRKMFGHNRARSGIIVLPCGAGKTLVGVTAACTIRKRCIVFCTGGVAVEQWRNHFLNYTTIEEKKICRFTGSTKDPAKNTD------VFVTTYNIIGYSGKRSYETKETLEWIKQQEWGLIILDEVHTIPAKTFRSVLQVIHGHCMLGLTATLVREDNKINDLNFLVGPKLYEADWMELQDKGYIARVQCVEVRCTMTPEFYWEYLKAPQNRKMLIYVMNPEKIRRCEYLIKYHEKRGDKIIVFSDNLFALRTYAGLMKRLYLEGDTSHEERIKVMDNFKQNPNVNTIFVSKMADVALDLPEATVLIQISSQGASRRQEAQRLGRITRAKKGMRPDEVNAFFYTLVSSDTTEQWFSVKRQQFLKDQGYAFKVVTELDGMNKEDLMFNNKAAQAELLAKVLTAHENDCEIEGKPAKSA--SIKLPSKAETLSNMMAKKRKLHFSGGDGPVYMDTG-APSSRH 2343
            +GENA    +   DE GAKDY   + LK D   RP+WVAPDG I+ E+F+ + K  ++FLI I+EPV RP+H+H Y+LT  SLYAAVS GL+++DI+ YL++L K++LP+ +++F++  T +YGK  LVL+H R  +ES++ + ++ L+ D  I+ C++ D    P    E    E I     NE ++                 D  +  DI EFY  ID   EE++ I +  ++LL       + EI +  +E V+KRCI+L   LL+EYDFRND  NP++ +DLKP+T+LRPYQEKSLRKMFG++RARSG+IVLPCGAGKTLVGVTA  T+ KRC+V     V+VEQWR  F  ++TI++K++ RFT   KDPA +        V ++TY+++ YSG+R+ + +E +++I++QEWGL++LDEVHTIPAK FR VL ++  HC LGLTATLVRED+KI DLNFL+GPK+YEA+WMELQ  G+IA+VQC EV C MT  FY  YL++   RK+L+ VMNP K R C++LIK+HE+R DKIIVFSDN+FAL+ YA  M++ +L G+TS  ER+K++ NF+ NP VNTIFVSK+AD + DLPEA VLIQIS+ G SRRQEAQRLGRI RAKK    D+ NAFFY+LVS DT E  +S KRQ+FL +QGYA+KVV  L GM  EDL   +K +Q +LL +VL   + D E E    + A  +I++  +  T+++M         SGG G  Y     A + RH
Sbjct:   44 NGENA---SSVMTDEFGAKDYRKDMPLKGDFTARPLWVAPDGHIFLESFSPVYKHARDFLIAISEPVCRPQHIHEYQLTAYSLYAAVSVGLQTKDIIEYLERLSKSQLPKGVITFVQMCTVSYGKVKLVLKHNRYFVESRHSDVMQKLLKDSVIQSCILDDRVQ-PAQQTELPAQEKIKFSHGNENEKGVEKDGAAADGTAAAATDGKVPADIDEFYGKIDGDDEEDAEIRN--LQLL-------TFEIKQETIETVQKRCIELEYPLLAEYDFRNDTLNPNLGIDLKPSTTLRPYQEKSLRKMFGNSRARSGVIVLPCGAGKTLVGVTAVTTVNKRCLVLANSNVSVEQWRAQFKLWSTIQDKQLVRFTREAKDPAPSGADATKPVVCISTYSMVAYSGRRTLQAEEAMKFIEKQEWGLLLLDEVHTIPAKMFRRVLTIVQAHCKLGLTATLVREDDKITDLNFLIGPKIYEANWMELQKAGHIAKVQCAEVWCPMTSAFYSYYLRSQIARKLLLAVMNPNKFRICQFLIKFHERRNDKIIVFSDNVFALKRYAIEMQKPFLYGETSQNERMKILQNFQYNPRVNTIFVSKVADTSFDLPEANVLIQISAHGGSRRQEAQRLGRILRAKK-HSTDQFNAFFYSLVSQDTVEMGYSRKRQRFLVNQGYAYKVVNNLPGMELEDLKLASKESQLQLLQQVLATSDADAEEEDVKEELADGTIRISRREATMASM---------SGGQGAQYHSKAKAIAERH 781          
BLAST of TFIIH basal transcription factor complex helicase XPB subunit vs. Ensembl Celegans
Match: xpb-1 (XPB (Xeroderma Pigmentosum complementation group B) related [Source:UniProtKB/TrEMBL;Acc:Q95PZ4])

HSP 1 Score: 727.628 bits (1877), Expect = 0.000e+0
Identity = 381/761 (50.07%), Postives = 518/761 (68.07%), Query Frame = 1
Query:  139 SGENALIQDNYPVDENGAKDY-TSLELKKDHFNRPIWVAPDGCIYFETFNKLKKITQEFLITIAEPVSRPEHVHTYKLTDTSLYAAVSGGLKSEDIMRYLDKLCKTKLPENIVSFIKTATSNYGKANLVLRHGRLKIESKNLEQLRFLISDPKIKECLIKDSTGLPIIHKESDDLEDISNPFTNELDRN----------------DSDLAPDIIEFYKNIDRVVEENSSIIDNPVELLKKEKVAYSVEILESHLEKVKKRCIDLRSTLLSEYDFRNDNANPDIKMDLKPTTSLRPYQEKSLRKMFGHNRARSGIIVLPCGAGKTLVGVTAACTIRKRCIVFCTGGVAVEQWRNHFLNYTTIEEKKICRFTGSTKDPAKNTD------VFVTTYNIIGYSGKRSYETKETLEWIKQQEWGLIILDEVHTIPAKTFRSVLQVIHGHCMLGLTATLVREDNKINDLNFLVGPKLYEADWMELQDKGYIARVQCVEVRCTMTPEFYWEYLKAPQNRKMLIYVMNPEKIRRCEYLIKYHEKRGDKIIVFSDNLFALRTYAGLMKRLYLEGDTSHEERIKVMDNFKQNPNVNTIFVSKMADVALDLPEATVLIQISSQGASRRQEAQRLGRITRAKKGMRPDEVNAFFYTLVSSDTTEQWFSVKRQQFLKDQGYAFKVVTELDGMNKEDLMFNNKAAQAELLAKVLTAHENDCEIEGKPAKSA--SIKLPSKAETLSNMMAKKRKLHFSGGDGPVYMDTG-APSSRH 2343
            +GENA    +   DE GAKDY   + LK D   RP+WVAPDG I+ E+F+ + K  ++FLI I+EPV RP+H+H Y+LT  SLYAAVS GL+++DI+ YL++L K++LP+ +++F++  T +YGK  LVL+H R  +ES++ + ++ L+ D  I+ C++ D    P    E    E I     NE ++                 D  +  DI EFY  ID   EE++ I +  ++LL       + EI +  +E V+KRCI+L   LL+EYDFRND  NP++ +DLKP+T+LRPYQEKSLRKMFG++RARSG+IVLPCGAGKTLVGVTA  T+ KRC+V     V+VEQWR  F  ++TI++K++ RFT   KDPA +        V ++TY+++ YSG+R+ + +E +++I++QEWGL++LDEVHTIPAK FR VL ++  HC LGLTATLVRED+KI DLNFL+GPK+YEA+WMELQ  G+IA+VQC EV C MT  FY  YL++   RK+L+ VMNP K R C++LIK+HE+R DKIIVFSDN+FAL+ YA  M++ +L G+TS  ER+K++ NF+ NP VNTIFVSK+AD + DLPEA VLIQIS+ G SRRQEAQRLGRI RAKK    D+ NAFFY+LVS DT E  +S KRQ+FL +QGYA+KVV  L GM  EDL   +K +Q +LL +VL   + D E E    + A  +I++  +  T+++M         SGG G  Y     A + RH
Sbjct:   44 NGENA---SSVMTDEFGAKDYRKDMPLKGDFTARPLWVAPDGHIFLESFSPVYKHARDFLIAISEPVCRPQHIHEYQLTAYSLYAAVSVGLQTKDIIEYLERLSKSQLPKGVITFVQMCTVSYGKVKLVLKHNRYFVESRHSDVMQKLLKDSVIQSCILDDRVQ-PAQQTELPAQEKIKFSHGNENEKGVEKDGAAADGTAAAATDGKVPADIDEFYGKIDGDDEEDAEIRN--LQLL-------TFEIKQETIETVQKRCIELEYPLLAEYDFRNDTLNPNLGIDLKPSTTLRPYQEKSLRKMFGNSRARSGVIVLPCGAGKTLVGVTAVTTVNKRCLVLANSNVSVEQWRAQFKLWSTIQDKQLVRFTREAKDPAPSGADATKPVVCISTYSMVAYSGRRTLQAEEAMKFIEKQEWGLLLLDEVHTIPAKMFRRVLTIVQAHCKLGLTATLVREDDKITDLNFLIGPKIYEANWMELQKAGHIAKVQCAEVWCPMTSAFYSYYLRSQIARKLLLAVMNPNKFRICQFLIKFHERRNDKIIVFSDNVFALKRYAIEMQKPFLYGETSQNERMKILQNFQYNPRVNTIFVSKVADTSFDLPEANVLIQISAHGGSRRQEAQRLGRILRAKK-HSTDQFNAFFYSLVSQDTVEMGYSRKRQRFLVNQGYAYKVVNNLPGMELEDLKLASKESQLQLLQQVLATSDADAEEEDVKEELADGTIRISRREATMASM---------SGGQGAQYHSKAKAIAERH 781          
BLAST of TFIIH basal transcription factor complex helicase XPB subunit vs. Ensembl Celegans
Match: xpb-1 (XPB (Xeroderma Pigmentosum complementation group B) related [Source:UniProtKB/TrEMBL;Acc:Q95PZ4])

HSP 1 Score: 727.628 bits (1877), Expect = 0.000e+0
Identity = 381/761 (50.07%), Postives = 518/761 (68.07%), Query Frame = 1
Query:  139 SGENALIQDNYPVDENGAKDY-TSLELKKDHFNRPIWVAPDGCIYFETFNKLKKITQEFLITIAEPVSRPEHVHTYKLTDTSLYAAVSGGLKSEDIMRYLDKLCKTKLPENIVSFIKTATSNYGKANLVLRHGRLKIESKNLEQLRFLISDPKIKECLIKDSTGLPIIHKESDDLEDISNPFTNELDRN----------------DSDLAPDIIEFYKNIDRVVEENSSIIDNPVELLKKEKVAYSVEILESHLEKVKKRCIDLRSTLLSEYDFRNDNANPDIKMDLKPTTSLRPYQEKSLRKMFGHNRARSGIIVLPCGAGKTLVGVTAACTIRKRCIVFCTGGVAVEQWRNHFLNYTTIEEKKICRFTGSTKDPAKNTD------VFVTTYNIIGYSGKRSYETKETLEWIKQQEWGLIILDEVHTIPAKTFRSVLQVIHGHCMLGLTATLVREDNKINDLNFLVGPKLYEADWMELQDKGYIARVQCVEVRCTMTPEFYWEYLKAPQNRKMLIYVMNPEKIRRCEYLIKYHEKRGDKIIVFSDNLFALRTYAGLMKRLYLEGDTSHEERIKVMDNFKQNPNVNTIFVSKMADVALDLPEATVLIQISSQGASRRQEAQRLGRITRAKKGMRPDEVNAFFYTLVSSDTTEQWFSVKRQQFLKDQGYAFKVVTELDGMNKEDLMFNNKAAQAELLAKVLTAHENDCEIEGKPAKSA--SIKLPSKAETLSNMMAKKRKLHFSGGDGPVYMDTG-APSSRH 2343
            +GENA    +   DE GAKDY   + LK D   RP+WVAPDG I+ E+F+ + K  ++FLI I+EPV RP+H+H Y+LT  SLYAAVS GL+++DI+ YL++L K++LP+ +++F++  T +YGK  LVL+H R  +ES++ + ++ L+ D  I+ C++ D    P    E    E I     NE ++                 D  +  DI EFY  ID   EE++ I +  ++LL       + EI +  +E V+KRCI+L   LL+EYDFRND  NP++ +DLKP+T+LRPYQEKSLRKMFG++RARSG+IVLPCGAGKTLVGVTA  T+ KRC+V     V+VEQWR  F  ++TI++K++ RFT   KDPA +        V ++TY+++ YSG+R+ + +E +++I++QEWGL++LDEVHTIPAK FR VL ++  HC LGLTATLVRED+KI DLNFL+GPK+YEA+WMELQ  G+IA+VQC EV C MT  FY  YL++   RK+L+ VMNP K R C++LIK+HE+R DKIIVFSDN+FAL+ YA  M++ +L G+TS  ER+K++ NF+ NP VNTIFVSK+AD + DLPEA VLIQIS+ G SRRQEAQRLGRI RAKK    D+ NAFFY+LVS DT E  +S KRQ+FL +QGYA+KVV  L GM  EDL   +K +Q +LL +VL   + D E E    + A  +I++  +  T+++M         SGG G  Y     A + RH
Sbjct:   44 NGENA---SSVMTDEFGAKDYRKDMPLKGDFTARPLWVAPDGHIFLESFSPVYKHARDFLIAISEPVCRPQHIHEYQLTAYSLYAAVSVGLQTKDIIEYLERLSKSQLPKGVITFVQMCTVSYGKVKLVLKHNRYFVESRHSDVMQKLLKDSVIQSCILDDRVQ-PAQQTELPAQEKIKFSHGNENEKGVEKDGAAADGTAAAATDGKVPADIDEFYGKIDGDDEEDAEIRN--LQLL-------TFEIKQETIETVQKRCIELEYPLLAEYDFRNDTLNPNLGIDLKPSTTLRPYQEKSLRKMFGNSRARSGVIVLPCGAGKTLVGVTAVTTVNKRCLVLANSNVSVEQWRAQFKLWSTIQDKQLVRFTREAKDPAPSGADATKPVVCISTYSMVAYSGRRTLQAEEAMKFIEKQEWGLLLLDEVHTIPAKMFRRVLTIVQAHCKLGLTATLVREDDKITDLNFLIGPKIYEANWMELQKAGHIAKVQCAEVWCPMTSAFYSYYLRSQIARKLLLAVMNPNKFRICQFLIKFHERRNDKIIVFSDNVFALKRYAIEMQKPFLYGETSQNERMKILQNFQYNPRVNTIFVSKVADTSFDLPEANVLIQISAHGGSRRQEAQRLGRILRAKK-HSTDQFNAFFYSLVSQDTVEMGYSRKRQRFLVNQGYAYKVVNNLPGMELEDLKLASKESQLQLLQQVLATSDADAEEEDVKEELADGTIRISRREATMASM---------SGGQGAQYHSKAKAIAERH 781          
BLAST of TFIIH basal transcription factor complex helicase XPB subunit vs. Ensembl Fly
Match: hay (gene:FBgn0001179 transcript:FBtr0076253)

HSP 1 Score: 763.451 bits (1970), Expect = 0.000e+0
Identity = 398/784 (50.77%), Postives = 516/784 (65.82%), Query Frame = 1
Query:   61 NKKSKAVQEAIDEFEDYTEYNSDTEESG------ENALIQD-NYPVDENGAKDYTS-LELKKDHFNRPIWVAPDGCIYFETFNKLKKITQEFLITIAEPVSRPEHVHTYKLTDTSLYAAVSGGLKSEDIMRYLDKLCKTKLPENIVSFIKTATSNYGKANLVLRHGRLKIESKNLEQLRFLISDPKIKECLIKDSTGLPIIHKESDDLEDISNPFTNELDRNDSD-----------------LAPDIIEFYKNIDRVVEENSSIIDNPVELLKKEKVAYSVEILESHLEKVKKRCIDLRSTLLSEYDFRNDNANPDIKMDLKPTTSLRPYQEKSLRKMFGHNRARSGIIVLPCGAGKTLVGVTAACTIRKRCIVFCTGGVAVEQWRNHFLNYTTIEEKKICRFTGSTKDPAKNTDVFVTTYNIIGYSGKRSYETKETLEWIKQQEWGLIILDEVHTIPAKTFRSVLQVIHGHCMLGLTATLVREDNKINDLNFLVGPKLYEADWMELQDKGYIARVQCVEVRCTMTPEFYWEYLKAPQNRKMLIYVMNPEKIRRCEYLIKYHEKRGDKIIVFSDNLFALRTYAGLMKRLYLEGDTSHEERIKVMDNFKQNPNVNTIFVSKMADVALDLPEATVLIQISSQGASRRQEAQRLGRITRAKKGMRPDEVNAFFYTLVSSDTTEQWFSVKRQQFLKDQGYAFKVVTELDGMNKE-DLMFNNKAAQAELLAKVLTAHENDCEIEGKPAK-----SASIKLPSKAETLSNMMAKKRKLHFSGGDGPVYMD 2319
             KK +A  EA  +  D  +    TE  G      +NA   D     DE GAKDY S ++L+ DH NRP+WVAP+G ++ E+F+ + K   +FLI I+EPV RPEH+H YKLT  SLYAAVS GL++ DI+ YL +L KT +PE I+ FI+  T +YGK  LVL+H +  IES + E L+ L+ DP I++C +  S G   I    D        F  +L    +D                 +  DI +FY+ ID+  E+        V          S E+ +  +E ++KRCI++   LL+EYDFRND  NPDI +DLKP   LRPYQEKSLRKMFG+ RARSG+IVLPCGAGK+LVGVTA CT+RKR +V C  GV+VEQW+  F  ++T ++  ICRFT   KD      + VTTY++I ++ KRS+E ++T+ W+++QEWG+++LDEVHTIPAK FR VL ++  HC LGLTATL+RED+KI DLNFL+GPKLYEA+W+ELQ KGYIARVQC EV C M+PEFY EYL    ++KML+YVMNP K R C++LIKYHE+RGDK IVFSDN+FAL+ YA  M + ++ G TS  ERI+++ NFK N  VNTIFVSK+AD + DLPEA VLIQISS G SRRQEAQRLGRI RAKKG   +E NAFFYTLVS DT E  +S KRQ+FL +QGY++KV+T L GM+ + DLM+  +  Q +LL  VL+A + DCE E  P +     S S     +   LS+M         SGGD  +Y +
Sbjct:   18 GKKRRAEDEAFTQLVDDNDSLDATESEGIPGAASKNAETNDEQINTDEYGAKDYRSQMQLRPDHGNRPLWVAPNGHVFLESFSPVYKHAHDFLIAISEPVCRPEHIHEYKLTAYSLYAAVSVGLQTHDIVEYLKRLSKTSIPEGILEFIRLCTLSYGKVKLVLKHNKYFIESPHPEVLQKLLKDPVIQKCRLIRSEGEDFIQGTLDG--KAITQFGTKLPPGATDKPTPDPAAAAGADGTTAVPEDITDFYEKIDKEEEDEDEANLKTV----------SFEVAQEKIEVIQKRCIEIEHPLLAEYDFRNDTNNPDINIDLKPAAVLRPYQEKSLRKMFGNGRARSGVIVLPCGAGKSLVGVTACCTVRKRALVLCNSGVSVEQWKQQFKMWSTADDSMICRFTSEAKDKPMGCGILVTTYSMITHTQKRSWEAEQTMRWLQEQEWGIMVLDEVHTIPAKMFRRVLTIVQSHCKLGLTATLLREDDKIADLNFLIGPKLYEANWLELQKKGYIARVQCAEVWCPMSPEFYREYLTTKTSKKMLLYVMNPSKFRSCQFLIKYHEQRGDKTIVFSDNVFALKHYAIKMNKPFIYGPTSQNERIQILQNFKFNSKVNTIFVSKVADTSFDLPEANVLIQISSHGGSRRQEAQRLGRILRAKKGAIAEEYNAFFYTLVSQDTMEMSYSRKRQRFLVNQGYSYKVITHLKGMDTDSDLMYGTQEEQGQLLQLVLSASDLDCEDEKLPGEPGYRPSGSGGAVRRVGGLSSM---------SGGDDAIYYE 780          
BLAST of TFIIH basal transcription factor complex helicase XPB subunit vs. Ensembl Fly
Match: hay (gene:FBgn0001179 transcript:FBtr0114599)

HSP 1 Score: 763.451 bits (1970), Expect = 0.000e+0
Identity = 398/784 (50.77%), Postives = 516/784 (65.82%), Query Frame = 1
Query:   61 NKKSKAVQEAIDEFEDYTEYNSDTEESG------ENALIQD-NYPVDENGAKDYTS-LELKKDHFNRPIWVAPDGCIYFETFNKLKKITQEFLITIAEPVSRPEHVHTYKLTDTSLYAAVSGGLKSEDIMRYLDKLCKTKLPENIVSFIKTATSNYGKANLVLRHGRLKIESKNLEQLRFLISDPKIKECLIKDSTGLPIIHKESDDLEDISNPFTNELDRNDSD-----------------LAPDIIEFYKNIDRVVEENSSIIDNPVELLKKEKVAYSVEILESHLEKVKKRCIDLRSTLLSEYDFRNDNANPDIKMDLKPTTSLRPYQEKSLRKMFGHNRARSGIIVLPCGAGKTLVGVTAACTIRKRCIVFCTGGVAVEQWRNHFLNYTTIEEKKICRFTGSTKDPAKNTDVFVTTYNIIGYSGKRSYETKETLEWIKQQEWGLIILDEVHTIPAKTFRSVLQVIHGHCMLGLTATLVREDNKINDLNFLVGPKLYEADWMELQDKGYIARVQCVEVRCTMTPEFYWEYLKAPQNRKMLIYVMNPEKIRRCEYLIKYHEKRGDKIIVFSDNLFALRTYAGLMKRLYLEGDTSHEERIKVMDNFKQNPNVNTIFVSKMADVALDLPEATVLIQISSQGASRRQEAQRLGRITRAKKGMRPDEVNAFFYTLVSSDTTEQWFSVKRQQFLKDQGYAFKVVTELDGMNKE-DLMFNNKAAQAELLAKVLTAHENDCEIEGKPAK-----SASIKLPSKAETLSNMMAKKRKLHFSGGDGPVYMD 2319
             KK +A  EA  +  D  +    TE  G      +NA   D     DE GAKDY S ++L+ DH NRP+WVAP+G ++ E+F+ + K   +FLI I+EPV RPEH+H YKLT  SLYAAVS GL++ DI+ YL +L KT +PE I+ FI+  T +YGK  LVL+H +  IES + E L+ L+ DP I++C +  S G   I    D        F  +L    +D                 +  DI +FY+ ID+  E+        V          S E+ +  +E ++KRCI++   LL+EYDFRND  NPDI +DLKP   LRPYQEKSLRKMFG+ RARSG+IVLPCGAGK+LVGVTA CT+RKR +V C  GV+VEQW+  F  ++T ++  ICRFT   KD      + VTTY++I ++ KRS+E ++T+ W+++QEWG+++LDEVHTIPAK FR VL ++  HC LGLTATL+RED+KI DLNFL+GPKLYEA+W+ELQ KGYIARVQC EV C M+PEFY EYL    ++KML+YVMNP K R C++LIKYHE+RGDK IVFSDN+FAL+ YA  M + ++ G TS  ERI+++ NFK N  VNTIFVSK+AD + DLPEA VLIQISS G SRRQEAQRLGRI RAKKG   +E NAFFYTLVS DT E  +S KRQ+FL +QGY++KV+T L GM+ + DLM+  +  Q +LL  VL+A + DCE E  P +     S S     +   LS+M         SGGD  +Y +
Sbjct:   18 GKKRRAEDEAFTQLVDDNDSLDATESEGIPGAASKNAETNDEQINTDEYGAKDYRSQMQLRPDHGNRPLWVAPNGHVFLESFSPVYKHAHDFLIAISEPVCRPEHIHEYKLTAYSLYAAVSVGLQTHDIVEYLKRLSKTSIPEGILEFIRLCTLSYGKVKLVLKHNKYFIESPHPEVLQKLLKDPVIQKCRLIRSEGEDFIQGTLDG--KAITQFGTKLPPGATDKPTPDPAAAAGADGTTAVPEDITDFYEKIDKEEEDEDEANLKTV----------SFEVAQEKIEVIQKRCIEIEHPLLAEYDFRNDTNNPDINIDLKPAAVLRPYQEKSLRKMFGNGRARSGVIVLPCGAGKSLVGVTACCTVRKRALVLCNSGVSVEQWKQQFKMWSTADDSMICRFTSEAKDKPMGCGILVTTYSMITHTQKRSWEAEQTMRWLQEQEWGIMVLDEVHTIPAKMFRRVLTIVQSHCKLGLTATLLREDDKIADLNFLIGPKLYEANWLELQKKGYIARVQCAEVWCPMSPEFYREYLTTKTSKKMLLYVMNPSKFRSCQFLIKYHEQRGDKTIVFSDNVFALKHYAIKMNKPFIYGPTSQNERIQILQNFKFNSKVNTIFVSKVADTSFDLPEANVLIQISSHGGSRRQEAQRLGRILRAKKGAIAEEYNAFFYTLVSQDTMEMSYSRKRQRFLVNQGYSYKVITHLKGMDTDSDLMYGTQEEQGQLLQLVLSASDLDCEDEKLPGEPGYRPSGSGGAVRRVGGLSSM---------SGGDDAIYYE 780          
BLAST of TFIIH basal transcription factor complex helicase XPB subunit vs. Ensembl Zebrafish
Match: ercc3 (excision repair cross-complementation group 3 [Source:NCBI gene;Acc:324323])

HSP 1 Score: 775.393 bits (2001), Expect = 0.000e+0
Identity = 382/739 (51.69%), Postives = 503/739 (68.06%), Query Frame = 1
Query:  175 VDENGAKDY-TSLELKKDHFNRPIWVAPDGCIYFETFNKLKKITQEFLITIAEPVSRPEHVHTYKLTDTSLYAAVSGGLKSEDIMRYLDKLCKTKLPENIVSFIKTATSNYGKANLVLRHGRLKIESKNLEQLRFLISDPKIKECLIKDSTG---------LPIIHKESDDLEDISNPFTNEL---DRNDSDLAPDIIEFYKNIDRVVEENSSIIDNPVELLKKEKVAYSVEILESHLEKVKKRCIDLRSTLLSEYDFRNDNANPDIKMDLKPTTSLRPYQEKSLRKMFGHNRARSGIIVLPCGAGKTLVGVTAACTIRKRCIVFCTGGVAVEQWRNHFLNYTTIEEKKICRFTGSTKDPAKNTDVFVTTYNIIGYSGKRSYETKETLEWIKQQEWGLIILDEVHTIPAKTFRSVLQVIHGHCMLGLTATLVREDNKINDLNFLVGPKLYEADWMELQDKGYIARVQCVEVRCTMTPEFYWEYLKAPQNRKMLIYVMNPEKIRRCEYLIKYHEKRGDKIIVFSDNLFALRTYAGLMKRLYLEGDTSHEERIKVMDNFKQNPNVNTIFVSKMADVALDLPEATVLIQISSQGASRRQEAQRLGRITRAKKGMRPDEVNAFFYTLVSSDTTEQWFSVKRQQFLKDQGYAFKVVTELDGMNKEDLMFNNKAAQAELLAKVLTAHENDC-------EIEGKPAKSASIKLPSKAETLSNMMAKKRKLHFSGGDGPVYMDTGAP 2331
            +DE GAKDY   + LK DH +RP+WVAPDG I+ E F+ + K  Q+FL+ I+EPV RP H H YKLT  SLYAAVS GL++ DI+ YL KL KT +P+ IV FIK  T +YGK  LVL+H R  +ES   + ++ L+ D  I++C ++ + G         +      S   +D   P +++     R+ + +  DI  +Y+ +D+  EE                   S EI +  +E+++KRCI L   LL+EYDFRND  NPDI MDLKPT  LRPYQEKSLRKMFG+ RARSG+IVLPCGAGK+LVGVTAACT+RKRC+V     V+VEQW+  F  ++TI++ +ICRFT   KD      V ++TY+++G++ KRS+E +  +EW+K QEWGLIILDEVHTIPAK FR VL ++  HC LGLTATLVRED+KI DLNFL+GPKLYEA+WMELQ+ GYIA+VQC EV C M+PEFY EY+     +++L+Y MNP K R C++LI++HE+R DKIIVF+DN+FAL+ YA  + + Y+ G TS  ER++++ NFK NP +NTIF+SK+ D + DLPEA VLIQISS G SRRQEAQRLGR+ RAKKGM  +E NA+FY+LVS DT E  +S KRQ+FL DQGY+FKV+T+L GM +EDLMF+ +  Q +LL KVL A + D        E+ GKP      +   +A T+S+M         SG D  +YM+   P
Sbjct:   51 LDEYGAKDYRLQMLLKNDHSSRPLWVAPDGHIFLEAFSPVYKYAQDFLVAISEPVCRPTHAHEYKLTAYSLYAAVSVGLQTSDIIEYLQKLSKTSVPDGIVQFIKLCTVSYGKVKLVLKHNRYFVESAFPDVIQRLLQDTVIRDCRLRSAEGEETELITETISSKSAISKSQQDNGGPSSSQPADGQRSGTQVPEDIFSYYEQMDKEEEEEEET------------QTVSFEIRQEMIEELQKRCIQLEYPLLAEYDFRNDTVNPDINMDLKPTAVLRPYQEKSLRKMFGNGRARSGVIVLPCGAGKSLVGVTAACTVRKRCLVLGNSSVSVEQWKAQFKMWSTIDDSQICRFTSDAKDKPIGCSVAISTYSMLGHTTKRSWEAERVMEWMKSQEWGLIILDEVHTIPAKMFRRVLTIVQAHCKLGLTATLVREDDKIVDLNFLIGPKLYEANWMELQNNGYIAKVQCAEVWCPMSPEFYREYVAIKTKKRILLYTMNPNKFRACQFLIRFHERRNDKIIVFADNVFALKEYAIRLNKPYIYGPTSQGERMQILQNFKHNPKINTIFISKVGDTSFDLPEANVLIQISSHGGSRRQEAQRLGRVLRAKKGMVAEEYNAYFYSLVSQDTQEMAYSTKRQRFLVDQGYSFKVITKLAGMEEEDLMFSTRDEQQQLLQKVLAASDLDAEEEVVMGEVGGKP------QFSRRAGTMSSM---------SGADDALYMEYQMP 762          
BLAST of TFIIH basal transcription factor complex helicase XPB subunit vs. Ensembl Xenopus
Match: ercc3 (excision repair cross-complementation group 3 [Source:NCBI gene;Acc:100170563])

HSP 1 Score: 783.867 bits (2023), Expect = 0.000e+0
Identity = 384/732 (52.46%), Postives = 508/732 (69.40%), Query Frame = 1
Query:  178 DENGAKDY-TSLELKKDHFNRPIWVAPDGCIYFETFNKLKKITQEFLITIAEPVSRPEHVHTYKLTDTSLYAAVSGGLKSEDIMRYLDKLCKTKLPENIVSFIKTATSNYGKANLVLRHGRLKIESKNLEQLRFLISDPKIKECLIKDSTG------------LPIIHKESDDLEDISNPFTNEL--DRNDSDLAPDIIEFYKNIDRVVEENSSIIDNPVELLKKEKVAYSVEILESHLEKVKKRCIDLRSTLLSEYDFRNDNANPDIKMDLKPTTSLRPYQEKSLRKMFGHNRARSGIIVLPCGAGKTLVGVTAACTIRKRCIVFCTGGVAVEQWRNHFLNYTTIEEKKICRFTGSTKDPAKNTDVFVTTYNIIGYSGKRSYETKETLEWIKQQEWGLIILDEVHTIPAKTFRSVLQVIHGHCMLGLTATLVREDNKINDLNFLVGPKLYEADWMELQDKGYIARVQCVEVRCTMTPEFYWEYLKAPQNRKMLIYVMNPEKIRRCEYLIKYHEKRGDKIIVFSDNLFALRTYAGLMKRLYLEGDTSHEERIKVMDNFKQNPNVNTIFVSKMADVALDLPEATVLIQISSQGASRRQEAQRLGRITRAKKGMRPDEVNAFFYTLVSSDTTEQWFSVKRQQFLKDQGYAFKVVTELDGMNKEDLMFNNKAAQAELLAKVLTAHENDCEIE---GKPAKSASIKLPSKAETLSNMMAKKRKLHFSGGDGPVYMD 2319
            DE GAKDY   + LK DH +RP+WVAPDG I+ E F+ + K  Q+FL+ I+EPV RP H H YKLT  SLYAAVS GL++ DI+ YL KL KT +PE IV FIK  T +YGK  LVL+H R  +ES + E ++ L+ D  I+ C ++D+ G               I K S+     S P T+++   ++ +++  D+ EFY+ +D+  EE                   S E+ + ++E+++K+CI L   LL+EYDFRND  NPDI +DLKPT  LRPYQEKSLRKMFG+ RARSG+IVLPCGAGK+LVGVTAACT+RKRC+V     V+VEQW+  F  ++TI++ +ICRFT   KD      + ++TY+++G++ KRS+E +  +EW+K QEWGL+ILDEVHTIPAK FR VL ++  HC LGLTATLVRED+KI DLNFL+GPKLYEA+WMELQ+ GYIA+VQC EV C M+PEFY EY+     +++L+Y MNP K R C++LIK+HE+R DKIIVF+DN+FAL+ YA  + + Y+ G TS  ER+ ++ NFK NP +NTIF+SK+ D + DLPEA VLIQISS G SRRQEAQRLGR+ RAKKGM  +E NAFFY+LVS DT E  +S KRQ+FL DQGY+FKV+T+L GM +EDL F+NK  Q +LL KVL A + D E E   G+    +++++  +  T+S+M         SG D  VYM+
Sbjct:   66 DEYGAKDYRLQMPLKMDHSSRPLWVAPDGHIFLEAFSPVYKYAQDFLVAISEPVCRPSHTHEYKLTAYSLYAAVSVGLQTSDIVEYLQKLSKTGVPEGIVQFIKLCTVSYGKVKLVLKHNRYFVESTHPEVIQELLQDSVIRGCRLRDAEGNETDLITETFLSKSAISKASETAA--SGPSTSQVPEGQDKTNVPADLFEFYEQMDKEEEEEEET------------QTVSFEVKQDNIEELQKQCIHLEYPLLAEYDFRNDTMNPDINIDLKPTAVLRPYQEKSLRKMFGNGRARSGVIVLPCGAGKSLVGVTAACTVRKRCLVLGNSAVSVEQWKAQFKMWSTIDDSQICRFTSDAKDKPIGCSIAISTYSMLGHTTKRSWEAERVMEWLKSQEWGLMILDEVHTIPAKMFRRVLTIVQAHCKLGLTATLVREDDKIVDLNFLIGPKLYEANWMELQNNGYIAKVQCAEVWCPMSPEFYREYVAIKTKKRILLYTMNPNKFRACQFLIKFHERRNDKIIVFADNVFALKEYAIRLSKPYIYGPTSQGERMHILQNFKHNPKINTIFISKVGDTSFDLPEANVLIQISSHGGSRRQEAQRLGRVLRAKKGMVAEEYNAFFYSLVSQDTQEMAYSTKRQRFLVDQGYSFKVITKLAGMEEEDLAFSNKEDQQQLLQKVLAASDLDAEEEVVVGEFGSRSTMQVSRRVGTMSSM---------SGADDAVYME 774          
BLAST of TFIIH basal transcription factor complex helicase XPB subunit vs. Ensembl Xenopus
Match: ercc3 (excision repair cross-complementation group 3 [Source:NCBI gene;Acc:100170563])

HSP 1 Score: 772.311 bits (1993), Expect = 0.000e+0
Identity = 384/752 (51.06%), Postives = 508/752 (67.55%), Query Frame = 1
Query:  178 DENGAKDY-TSLELKKDHFNRPIWVAPDGCIYFETFNKLKKITQEFLITIAEPVSRPEHVHTYKLTDTSLYAAVSGGLKSEDIMRYLDKLCKTKLPENIVSFIKTATSNYGKANLVLRHGRLKIESKNLEQLRFLISDPKIKECLIKDSTG------------LPIIHKESDDLEDISNPFTNEL--DRNDSDLAPDIIEFYKNIDRVVEENSSIIDNPVELLKKEKVAYSVEILESHLEKVKKRCIDLRSTLLSEYDFRNDNANPDIKMDLKPTTSLRPYQEKSLRKMFGHNRARSGIIVLPCGAGKTLVGVTAACTIRKRCIVFCTGGVAVEQWRNHFLNYTTIEEKKICRFTGSTKDPAKNTDVFVTTYNIIGYSGKRSYETKETLEWIKQQEWGLIILDEVHTIP--------------------AKTFRSVLQVIHGHCMLGLTATLVREDNKINDLNFLVGPKLYEADWMELQDKGYIARVQCVEVRCTMTPEFYWEYLKAPQNRKMLIYVMNPEKIRRCEYLIKYHEKRGDKIIVFSDNLFALRTYAGLMKRLYLEGDTSHEERIKVMDNFKQNPNVNTIFVSKMADVALDLPEATVLIQISSQGASRRQEAQRLGRITRAKKGMRPDEVNAFFYTLVSSDTTEQWFSVKRQQFLKDQGYAFKVVTELDGMNKEDLMFNNKAAQAELLAKVLTAHENDCEIE---GKPAKSASIKLPSKAETLSNMMAKKRKLHFSGGDGPVYMD 2319
            DE GAKDY   + LK DH +RP+WVAPDG I+ E F+ + K  Q+FL+ I+EPV RP H H YKLT  SLYAAVS GL++ DI+ YL KL KT +PE IV FIK  T +YGK  LVL+H R  +ES + E ++ L+ D  I+ C ++D+ G               I K S+     S P T+++   ++ +++  D+ EFY+ +D+  EE                   S E+ + ++E+++K+CI L   LL+EYDFRND  NPDI +DLKPT  LRPYQEKSLRKMFG+ RARSG+IVLPCGAGK+LVGVTAACT+RKRC+V     V+VEQW+  F  ++TI++ +ICRFT   KD      + ++TY+++G++ KRS+E +  +EW+K QEWGL+ILDEVHTIP                    AK FR VL ++  HC LGLTATLVRED+KI DLNFL+GPKLYEA+WMELQ+ GYIA+VQC EV C M+PEFY EY+     +++L+Y MNP K R C++LIK+HE+R DKIIVF+DN+FAL+ YA  + + Y+ G TS  ER+ ++ NFK NP +NTIF+SK+ D + DLPEA VLIQISS G SRRQEAQRLGR+ RAKKGM  +E NAFFY+LVS DT E  +S KRQ+FL DQGY+FKV+T+L GM +EDL F+NK  Q +LL KVL A + D E E   G+    +++++  +  T+S+M         SG D  VYM+
Sbjct:   55 DEYGAKDYRLQMPLKMDHSSRPLWVAPDGHIFLEAFSPVYKYAQDFLVAISEPVCRPSHTHEYKLTAYSLYAAVSVGLQTSDIVEYLQKLSKTGVPEGIVQFIKLCTVSYGKVKLVLKHNRYFVESTHPEVIQELLQDSVIRGCRLRDAEGNETDLITETFLSKSAISKASETAA--SGPSTSQVPEGQDKTNVPADLFEFYEQMDKEEEEEEET------------QTVSFEVKQDNIEELQKQCIHLEYPLLAEYDFRNDTMNPDINIDLKPTAVLRPYQEKSLRKMFGNGRARSGVIVLPCGAGKSLVGVTAACTVRKRCLVLGNSAVSVEQWKAQFKMWSTIDDSQICRFTSDAKDKPIGCSIAISTYSMLGHTTKRSWEAERVMEWLKSQEWGLMILDEVHTIPGNDFLCSTVINTESQFLLLSAKMFRRVLTIVQAHCKLGLTATLVREDDKIVDLNFLIGPKLYEANWMELQNNGYIAKVQCAEVWCPMSPEFYREYVAIKTKKRILLYTMNPNKFRACQFLIKFHERRNDKIIVFADNVFALKEYAIRLSKPYIYGPTSQGERMHILQNFKHNPKINTIFISKVGDTSFDLPEANVLIQISSHGGSRRQEAQRLGRVLRAKKGMVAEEYNAFFYSLVSQDTQEMAYSTKRQRFLVDQGYSFKVITKLAGMEEEDLAFSNKEDQQQLLQKVLAASDLDAEEEVVVGEFGSRSTMQVSRRVGTMSSM---------SGADDAVYME 783          
BLAST of TFIIH basal transcription factor complex helicase XPB subunit vs. Ensembl Mouse
Match: Ercc3 (excision repair cross-complementing rodent repair deficiency, complementation group 3 [Source:MGI Symbol;Acc:MGI:95414])

HSP 1 Score: 776.933 bits (2005), Expect = 0.000e+0
Identity = 385/737 (52.24%), Postives = 514/737 (69.74%), Query Frame = 1
Query:  175 VDENGAKDY-TSLELKKDHFNRPIWVAPDGCIYFETFNKLKKITQEFLITIAEPVSRPEHVHTYKLTDTSLYAAVSGGLKSEDIMRYLDKLCKTKLPENIVSFIKTATSNYGKANLVLRHGRLKIESKNLEQLRFLISDPKIKECLIKDSTG--LPIIHKESDDLEDIS--------NPFTNE-LD-RNDSDLAPDIIEFYKNIDRVVEENSSIIDNPVELLKKEKVAYSVEILESHLEKVKKRCIDLRSTLLSEYDFRNDNANPDIKMDLKPTTSLRPYQEKSLRKMFGHNRARSGIIVLPCGAGKTLVGVTAACTIRKRCIVFCTGGVAVEQWRNHFLNYTTIEEKKICRFTGSTKDPAKNTDVFVTTYNIIGYSGKRSYETKETLEWIKQQEWGLIILDEVHTIPAKTFRSVLQVIHGHCMLGLTATLVREDNKINDLNFLVGPKLYEADWMELQDKGYIARVQCVEVRCTMTPEFYWEYLKAPQNRKMLIYVMNPEKIRRCEYLIKYHEKRGDKIIVFSDNLFALRTYAGLMKRLYLEGDTSHEERIKVMDNFKQNPNVNTIFVSKMADVALDLPEATVLIQISSQGASRRQEAQRLGRITRAKKGMRPDEVNAFFYTLVSSDTTEQWFSVKRQQFLKDQGYAFKVVTELDGMNKEDLMFNNKAAQAELLAKVLTAHENDCEIEGKPAK--SASIKLPSKAETLSNMMAKKRKLHFSGGDGPVYMDTGAPSSR 2340
            VDE GAKDY   + LK DH +RP+WVAPDG I+ E F+ + K  Q+FL+ IAEPV RP HVH YKLT  SLYAAVS GL++ DI  YL KL KT +P+ I+ FIK  T +YGK  LVL+H R  +ES + + ++ L+ DP I+EC ++++ G    +I +       IS         P T++ +D +  SD+  D+ +FY+ +D+          +  E  + + V++  E+ +  +E+++KRCI L   LL+EYDFRND  NPDI +DLKPT  LRPYQEKSLRKMFG+ RARSG+IVLPCGAGK+LVGVTAACT+RKRC+V     V+VEQW+  F  ++TI++ +ICRFT   KD      V ++TY+++G++ KRS+E +  +EW+K QEWGL+ILDEVHTIPA+ FR VL ++  HC LGLTATLVRED+KI DLNFL+GPKLYEA+WMELQ+ GYIA+VQC EV C M+PEFY EY+     +++L+Y MNP K R C++LIK+HE+R DKIIVF+DN+FAL+ YA  + + Y+ G TS  ER++++ NFK NP +NTIF+SK+ D + DLPEA VLIQISS G SRRQEAQRLGR+ RAKKGM  +E NAFFY+LVS DT E  +S KRQ+FL DQGY+FKV+T+L GM +E+L F+ K  Q +LL KVL A + D E E    +  S S +   +  T+S++         SG D  VYM+  +  S+
Sbjct:   53 VDEYGAKDYRQQMPLKGDHTSRPLWVAPDGHIFLEAFSPVYKYAQDFLVAIAEPVCRPTHVHEYKLTAYSLYAAVSVGLQTSDITEYLRKLSKTGVPDGIIQFIKLCTVSYGKVKLVLKHNRYFVESSHPDVIQHLLQDPVIRECRLRNAEGEATELITETFTSKSAISKTAAEGSGGPSTSQGVDAQATSDIPKDLFDFYEQMDK----------DEEEEEETQTVSF--EVKQEMIEELQKRCICLEYPLLAEYDFRNDTLNPDINIDLKPTAVLRPYQEKSLRKMFGNGRARSGVIVLPCGAGKSLVGVTAACTVRKRCLVLGNSAVSVEQWKAQFKMWSTIDDSQICRFTSDAKDKPIGCSVAISTYSMLGHTTKRSWEAERVMEWLKTQEWGLMILDEVHTIPARMFRRVLTIVQAHCKLGLTATLVREDDKIVDLNFLIGPKLYEANWMELQNNGYIAKVQCAEVWCPMSPEFYREYVAIKTKKRILLYTMNPNKFRACQFLIKFHERRNDKIIVFADNVFALKEYAIRLNKPYIYGPTSQGERMQILQNFKHNPKINTIFISKVGDTSFDLPEANVLIQISSHGGSRRQEAQRLGRVLRAKKGMVAEEYNAFFYSLVSQDTQEMAYSTKRQRFLVDQGYSFKVITKLAGMEEEELAFSTKEEQQQLLQKVLAATDLDAEEEVVAGEFGSRSGQASRRCGTMSSL---------SGADDTVYMEYHSSRSK 768          
BLAST of TFIIH basal transcription factor complex helicase XPB subunit vs. UniProt/SwissProt
Match: sp|Q1RMT1|ERCC3_BOVIN (General transcription and DNA repair factor IIH helicase subunit XPB OS=Bos taurus OX=9913 GN=ERCC3 PE=2 SV=1)

HSP 1 Score: 787.334 bits (2032), Expect = 0.000e+0
Identity = 391/758 (51.58%), Postives = 525/758 (69.26%), Query Frame = 1
Query:  121 NSDTEESGENA----LIQDNYPVDENGAKDY-TSLELKKDHFNRPIWVAPDGCIYFETFNKLKKITQEFLITIAEPVSRPEHVHTYKLTDTSLYAAVSGGLKSEDIMRYLDKLCKTKLPENIVSFIKTATSNYGKANLVLRHGRLKIESKNLEQLRFLISDPKIKECLIKDSTG--LPIIHKE-------SDDLEDISNPFTNELD--RNDSDLAPDIIEFYKNIDRVVEENSSIIDNPVELLKKEKVAYSVEILESHLEKVKKRCIDLRSTLLSEYDFRNDNANPDIKMDLKPTTSLRPYQEKSLRKMFGHNRARSGIIVLPCGAGKTLVGVTAACTIRKRCIVFCTGGVAVEQWRNHFLNYTTIEEKKICRFTGSTKDPAKNTDVFVTTYNIIGYSGKRSYETKETLEWIKQQEWGLIILDEVHTIPAKTFRSVLQVIHGHCMLGLTATLVREDNKINDLNFLVGPKLYEADWMELQDKGYIARVQCVEVRCTMTPEFYWEYLKAPQNRKMLIYVMNPEKIRRCEYLIKYHEKRGDKIIVFSDNLFALRTYAGLMKRLYLEGDTSHEERIKVMDNFKQNPNVNTIFVSKMADVALDLPEATVLIQISSQGASRRQEAQRLGRITRAKKGMRPDEVNAFFYTLVSSDTTEQWFSVKRQQFLKDQGYAFKVVTELDGMNKEDLMFNNKAAQAELLAKVLTAHENDCEIEGKPAK--SASIKLPSKAETLSNMMAKKRKLHFSGGDGPVYMDTGAPSSR 2340
             +DT+E+  +A    + +    VDE GAKDY   + LK DH +RP+WVAPDG I+ E F+ + K  Q+FL+ IAEPV RP HVH YKLT  SLYAAVS GL++ DI  YL KL KT +PE I+ FIK  T +YGK  LVL+H R  +ES + + ++ L+ DP I+EC +++S G    +I +        +  +E    P T+ +   +  SD+  D+ +FY+ +D+          +  E  + + V++  E+ +  +E+++KRCI L   LL+EYDFRND+ NPDI +DLKPT  LRPYQEKSLRKMFG+ RARSG+IVLPCGAGK+LVGVTAACT+RKRC+V     V+VEQW+  F  ++TI++ +ICRFT   KD      + ++TY+++G++ KRS+E +  +EW+K QEWGL+ILDEVHTIPAK FR VL ++  HC LGLTATLVRED+KI DLNFL+GPKLYEA+WMELQ+ GYIA+VQC EV C M+PEFY EY+     +++L+Y MNP K R C++LIK+HE+R DKIIVF+DN+FAL+ YA  + + Y+ G TS  ER++++ NFK NP +NTIF+SK+ D + DLPEA VLIQISS G SRRQEAQRLGR+ RAKKGM  +E NAFFY+LVS DT E  +S KRQ+FL DQGY+FKV+T+L GM +EDL F+ K  Q +LL KVL A + D E E    +  S S ++  +  T+S+M         SG D  VYM+  +  S+
Sbjct:   31 GNDTQEAVPSAAGKQVDESGTKVDEYGAKDYRLQMPLKDDHTSRPLWVAPDGHIFLEAFSPVYKYAQDFLVAIAEPVCRPTHVHEYKLTAYSLYAAVSVGLQTSDITDYLRKLSKTGVPEGIIQFIKLCTVSYGKVKLVLKHNRYFVESSHPDVIQHLLQDPVIRECRLRNSEGEATELITETFTSKSAIAKSVEGSGGPSTSRVTDPQGKSDIPTDLFDFYEQMDK----------DEEEEEETQTVSF--EVKQEMIEELQKRCIHLEYPLLAEYDFRNDSVNPDINIDLKPTAVLRPYQEKSLRKMFGNGRARSGVIVLPCGAGKSLVGVTAACTVRKRCLVLGNSAVSVEQWKAQFKMWSTIDDSQICRFTSDAKDKPIGCSIAISTYSMLGHTTKRSWEAERVMEWLKTQEWGLMILDEVHTIPAKMFRRVLTIVQAHCKLGLTATLVREDDKIVDLNFLIGPKLYEANWMELQNSGYIAKVQCAEVWCPMSPEFYREYVAIKTKKRILLYTMNPNKFRACQFLIKFHERRNDKIIVFADNVFALKEYAIRLNKPYIYGPTSQGERMQILQNFKHNPKINTIFISKVGDTSFDLPEANVLIQISSHGGSRRQEAQRLGRVLRAKKGMVAEEYNAFFYSLVSQDTQEMAYSTKRQRFLVDQGYSFKVITKLAGMEEEDLAFSTKEEQQQLLQKVLAATDLDAEEEVVAGEFGSKSSQVSRRFGTMSSM---------SGADDTVYMEYHSSRSK 767          
BLAST of TFIIH basal transcription factor complex helicase XPB subunit vs. UniProt/SwissProt
Match: sp|Q60HG1|ERCC3_MACFA (General transcription and DNA repair factor IIH helicase subunit XPB OS=Macaca fascicularis OX=9541 GN=ERCC3 PE=2 SV=1)

HSP 1 Score: 783.867 bits (2023), Expect = 0.000e+0
Identity = 388/736 (52.72%), Postives = 513/736 (69.70%), Query Frame = 1
Query:  175 VDENGAKDY-TSLELKKDHFNRPIWVAPDGCIYFETFNKLKKITQEFLITIAEPVSRPEHVHTYKLTDTSLYAAVSGGLKSEDIMRYLDKLCKTKLPENIVSFIKTATSNYGKANLVLRHGRLKIESKNLEQLRFLISDPKIKECLIKDSTG--LPIIHKE-------SDDLEDISNPFTNELD--RNDSDLAPDIIEFYKNIDRVVEENSSIIDNPVELLKKEKVAYSVEILESHLEKVKKRCIDLRSTLLSEYDFRNDNANPDIKMDLKPTTSLRPYQEKSLRKMFGHNRARSGIIVLPCGAGKTLVGVTAACTIRKRCIVFCTGGVAVEQWRNHFLNYTTIEEKKICRFTGSTKDPAKNTDVFVTTYNIIGYSGKRSYETKETLEWIKQQEWGLIILDEVHTIPAKTFRSVLQVIHGHCMLGLTATLVREDNKINDLNFLVGPKLYEADWMELQDKGYIARVQCVEVRCTMTPEFYWEYLKAPQNRKMLIYVMNPEKIRRCEYLIKYHEKRGDKIIVFSDNLFALRTYAGLMKRLYLEGDTSHEERIKVMDNFKQNPNVNTIFVSKMADVALDLPEATVLIQISSQGASRRQEAQRLGRITRAKKGMRPDEVNAFFYTLVSSDTTEQWFSVKRQQFLKDQGYAFKVVTELDGMNKEDLMFNNKAAQAELLAKVLTAHENDCEIEGKPAK--SASIKLPSKAETLSNMMAKKRKLHFSGGDGPVYMDTGAPSSR 2340
            VDE GAKDY   + LK DH +RP+WVAPDG I+ E F+ + K  Q+FL+ IAEPV RP HVH YKLT  SLYAAVS GL++ DI  YL KL KT +P+ I+ FIK  T +YGK  LVL+H R  +ES + + ++ L+ DP I+EC +++S G    +I +        S   E    P T+ +   +  SD+  D+ +FY+ +D+          +  E  + + V++  E+ +  +E+++KRCI L   LL+EYDFRND+ NPDI +DLKPT  LRPYQEKSLRKMFG+ RARSG+IVLPCGAGK+LVGVTAACT+RKRC+V     V+VEQW+  F  ++TI++ +ICRFT   KD      V ++TY+++G++ KRS+E +  +EW+K QEWGL+ILDEVHTIPAK FR VL ++  HC LGLTATLVRED+KI DLNFL+GPKLYEA+WMELQ+ GYIA+VQC EV C M+PEFY EY+     +++L+Y MNP K R C++LIK+HE+R DKIIVF+DN+FAL+ YA  + + Y+ G TS  ER++++ NFK NP +NTIF+SK+ D + DLPEA VLIQISS G SRRQEAQRLGR+ RAKKGM  +E NAFFY+LVS DT E  +S KRQ+FL DQGY+FKV+T+L GM +EDL F+ K  Q +LL KVL A + D E E    +  S S +   +  T+S+M         SG D  VYM+  +  S+
Sbjct:   53 VDEYGAKDYRLQMPLKDDHTSRPLWVAPDGHIFLEAFSPVYKYAQDFLVAIAEPVCRPTHVHEYKLTAYSLYAAVSVGLQTSDITEYLRKLSKTGVPDGIMQFIKLCTVSYGKVKLVLKHNRYFVESSHPDVIQHLLQDPVIRECRLRNSEGEATELITETFTSKSAISKTAEGSGGPSTSRVTDPQGKSDIPMDLFDFYEQMDK----------DEEEEEETQTVSF--EVKQEMIEELQKRCIHLEYPLLAEYDFRNDSVNPDINIDLKPTAVLRPYQEKSLRKMFGNGRARSGVIVLPCGAGKSLVGVTAACTVRKRCLVLGNSAVSVEQWKAQFKMWSTIDDSQICRFTSDAKDKPIGCSVAISTYSMLGHTTKRSWEAERVMEWLKTQEWGLMILDEVHTIPAKMFRRVLTIVQAHCKLGLTATLVREDDKIVDLNFLIGPKLYEANWMELQNNGYIAKVQCAEVWCPMSPEFYREYVAIKTKKRILLYTMNPNKFRACQFLIKFHERRNDKIIVFADNVFALKEYAIRLNKPYIYGPTSQGERMQILQNFKHNPKINTIFISKVGDTSFDLPEANVLIQISSHGGSRRQEAQRLGRVLRAKKGMVAEEYNAFFYSLVSQDTQEMAYSTKRQRFLVDQGYSFKVITKLAGMEEEDLAFSTKEEQQQLLQKVLAATDLDAEEEVVAGEFGSRSSQASRRFGTMSSM---------SGADDTVYMEYHSSRSK 767          
BLAST of TFIIH basal transcription factor complex helicase XPB subunit vs. UniProt/SwissProt
Match: sp|P19447|ERCC3_HUMAN (General transcription and DNA repair factor IIH helicase subunit XPB OS=Homo sapiens OX=9606 GN=ERCC3 PE=1 SV=1)

HSP 1 Score: 782.711 bits (2020), Expect = 0.000e+0
Identity = 388/736 (52.72%), Postives = 513/736 (69.70%), Query Frame = 1
Query:  175 VDENGAKDY-TSLELKKDHFNRPIWVAPDGCIYFETFNKLKKITQEFLITIAEPVSRPEHVHTYKLTDTSLYAAVSGGLKSEDIMRYLDKLCKTKLPENIVSFIKTATSNYGKANLVLRHGRLKIESKNLEQLRFLISDPKIKECLIKDSTG--LPIIHKE-------SDDLEDISNPFTNELD--RNDSDLAPDIIEFYKNIDRVVEENSSIIDNPVELLKKEKVAYSVEILESHLEKVKKRCIDLRSTLLSEYDFRNDNANPDIKMDLKPTTSLRPYQEKSLRKMFGHNRARSGIIVLPCGAGKTLVGVTAACTIRKRCIVFCTGGVAVEQWRNHFLNYTTIEEKKICRFTGSTKDPAKNTDVFVTTYNIIGYSGKRSYETKETLEWIKQQEWGLIILDEVHTIPAKTFRSVLQVIHGHCMLGLTATLVREDNKINDLNFLVGPKLYEADWMELQDKGYIARVQCVEVRCTMTPEFYWEYLKAPQNRKMLIYVMNPEKIRRCEYLIKYHEKRGDKIIVFSDNLFALRTYAGLMKRLYLEGDTSHEERIKVMDNFKQNPNVNTIFVSKMADVALDLPEATVLIQISSQGASRRQEAQRLGRITRAKKGMRPDEVNAFFYTLVSSDTTEQWFSVKRQQFLKDQGYAFKVVTELDGMNKEDLMFNNKAAQAELLAKVLTAHENDCEIEGKPAK--SASIKLPSKAETLSNMMAKKRKLHFSGGDGPVYMDTGAPSSR 2340
            VDE GAKDY   + LK DH +RP+WVAPDG I+ E F+ + K  Q+FL+ IAEPV RP HVH YKLT  SLYAAVS GL++ DI  YL KL KT +P+ I+ FIK  T +YGK  LVL+H R  +ES + + ++ L+ DP I+EC +++S G    +I +        S   E    P T+ +   +  SD+  D+ +FY+ +D+          +  E  + + V++  E+ +  +E+++KRCI L   LL+EYDFRND+ NPDI +DLKPT  LRPYQEKSLRKMFG+ RARSG+IVLPCGAGK+LVGVTAACT+RKRC+V     V+VEQW+  F  ++TI++ +ICRFT   KD      V ++TY+++G++ KRS+E +  +EW+K QEWGL+ILDEVHTIPAK FR VL ++  HC LGLTATLVRED+KI DLNFL+GPKLYEA+WMELQ+ GYIA+VQC EV C M+PEFY EY+     +++L+Y MNP K R C++LIK+HE+R DKIIVF+DN+FAL+ YA  + + Y+ G TS  ER++++ NFK NP +NTIF+SK+ D + DLPEA VLIQISS G SRRQEAQRLGR+ RAKKGM  +E NAFFY+LVS DT E  +S KRQ+FL DQGY+FKV+T+L GM +EDL F+ K  Q +LL KVL A + D E E    +  S S +   +  T+S+M         SG D  VYM+  +  S+
Sbjct:   53 VDEYGAKDYRLQMPLKDDHTSRPLWVAPDGHIFLEAFSPVYKYAQDFLVAIAEPVCRPTHVHEYKLTAYSLYAAVSVGLQTSDITEYLRKLSKTGVPDGIMQFIKLCTVSYGKVKLVLKHNRYFVESCHPDVIQHLLQDPVIRECRLRNSEGEATELITETFTSKSAISKTAESSGGPSTSRVTDPQGKSDIPMDLFDFYEQMDK----------DEEEEEETQTVSF--EVKQEMIEELQKRCIHLEYPLLAEYDFRNDSVNPDINIDLKPTAVLRPYQEKSLRKMFGNGRARSGVIVLPCGAGKSLVGVTAACTVRKRCLVLGNSAVSVEQWKAQFKMWSTIDDSQICRFTSDAKDKPIGCSVAISTYSMLGHTTKRSWEAERVMEWLKTQEWGLMILDEVHTIPAKMFRRVLTIVQAHCKLGLTATLVREDDKIVDLNFLIGPKLYEANWMELQNNGYIAKVQCAEVWCPMSPEFYREYVAIKTKKRILLYTMNPNKFRACQFLIKFHERRNDKIIVFADNVFALKEYAIRLNKPYIYGPTSQGERMQILQNFKHNPKINTIFISKVGDTSFDLPEANVLIQISSHGGSRRQEAQRLGRVLRAKKGMVAEEYNAFFYSLVSQDTQEMAYSTKRQRFLVDQGYSFKVITKLAGMEEEDLAFSTKEEQQQLLQKVLAATDLDAEEEVVAGEFGSRSSQASRRFGTMSSM---------SGADDTVYMEYHSSRSK 767          
BLAST of TFIIH basal transcription factor complex helicase XPB subunit vs. UniProt/SwissProt
Match: sp|Q5RA62|ERCC3_PONAB (General transcription and DNA repair factor IIH helicase subunit XPB OS=Pongo abelii OX=9601 GN=ERCC3 PE=2 SV=1)

HSP 1 Score: 780.785 bits (2015), Expect = 0.000e+0
Identity = 387/736 (52.58%), Postives = 512/736 (69.57%), Query Frame = 1
Query:  175 VDENGAKDY-TSLELKKDHFNRPIWVAPDGCIYFETFNKLKKITQEFLITIAEPVSRPEHVHTYKLTDTSLYAAVSGGLKSEDIMRYLDKLCKTKLPENIVSFIKTATSNYGKANLVLRHGRLKIESKNLEQLRFLISDPKIKECLIKDSTG--LPIIHKE-------SDDLEDISNPFTNELD--RNDSDLAPDIIEFYKNIDRVVEENSSIIDNPVELLKKEKVAYSVEILESHLEKVKKRCIDLRSTLLSEYDFRNDNANPDIKMDLKPTTSLRPYQEKSLRKMFGHNRARSGIIVLPCGAGKTLVGVTAACTIRKRCIVFCTGGVAVEQWRNHFLNYTTIEEKKICRFTGSTKDPAKNTDVFVTTYNIIGYSGKRSYETKETLEWIKQQEWGLIILDEVHTIPAKTFRSVLQVIHGHCMLGLTATLVREDNKINDLNFLVGPKLYEADWMELQDKGYIARVQCVEVRCTMTPEFYWEYLKAPQNRKMLIYVMNPEKIRRCEYLIKYHEKRGDKIIVFSDNLFALRTYAGLMKRLYLEGDTSHEERIKVMDNFKQNPNVNTIFVSKMADVALDLPEATVLIQISSQGASRRQEAQRLGRITRAKKGMRPDEVNAFFYTLVSSDTTEQWFSVKRQQFLKDQGYAFKVVTELDGMNKEDLMFNNKAAQAELLAKVLTAHENDCEIEGKPAK--SASIKLPSKAETLSNMMAKKRKLHFSGGDGPVYMDTGAPSSR 2340
            VDE GAKDY   + LK DH +RP+WVAPDG I+ E F+ + K  Q+FL+ IAE V RP HVH YKLT  SLYAAVS GL++ DI  YL KL KT +P+ I+ FIK  T +YGK  LVL+H R  +ES + + ++ L+ DP I+EC +++S G    +I +        S   E    P T+ +   +  SD+  D+ +FY+ +D+          +  E  + + V++  E+ +  +E+++KRCI L   LL+EYDFRND+ NPDI +DLKPT  LRPYQEKSLRKMFG+ RARSG+IVLPCGAGK+LVGVTAACT+RKRC+V     V+VEQW+  F  ++TI++ +ICRFT   KD      V ++TY+++G++ KRS+E +  +EW+K QEWGL+ILDEVHTIPAK FR VL ++  HC LGLTATLVRED+KI DLNFL+GPKLYEA+WMELQ+ GYIA+VQC EV C M+PEFY EY+     +++L+Y MNP K R C++LIK+HE+R DKIIVF+DN+FAL+ YA  + + Y+ G TS  ER++++ NFK NP +NTIF+SK+ D + DLPEA VLIQISS G SRRQEAQRLGR+ RAKKGM  +E NAFFY+LVS DT E  +S KRQ+FL DQGY+FKV+T+L GM +EDL F+ K  Q +LL KVL A + D E E    +  S S +   +  T+S+M         SG D  VYM+  +  S+
Sbjct:   53 VDEYGAKDYRLQMPLKDDHTSRPLWVAPDGHIFLEAFSPVYKYAQDFLVAIAESVCRPTHVHEYKLTAYSLYAAVSVGLQTSDITEYLRKLSKTGVPDGIMQFIKLCTVSYGKVKLVLKHNRYFVESSHPDVIQHLLQDPVIRECRLRNSEGEATELITETFTSKSAISKTAESSGGPSTSRVTDPQGKSDIPMDLFDFYEQMDK----------DEEEEEETQTVSF--EVKQEMIEELQKRCIHLEYPLLAEYDFRNDSVNPDINIDLKPTAVLRPYQEKSLRKMFGNGRARSGVIVLPCGAGKSLVGVTAACTVRKRCLVLGNSAVSVEQWKAQFKMWSTIDDSQICRFTSDAKDKPIGCSVAISTYSMLGHTTKRSWEAERVMEWLKTQEWGLMILDEVHTIPAKMFRRVLTIVQAHCKLGLTATLVREDDKIVDLNFLIGPKLYEANWMELQNNGYIAKVQCAEVWCPMSPEFYREYVAIKTKKRILLYTMNPNKFRACQFLIKFHERRNDKIIVFADNVFALKEYAIRLNKPYIYGPTSQGERMQILQNFKHNPKINTIFISKVGDTSFDLPEANVLIQISSHGGSRRQEAQRLGRVLRAKKGMVAEEYNAFFYSLVSQDTQEMAYSTKRQRFLVDQGYSFKVITKLAGMEEEDLAFSTKEEQQQLLQKVLAATDLDAEEEVVAGEFGSRSSQASRRFGTMSSM---------SGADDTVYMEYHSSRSK 767          
BLAST of TFIIH basal transcription factor complex helicase XPB subunit vs. UniProt/SwissProt
Match: sp|P49135|ERCC3_MOUSE (General transcription and DNA repair factor IIH helicase subunit XPB OS=Mus musculus OX=10090 GN=Ercc3 PE=2 SV=1)

HSP 1 Score: 776.933 bits (2005), Expect = 0.000e+0
Identity = 385/737 (52.24%), Postives = 514/737 (69.74%), Query Frame = 1
Query:  175 VDENGAKDY-TSLELKKDHFNRPIWVAPDGCIYFETFNKLKKITQEFLITIAEPVSRPEHVHTYKLTDTSLYAAVSGGLKSEDIMRYLDKLCKTKLPENIVSFIKTATSNYGKANLVLRHGRLKIESKNLEQLRFLISDPKIKECLIKDSTG--LPIIHKESDDLEDIS--------NPFTNE-LD-RNDSDLAPDIIEFYKNIDRVVEENSSIIDNPVELLKKEKVAYSVEILESHLEKVKKRCIDLRSTLLSEYDFRNDNANPDIKMDLKPTTSLRPYQEKSLRKMFGHNRARSGIIVLPCGAGKTLVGVTAACTIRKRCIVFCTGGVAVEQWRNHFLNYTTIEEKKICRFTGSTKDPAKNTDVFVTTYNIIGYSGKRSYETKETLEWIKQQEWGLIILDEVHTIPAKTFRSVLQVIHGHCMLGLTATLVREDNKINDLNFLVGPKLYEADWMELQDKGYIARVQCVEVRCTMTPEFYWEYLKAPQNRKMLIYVMNPEKIRRCEYLIKYHEKRGDKIIVFSDNLFALRTYAGLMKRLYLEGDTSHEERIKVMDNFKQNPNVNTIFVSKMADVALDLPEATVLIQISSQGASRRQEAQRLGRITRAKKGMRPDEVNAFFYTLVSSDTTEQWFSVKRQQFLKDQGYAFKVVTELDGMNKEDLMFNNKAAQAELLAKVLTAHENDCEIEGKPAK--SASIKLPSKAETLSNMMAKKRKLHFSGGDGPVYMDTGAPSSR 2340
            VDE GAKDY   + LK DH +RP+WVAPDG I+ E F+ + K  Q+FL+ IAEPV RP HVH YKLT  SLYAAVS GL++ DI  YL KL KT +P+ I+ FIK  T +YGK  LVL+H R  +ES + + ++ L+ DP I+EC ++++ G    +I +       IS         P T++ +D +  SD+  D+ +FY+ +D+          +  E  + + V++  E+ +  +E+++KRCI L   LL+EYDFRND  NPDI +DLKPT  LRPYQEKSLRKMFG+ RARSG+IVLPCGAGK+LVGVTAACT+RKRC+V     V+VEQW+  F  ++TI++ +ICRFT   KD      V ++TY+++G++ KRS+E +  +EW+K QEWGL+ILDEVHTIPA+ FR VL ++  HC LGLTATLVRED+KI DLNFL+GPKLYEA+WMELQ+ GYIA+VQC EV C M+PEFY EY+     +++L+Y MNP K R C++LIK+HE+R DKIIVF+DN+FAL+ YA  + + Y+ G TS  ER++++ NFK NP +NTIF+SK+ D + DLPEA VLIQISS G SRRQEAQRLGR+ RAKKGM  +E NAFFY+LVS DT E  +S KRQ+FL DQGY+FKV+T+L GM +E+L F+ K  Q +LL KVL A + D E E    +  S S +   +  T+S++         SG D  VYM+  +  S+
Sbjct:   53 VDEYGAKDYRQQMPLKGDHTSRPLWVAPDGHIFLEAFSPVYKYAQDFLVAIAEPVCRPTHVHEYKLTAYSLYAAVSVGLQTSDITEYLRKLSKTGVPDGIIQFIKLCTVSYGKVKLVLKHNRYFVESSHPDVIQHLLQDPVIRECRLRNAEGEATELITETFTSKSAISKTAAEGSGGPSTSQGVDAQATSDIPKDLFDFYEQMDK----------DEEEEEETQTVSF--EVKQEMIEELQKRCICLEYPLLAEYDFRNDTLNPDINIDLKPTAVLRPYQEKSLRKMFGNGRARSGVIVLPCGAGKSLVGVTAACTVRKRCLVLGNSAVSVEQWKAQFKMWSTIDDSQICRFTSDAKDKPIGCSVAISTYSMLGHTTKRSWEAERVMEWLKTQEWGLMILDEVHTIPARMFRRVLTIVQAHCKLGLTATLVREDDKIVDLNFLIGPKLYEANWMELQNNGYIAKVQCAEVWCPMSPEFYREYVAIKTKKRILLYTMNPNKFRACQFLIKFHERRNDKIIVFADNVFALKEYAIRLNKPYIYGPTSQGERMQILQNFKHNPKINTIFISKVGDTSFDLPEANVLIQISSHGGSRRQEAQRLGRVLRAKKGMVAEEYNAFFYSLVSQDTQEMAYSTKRQRFLVDQGYSFKVITKLAGMEEEELAFSTKEEQQQLLQKVLAATDLDAEEEVVAGEFGSRSGQASRRCGTMSSL---------SGADDTVYMEYHSSRSK 768          
BLAST of TFIIH basal transcription factor complex helicase XPB subunit vs. TrEMBL
Match: A0A2Y9E4T7 (TFIIH basal transcription factor complex helicase XPB subunit OS=Trichechus manatus latirostris OX=127582 GN=LOC101349322 PE=4 SV=1)

HSP 1 Score: 790.801 bits (2041), Expect = 0.000e+0
Identity = 390/736 (52.99%), Postives = 512/736 (69.57%), Query Frame = 1
Query:  175 VDENGAKDY-TSLELKKDHFNRPIWVAPDGCIYFETFNKLKKITQEFLITIAEPVSRPEHVHTYKLTDTSLYAAVSGGLKSEDIMRYLDKLCKTKLPENIVSFIKTATSNYGKANLVLRHGRLKIESKNLEQLRFLISDPKIKECLIKDSTG--LPIIHKE-------SDDLEDISNPFTNELD--RNDSDLAPDIIEFYKNIDRVVEENSSIIDNPVELLKKEKVAYSVEILESHLEKVKKRCIDLRSTLLSEYDFRNDNANPDIKMDLKPTTSLRPYQEKSLRKMFGHNRARSGIIVLPCGAGKTLVGVTAACTIRKRCIVFCTGGVAVEQWRNHFLNYTTIEEKKICRFTGSTKDPAKNTDVFVTTYNIIGYSGKRSYETKETLEWIKQQEWGLIILDEVHTIPAKTFRSVLQVIHGHCMLGLTATLVREDNKINDLNFLVGPKLYEADWMELQDKGYIARVQCVEVRCTMTPEFYWEYLKAPQNRKMLIYVMNPEKIRRCEYLIKYHEKRGDKIIVFSDNLFALRTYAGLMKRLYLEGDTSHEERIKVMDNFKQNPNVNTIFVSKMADVALDLPEATVLIQISSQGASRRQEAQRLGRITRAKKGMRPDEVNAFFYTLVSSDTTEQWFSVKRQQFLKDQGYAFKVVTELDGMNKEDLMFNNKAAQAELLAKVLTAHENDCEIEGKPAK--SASIKLPSKAETLSNMMAKKRKLHFSGGDGPVYMDTGAPSSR 2340
            VDE GAKDY   + LK DH +RP+WVAPDG I+ E F+ + K  Q+FL+ IAEPV RP HVH YKLT  SLYAAVS GL++ DI  YL KL KT +P+ I+ FIK  T +YGK  LVL+H R  +ES + + ++ L+ DP I+EC +++S G    +I +        S  LE    P T+ +   +N SD+  D+ +FY+ +D+  E+                   S E+ +  +E+++KRCI L   LL+EYDFRND+ NPDI +DLKPT  LRPYQEKSLRKMFG+ RARSG+IVLPCGAGK+LVGVTAACT+RKRC+V     V+VEQW+  F  ++TI++ +ICRFT   KD      V ++TY+++G++ KRS+E +  +EW+K QEWGL+ILDEVHTIPAK FR VL ++  HC LGLTATLVRED+KI DLNFL+GPKLYEA+WMELQ+ GYIA+VQC EV C M+PEFY EY+     +++L+Y MNP K R C++LIK+HE+R DKIIVF+DN+FAL+ YA  + + Y+ G TS  ER++++ NFK NP +NTIF+SK+ D + DLPEA VLIQISS G SRRQEAQRLGR+ RAKKGM  +E NAFFY+LVS DT E  +S KRQ+FL DQGY+FKV+T+L GM +EDL F+ K  Q +LL KVL A + D E E    +  S S ++  +  T+S+M         SG D  VYM+  +  S+
Sbjct:   53 VDEYGAKDYRLQMPLKDDHTSRPLWVAPDGHIFLEAFSPVYKYAQDFLVAIAEPVCRPTHVHEYKLTAYSLYAAVSVGLQTSDITEYLRKLSKTGVPDGIIQFIKLCTVSYGKVKLVLKHNRYFVESSHPDVIQHLLQDPVIRECRLRNSEGEATELITETFTSKSAISKTLEGSGGPSTSRVTDPQNKSDIPTDLFDFYEQMDKDEEDEEET------------QTVSFEVKQEMIEELQKRCIHLEYPLLAEYDFRNDSVNPDINIDLKPTAVLRPYQEKSLRKMFGNGRARSGVIVLPCGAGKSLVGVTAACTVRKRCLVLGNSAVSVEQWKAQFKMWSTIDDSQICRFTSDAKDKPIGCSVAISTYSMLGHTTKRSWEAERVMEWLKTQEWGLMILDEVHTIPAKMFRRVLTIVQAHCKLGLTATLVREDDKIVDLNFLIGPKLYEANWMELQNNGYIAKVQCAEVWCPMSPEFYREYVAIKTKKRILLYTMNPNKFRACQFLIKFHERRNDKIIVFADNVFALKEYAIRLNKPYIYGPTSQGERMQILQNFKHNPKINTIFISKVGDTSFDLPEANVLIQISSHGGSRRQEAQRLGRVLRAKKGMVAEEYNAFFYSLVSQDTQEMAYSTKRQRFLVDQGYSFKVITKLAGMEEEDLAFSTKEEQQQLLQKVLAATDLDAEEEVVAGEFGSKSSQVSRRFGTMSSM---------SGADDTVYMEYHSSRSK 767          
BLAST of TFIIH basal transcription factor complex helicase XPB subunit vs. TrEMBL
Match: A0A5N5PXS7 (Uncharacterized protein OS=Pangasianodon hypophthalmus OX=310915 GN=PHYPO_G00108990 PE=4 SV=1)

HSP 1 Score: 789.26 bits (2037), Expect = 0.000e+0
Identity = 391/768 (50.91%), Postives = 515/768 (67.06%), Query Frame = 1
Query:   58 KNKKSKAVQEAIDEFEDYTEYNSDTEESGENALIQDNYPVDENGAKDY-TSLELKKDHFNRPIWVAPDGCIYFETFNKLKKITQEFLITIAEPVSRPEHVHTYKLTDTSLYAAVSGGLKSEDIMRYLDKLCKTKLPENIVSFIKTATSNYGKANLVLRHGRLKIESKNLEQLRFLISDPKIKECLIKDSTG------------LPIIHKESDDLEDISNPFTNELDRNDSDLAPDIIEFYKNIDRVVEENSSIIDNPVELLKKEKVAYSVEILESHLEKVKKRCIDLRSTLLSEYDFRNDNANPDIKMDLKPTTSLRPYQEKSLRKMFGHNRARSGIIVLPCGAGKTLVGVTAACTIRKRCIVFCTGGVAVEQWRNHFLNYTTIEEKKICRFTGSTKDPAKNTDVFVTTYNIIGYSGKRSYETKETLEWIKQQEWGLIILDEVHTIPAKTFRSVLQVIHGHCMLGLTATLVREDNKINDLNFLVGPKLYEADWMELQDKGYIARVQCVEVRCTMTPEFYWEYLKAPQNRKMLIYVMNPEKIRRCEYLIKYHEKRGDKIIVFSDNLFALRTYAGLMKRLYLEGDTSHEERIKVMDNFKQNPNVNTIFVSKMADVALDLPEATVLIQISSQGASRRQEAQRLGRITRAKKGMRPDEVNAFFYTLVSSDTTEQWFSVKRQQFLKDQGYAFKVVTELDGMNKEDLMFNNKAAQAELLAKVLTAHENDCEIEGKPAK-SASIKLPSKAETLSNMMAKKRKLHFSGGDGPVYMD 2319
            K+KK     E  +EF   TE       +    + + +  +DE GAKDY   + LK DH +RP+WVAPDG I+ E F+ + K  Q+FL+ IAEPV RP HVH YKLT  SLYAAVS GL++ DI+ YL KL KT +P+ IV FIK  T +YGK  LVL+H R  +ES   + ++ L+ DP I++C ++ + G             P I K   D    S   + +  R+ + +  DI  +Y+ +D+  EE                   S EI +  +E+++KRCI L   LL+EYDFRND  NPDI MDLKPT  LRPYQEKSLRKMFG+ RARSG+IVLPCGAGK+LVGVTAACT+RKRC+V     V+VEQW+  F  ++TI++ +ICRFT   KD      V ++TY+++G++ KRS+E +  +EW++ QEWGLIILDEVHTIPA+ FR VL ++  HC LGLTATLVRED+KI DLNFL+GPKLYEA+WMELQ+ GYIA+VQC EV C M+PEFY EY+     +++L+Y MNP K R C++LI++HE+R DKIIVF+DN+FAL+ YA  + + Y+ G TS  ER++++ NFK NP +NTIF+SK+ D + DLPEA VLIQISS G SRRQEAQRLGR+ RAKKGM  +E NA+FY+LVS DT E  +S KRQ+FL DQGY+FKV+T+L GM +EDLMF+ +  Q +LL KVL A + D E E    +     +   +A T+S+M         SG D  VYM+
Sbjct:   12 KSKKRYYDDEDDEEFVAGTESPEAIPAAAGKQVDESSTKLDEYGAKDYRVQMLLKADHSSRPLWVAPDGHIFLEAFSPVYKYAQDFLVAIAEPVCRPSHVHEYKLTAYSLYAAVSVGLQTSDIIEYLQKLSKTSVPDGIVQFIKLCTVSYGKVKLVLKHNRYFVESAFPDVIQRLLQDPVIRDCRLRTTEGEETELITEVISNKPAISKTLQDNGGASTSQSADGQRSSAQVPEDIFSYYEQMDKEEEEEEET------------QTVSFEIRQEMIEELQKRCIQLEYPLLAEYDFRNDTVNPDINMDLKPTAVLRPYQEKSLRKMFGNGRARSGVIVLPCGAGKSLVGVTAACTVRKRCLVLGNSSVSVEQWKAQFKMWSTIDDSQICRFTSDAKDKPIGCSVAISTYSMLGHTTKRSWEAERVMEWMRSQEWGLIILDEVHTIPARMFRRVLTIVQAHCKLGLTATLVREDDKIVDLNFLIGPKLYEANWMELQNNGYIAKVQCAEVWCPMSPEFYHEYVAIKTKKRILLYTMNPNKFRACQFLIRFHERRNDKIIVFADNVFALKEYAIRLNKPYIYGPTSQGERMQILQNFKHNPKINTIFISKVGDTSFDLPEANVLIQISSHGGSRRQEAQRLGRVLRAKKGMVAEEYNAYFYSLVSQDTQEMAYSTKRQRFLVDQGYSFKVITKLAGMEEEDLMFSTREEQQQLLQKVLAATDLDAEEEVVAGEFGGKTQFSRRAGTMSSM---------SGADDAVYME 758          
BLAST of TFIIH basal transcription factor complex helicase XPB subunit vs. TrEMBL
Match: A0A4W2DNG5 (ERCC excision repair 3, TFIIH core complex helicase subunit OS=Bos indicus x Bos taurus OX=30522 GN=ERCC3 PE=4 SV=1)

HSP 1 Score: 789.26 bits (2037), Expect = 0.000e+0
Identity = 398/780 (51.03%), Postives = 535/780 (68.59%), Query Frame = 1
Query:   55 SKNKKSKAVQEAIDEFEDYTEYNSDTEESGENA----LIQDNYPVDENGAKDY-TSLELKKDHFNRPIWVAPDGCIYFETFNKLKKITQEFLITIAEPVSRPEHVHTYKLTDTSLYAAVSGGLKSEDIMRYLDKLCKTKLPENIVSFIKTATSNYGKANLVLRHGRLKIESKNLEQLRFLISDPKIKECLIKDSTG--LPIIHKE-------SDDLEDISNPFTNELD--RNDSDLAPDIIEFYKNIDRVVEENSSIIDNPVELLKKEKVAYSVEILESHLEKVKKRCIDLRSTLLSEYDFRNDNANPDIKMDLKPTTSLRPYQEKSLRKMFGHNRARSGIIVLPCGAGKTLVGVTAACTIRKRCIVFCTGGVAVEQWRNHFLNYTTIEEKKICRFTGSTKDPAKNTDVFVTTYNIIGYSGKRSYETKETLEWIKQQEWGLIILDEVHTIPAKTFRSVLQVIHGHCMLGLTATLVREDNKINDLNFLVGPKLYEADWMELQDKGYIARVQCVEVRCTMTPEFYWEYLKAPQNRKMLIYVMNPEKIRRCEYLIKYHEKRGDKIIVFSDNLFALRTYAGLMKRLYLEGDTSHEERIKVMDNFKQNPNVNTIFVSKMADVALDLPEATVLIQISSQGASRRQEAQRLGRITRAKKGMRPDEVNAFFYTLVSSDTTEQWFSVKRQQFLKDQGYAFKVVTELDGMNKEDLMFNNKAAQAELLAKVLTAHENDCEIEGKPAK--SASIKLPSKAETLSNMMAKKRKLHFSGGDGPVYMDTGAPSSR 2340
            S+ KKSK      +E E+     +DT+E+  +A    + +    VDE GAKDY   + LK DH +RP+WVAPDG I+ E F+ + K  Q+FL+ IAEPV RP HVH YKLT  SLYAAVS GL++ DI  YL KL KT +PE I+ FIK  T +YGK  LVL+H R  +ES + + ++ L+ DP I+EC +++S G    +I +        +  +E    P T+ +   +  SD+  D+ +FY+ +D+          +  E  + + V++  E+ +  +E+++KRCI L   LL+EYDFRND+ NPDI +DLKPT  LRPYQEKSLRKMFG+ RARSG+IVLPCGAGK+LVGVTAACT+RKRC+V     V+VEQW+  F  ++TI++ +ICRFT   KD      + ++TY+++G++ KRS+E +  +EW+K QEWGL+ILDEVHTIPAK FR VL ++  HC LGLTATLVRED+KI DLNFL+GPKLYEA+WMELQ+ GYIA+VQC EV C M+PEFY EY+     +++L+Y MNP K R C++LIK+HE+R DKIIVF+DN+FAL+ YA  + + Y+ G TS  ER++++ NFK NP +NTIF+SK+ D + DLPEA VLIQISS G SRRQEAQRLGR+ RAKKGM  +E NAFFY+LVS DT E  +S KRQ+FL DQGY+FKV+T+L GM +EDL F+ K  Q +LL KVL A + D E E    +  S S ++  +  T+S+M         SG D  VYM+  +  S+
Sbjct:    7 SEKKKSKKRHYEDEEDEEDDAPGNDTQEAVPSAAGKQVDESGTKVDEYGAKDYRLQMPLKDDHTSRPLWVAPDGHIFLEAFSPVYKYAQDFLVAIAEPVCRPTHVHEYKLTAYSLYAAVSVGLQTSDITDYLRKLSKTGVPEGIIQFIKLCTVSYGKVKLVLKHNRYFVESSHPDVIQHLLQDPVIRECRLRNSEGEATELITETFTSKSAIAKSVEGSGGPSTSRVTDPQGKSDIPTDLFDFYEQMDK----------DEEEEEETQTVSF--EVKQEMIEELQKRCIHLEYPLLAEYDFRNDSVNPDINIDLKPTAVLRPYQEKSLRKMFGNGRARSGVIVLPCGAGKSLVGVTAACTVRKRCLVLGNSAVSVEQWKAQFKMWSTIDDSQICRFTSDAKDKPIGCSIAISTYSMLGHTTKRSWEAERVMEWLKTQEWGLMILDEVHTIPAKMFRRVLTIVQAHCKLGLTATLVREDDKIVDLNFLIGPKLYEANWMELQNSGYIAKVQCAEVWCPMSPEFYREYVAIKTKKRILLYTMNPNKFRACQFLIKFHERRNDKIIVFADNVFALKEYAIRLNKPYIYGPTSQGERMQILQNFKHNPKINTIFISKVGDTSFDLPEANVLIQISSHGGSRRQEAQRLGRVLRAKKGMVAEEYNAFFYSLVSQDTQEMAYSTKRQRFLVDQGYSFKVITKLAGMEEEDLAFSTKEEQQQLLQKVLAATDLDAEEEVVAGEFGSKSSQVSRRFGTMSSM---------SGADDTVYMEYHSSRSK 765          
BLAST of TFIIH basal transcription factor complex helicase XPB subunit vs. TrEMBL
Match: K9IMP7 (Putative rna polymer OS=Desmodus rotundus OX=9430 PE=2 SV=1)

HSP 1 Score: 787.334 bits (2032), Expect = 0.000e+0
Identity = 385/736 (52.31%), Postives = 511/736 (69.43%), Query Frame = 1
Query:  175 VDENGAKDY-TSLELKKDHFNRPIWVAPDGCIYFETFNKLKKITQEFLITIAEPVSRPEHVHTYKLTDTSLYAAVSGGLKSEDIMRYLDKLCKTKLPENIVSFIKTATSNYGKANLVLRHGRLKIESKNLEQLRFLISDPKIKECLIKDSTG--LPIIHKE-------SDDLEDISNPFTNELD--RNDSDLAPDIIEFYKNIDRVVEENSSIIDNPVELLKKEKVAYSVEILESHLEKVKKRCIDLRSTLLSEYDFRNDNANPDIKMDLKPTTSLRPYQEKSLRKMFGHNRARSGIIVLPCGAGKTLVGVTAACTIRKRCIVFCTGGVAVEQWRNHFLNYTTIEEKKICRFTGSTKDPAKNTDVFVTTYNIIGYSGKRSYETKETLEWIKQQEWGLIILDEVHTIPAKTFRSVLQVIHGHCMLGLTATLVREDNKINDLNFLVGPKLYEADWMELQDKGYIARVQCVEVRCTMTPEFYWEYLKAPQNRKMLIYVMNPEKIRRCEYLIKYHEKRGDKIIVFSDNLFALRTYAGLMKRLYLEGDTSHEERIKVMDNFKQNPNVNTIFVSKMADVALDLPEATVLIQISSQGASRRQEAQRLGRITRAKKGMRPDEVNAFFYTLVSSDTTEQWFSVKRQQFLKDQGYAFKVVTELDGMNKEDLMFNNKAAQAELLAKVLTAHENDCEIEGKPAKSA--SIKLPSKAETLSNMMAKKRKLHFSGGDGPVYMDTGAPSSR 2340
            +DE GAKDY   + LK DH +RP+WVAPDG I+ E F+ + K  Q+FL+ IAEPV RP HVH YKLT  SLYAAVS GL++ DI  YL KL KT +PE I+ FIK  T +YGK  LVL+H R  +ES + + ++ L+ DP I+EC ++ S G    +I +        +   ED   P T+ +   +  SD+  D+++FY+ +D+  E+                   S E+ +  +E+++KRCI L   LL+EYDFRND+ NPDI +DLKPT  LRPYQEKSLRKMFG+ RARSG+IVLPCGAGK+LVGVTAACT+RKRC+V     V+VEQW+  F  ++TI++ +ICRFT   KD      + ++TY+++G++ KRS+E +  +EW++ QEWGL+ILDEVHTIPAK FR VL ++  HC LGLTATLVRED+KI DLNFL+GPKLYEA+WMELQ+ GYIA+VQC EV C M+PEFY EY+     +++L+Y MNP K R C++LIK+HE+R DKIIVF+DN+FAL+ YA  + + Y+ G TS  ER++++ NFK NP +NTIF+SK+ D + DLPEA VLIQISS G SRRQEAQRLGR+ RAKKGM  +E NAFFY+LVS DT E  +S KRQ+FL DQGY+FKV+T+L GM +E+L F+ K  Q +LL KVL A + D E E    +S   S ++  +  T+S+M         SG D  VYM+  +  S+
Sbjct:   53 LDEYGAKDYRLQMPLKADHNSRPLWVAPDGHIFLEAFSPVYKYAQDFLVAIAEPVCRPTHVHEYKLTAYSLYAAVSVGLQTSDITEYLRKLSKTGIPEGIIQFIKLCTVSYGKVKLVLKHNRYFVESSHPDVIQHLLQDPVIRECRLRSSEGEVTELITETFTSRSAIAKTTEDSGGPSTSRVTDPQGKSDIPTDLLDFYEQMDKDEEDEEET------------QTVSFEVKQEMIEELQKRCIHLEYPLLAEYDFRNDSVNPDINIDLKPTAVLRPYQEKSLRKMFGNGRARSGVIVLPCGAGKSLVGVTAACTVRKRCLVLGNSAVSVEQWKAQFKMWSTIDDSQICRFTSDAKDKPIGCSIAISTYSMLGHTTKRSWEAERVMEWLRTQEWGLMILDEVHTIPAKMFRRVLTIVQAHCKLGLTATLVREDDKIVDLNFLIGPKLYEANWMELQNNGYIAKVQCAEVWCPMSPEFYREYVAIKTKKRILLYTMNPNKFRACQFLIKFHERRNDKIIVFADNVFALKEYAIRLNKPYIYGPTSQGERMQILQNFKHNPKINTIFISKVGDTSFDLPEANVLIQISSHGGSRRQEAQRLGRVLRAKKGMVAEEYNAFFYSLVSQDTQEMAYSTKRQRFLVDQGYSFKVITKLAGMEEEELAFSTKEEQQQLLQKVLAATDLDAEEEVVAGESGFRSSQVSRRFGTMSSM---------SGADDTVYMEYHSARSK 767          
BLAST of TFIIH basal transcription factor complex helicase XPB subunit vs. TrEMBL
Match: A0A3B1JE20 (Excision repair cross-complementation group 3 OS=Astyanax mexicanus OX=7994 PE=4 SV=1)

HSP 1 Score: 786.949 bits (2031), Expect = 0.000e+0
Identity = 387/735 (52.65%), Postives = 500/735 (68.03%), Query Frame = 1
Query:  175 VDENGAKDYTS-LELKKDHFNRPIWVAPDGCIYFETFNKLKKITQEFLITIAEPVSRPEHVHTYKLTDTSLYAAVSGGLKSEDIMRYLDKLCKTKLPENIVSFIKTATSNYGKANLVLRHGRLKIESKNLEQLRFLISDPKIKECLIKDSTG------------LPIIHKESDDLEDISNPFTNELDRNDSDLAPDIIEFYKNIDRVVEENSSIIDNPVELLKKEKVAYSVEILESHLEKVKKRCIDLRSTLLSEYDFRNDNANPDIKMDLKPTTSLRPYQEKSLRKMFGHNRARSGIIVLPCGAGKTLVGVTAACTIRKRCIVFCTGGVAVEQWRNHFLNYTTIEEKKICRFTGSTKDPAKNTDVFVTTYNIIGYSGKRSYETKETLEWIKQQEWGLIILDEVHTIPAKTFRSVLQVIHGHCMLGLTATLVREDNKINDLNFLVGPKLYEADWMELQDKGYIARVQCVEVRCTMTPEFYWEYLKAPQNRKMLIYVMNPEKIRRCEYLIKYHEKRGDKIIVFSDNLFALRTYAGLMKRLYLEGDTSHEERIKVMDNFKQNPNVNTIFVSKMADVALDLPEATVLIQISSQGASRRQEAQRLGRITRAKKGMRPDEVNAFFYTLVSSDTTEQWFSVKRQQFLKDQGYAFKVVTELDGMNKEDLMFNNKAAQAELLAKVLTAHENDCEIE-------GKPAKSASIKLPSKAETLSNMMAKKRKLHFSGGDGPVYMD 2319
            +DE GAKDY S + LK DH +RP+WVAPDG I+ E F+ + K  Q+FL+ IAEPV RP HVH YKLT  SLYAAVS GL++ DI+ YL KL KT +P+ I+ FIK  T +YGK  LVL+H R  +ES   + ++ L+ D  I++C ++ + G             P I K   D    S     E  R  + +  DI  +Y+ +D+  EE                   S EI +  +E+++KRCI L   LL+EYDFRND  NPDI MDLKPT  LRPYQEKSLRKMFG+ RARSG+IVLPCGAGK+LVGVTAACT+RKRC+V     V+VEQW+  F  ++TI++ +ICRFT   KD      V ++TY+++G++ KRS+E +  +EW++ QEWGLIILDEVHTIPAK FR VL ++  HC LGLTATLVRED+KI DLNFL+GPKLYEA+WMELQ+ GYIA+VQC EV C M+PEFY EY+     +++L+Y MNP K R C++LI+YHE+R DKIIVF+DN+FAL+ YA  + + Y+ G TS  ER++++ NFK NP +NTIF+SK+ D + DLPEA VLIQISS G SRRQEAQRLGR+ RAKKGM  +E NA+FY+LVS DT E  +S KRQ+FL DQGY+FKV+T++ GM +EDLMFN +  Q +LL KVL A + D E E       GKP      +   +  T+S+M         SG D  VYM+
Sbjct:   51 LDEYGAKDYRSQMLLKNDHGSRPLWVAPDGHIFLEAFSPVYKYAQDFLVAIAEPVCRPNHVHEYKLTAYSLYAAVSVGLQTSDIVEYLQKLSKTSVPDGIIQFIKLCTVSYGKVKLVLKHNRYFVESAFPDVIQRLLQDVVIRDCRLRTAEGEETELITEVISSKPAISKSLQDGSGASTSQPAEGQRTGAQVPEDIFSYYEQMDKEEEEEEET------------QTVSFEIRQEMIEELQKRCIQLEYPLLAEYDFRNDTVNPDINMDLKPTAVLRPYQEKSLRKMFGNGRARSGVIVLPCGAGKSLVGVTAACTVRKRCLVLGNSSVSVEQWKAQFKMWSTIDDSQICRFTSDAKDKPIGCSVAISTYSMLGHTTKRSWEAERVMEWMRSQEWGLIILDEVHTIPAKMFRRVLTIVQAHCKLGLTATLVREDDKIVDLNFLIGPKLYEANWMELQNNGYIAKVQCAEVWCPMSPEFYREYVAIKTKKRILLYTMNPNKFRACQFLIRYHERRNDKIIVFADNVFALKEYAIRLNKPYIYGPTSQGERMQILQNFKHNPKINTIFISKVGDTSFDLPEANVLIQISSHGGSRRQEAQRLGRVLRAKKGMVAEEYNAYFYSLVSQDTQEMAYSTKRQRFLVDQGYSFKVITKMAGMEEEDLMFNTREEQQQLLQKVLAASDLDAEEEVVMGEMGGKP------QFSRRPGTMSSM---------SGADDTVYME 758          
BLAST of TFIIH basal transcription factor complex helicase XPB subunit vs. Ensembl Cavefish
Match: ercc3 (ERCC excision repair 3, TFIIH core complex helicase subunit [Source:NCBI gene;Acc:103032561])

HSP 1 Score: 786.949 bits (2031), Expect = 0.000e+0
Identity = 387/735 (52.65%), Postives = 500/735 (68.03%), Query Frame = 1
Query:  175 VDENGAKDYTS-LELKKDHFNRPIWVAPDGCIYFETFNKLKKITQEFLITIAEPVSRPEHVHTYKLTDTSLYAAVSGGLKSEDIMRYLDKLCKTKLPENIVSFIKTATSNYGKANLVLRHGRLKIESKNLEQLRFLISDPKIKECLIKDSTG------------LPIIHKESDDLEDISNPFTNELDRNDSDLAPDIIEFYKNIDRVVEENSSIIDNPVELLKKEKVAYSVEILESHLEKVKKRCIDLRSTLLSEYDFRNDNANPDIKMDLKPTTSLRPYQEKSLRKMFGHNRARSGIIVLPCGAGKTLVGVTAACTIRKRCIVFCTGGVAVEQWRNHFLNYTTIEEKKICRFTGSTKDPAKNTDVFVTTYNIIGYSGKRSYETKETLEWIKQQEWGLIILDEVHTIPAKTFRSVLQVIHGHCMLGLTATLVREDNKINDLNFLVGPKLYEADWMELQDKGYIARVQCVEVRCTMTPEFYWEYLKAPQNRKMLIYVMNPEKIRRCEYLIKYHEKRGDKIIVFSDNLFALRTYAGLMKRLYLEGDTSHEERIKVMDNFKQNPNVNTIFVSKMADVALDLPEATVLIQISSQGASRRQEAQRLGRITRAKKGMRPDEVNAFFYTLVSSDTTEQWFSVKRQQFLKDQGYAFKVVTELDGMNKEDLMFNNKAAQAELLAKVLTAHENDCEIE-------GKPAKSASIKLPSKAETLSNMMAKKRKLHFSGGDGPVYMD 2319
            +DE GAKDY S + LK DH +RP+WVAPDG I+ E F+ + K  Q+FL+ IAEPV RP HVH YKLT  SLYAAVS GL++ DI+ YL KL KT +P+ I+ FIK  T +YGK  LVL+H R  +ES   + ++ L+ D  I++C ++ + G             P I K   D    S     E  R  + +  DI  +Y+ +D+  EE                   S EI +  +E+++KRCI L   LL+EYDFRND  NPDI MDLKPT  LRPYQEKSLRKMFG+ RARSG+IVLPCGAGK+LVGVTAACT+RKRC+V     V+VEQW+  F  ++TI++ +ICRFT   KD      V ++TY+++G++ KRS+E +  +EW++ QEWGLIILDEVHTIPAK FR VL ++  HC LGLTATLVRED+KI DLNFL+GPKLYEA+WMELQ+ GYIA+VQC EV C M+PEFY EY+     +++L+Y MNP K R C++LI+YHE+R DKIIVF+DN+FAL+ YA  + + Y+ G TS  ER++++ NFK NP +NTIF+SK+ D + DLPEA VLIQISS G SRRQEAQRLGR+ RAKKGM  +E NA+FY+LVS DT E  +S KRQ+FL DQGY+FKV+T++ GM +EDLMFN +  Q +LL KVL A + D E E       GKP      +   +  T+S+M         SG D  VYM+
Sbjct:   51 LDEYGAKDYRSQMLLKNDHGSRPLWVAPDGHIFLEAFSPVYKYAQDFLVAIAEPVCRPNHVHEYKLTAYSLYAAVSVGLQTSDIVEYLQKLSKTSVPDGIIQFIKLCTVSYGKVKLVLKHNRYFVESAFPDVIQRLLQDVVIRDCRLRTAEGEETELITEVISSKPAISKSLQDGSGASTSQPAEGQRTGAQVPEDIFSYYEQMDKEEEEEEET------------QTVSFEIRQEMIEELQKRCIQLEYPLLAEYDFRNDTVNPDINMDLKPTAVLRPYQEKSLRKMFGNGRARSGVIVLPCGAGKSLVGVTAACTVRKRCLVLGNSSVSVEQWKAQFKMWSTIDDSQICRFTSDAKDKPIGCSVAISTYSMLGHTTKRSWEAERVMEWMRSQEWGLIILDEVHTIPAKMFRRVLTIVQAHCKLGLTATLVREDDKIVDLNFLIGPKLYEANWMELQNNGYIAKVQCAEVWCPMSPEFYREYVAIKTKKRILLYTMNPNKFRACQFLIRYHERRNDKIIVFADNVFALKEYAIRLNKPYIYGPTSQGERMQILQNFKHNPKINTIFISKVGDTSFDLPEANVLIQISSHGGSRRQEAQRLGRVLRAKKGMVAEEYNAYFYSLVSQDTQEMAYSTKRQRFLVDQGYSFKVITKMAGMEEEDLMFNTREEQQQLLQKVLAASDLDAEEEVVMGEMGGKP------QFSRRPGTMSSM---------SGADDTVYME 758          
BLAST of TFIIH basal transcription factor complex helicase XPB subunit vs. Ensembl Sea Lamprey
Match: ercc3 (excision repair cross-complementation group 3 [Source:NCBI gene;Acc:324323])

HSP 1 Score: 712.99 bits (1839), Expect = 0.000e+0
Identity = 350/721 (48.54%), Postives = 478/721 (66.30%), Query Frame = 1
Query:  250 APDGCIYFETFNKLKKITQEFLITIAEPVSRPEHVHTYKLTDTSLYAAVSGGLKSEDIMRYLDKLCKTKLPENIVSFIKTATSNYGKANLVLRHGRLKIESKNLEQLRFLISDPKIKECLIKDSTG-LPIIHK--ESDDLEDISNPFTNELDRNDSD----------------LAPDIIEFYKNIDRVVEENSSIIDNPVELLKKEKVAYSVEILESHLEKVKKRCIDLRSTLLSEYDFRNDNANPDIKMDLKPTTSLRPYQEKSLRKMFGHNRARSGIIVLPCGAGKTLVGVTAACTIRKRCIVFCTGGVAVEQWRNHFLNYTTIEEKKICRFTGSTKDPAKNTDVFVTTYNIIGYSGKRSYETKETLEWIKQQEWGLIILDEVHTIPAKTFRSVLQVIHGHCMLGLTATLVREDNKINDLNFLVGPKLYEADWMELQDKGYIARVQCVEVRCTMTPEFYWEYLKAPQNRKMLIYVMNPEKIRRCEYLIKYHEKRGDKIIVFSDNLFALRTYAGLMKRLYLEGDTSHEERIKVMDNFKQNPNVNTIFVSKMADVALDLPEATVLIQISSQGASRRQEAQRLGRITRAKKGMRPDEVNAFFYTLVSSDTTEQWFSVKRQQFLKDQGYAFKVVTELDGMNKEDLMFNNKAAQAELLAKVLTAHENDCEIEGKPAKSASIKLPSKAETLSNMMAKK--RKLHFSGGDGPVYMDTGAPSSRH*M 2349
            APDG I+ E F+ + K   +FLI IAEPV RP  +H Y+LT  SLYAAVS GL++ DI+ YL KL KT +P+ I++FI+  T +YGK  LVL+H R  +ES   + ++ L+ D  +K+C ++   G  P+I +         ++ P T  L   D                  +  DI  FY+ +D+  E+ +            E    S EI +  +E ++KRCI++   LL+EYDFRND  NPD+ +DLKPT  LRPYQEKSLRKMFG+ RARSG+IVLPCGAGK+LVGVTAACT+RKRC+V CT  V+VEQW+  F  ++T +E +ICRFT   KD      + ++TY+++G++ KRS+E +  ++W+K QEWGL++LDEVHTIPA+ FR VL ++  HC LGLTATLVRED+KI DLNFL+GPKLYEA+WMELQ+ GYIA+VQC EV C MTPEFY EY+     +++L+YVMNP K R C++LI++HE+R DK+IVF+DN+FAL+ YA  + + Y+ G TS  ER++++ NFK NP +NTIF+SK+ D + DLPEA VLIQISS G SRRQEAQRLGR+ RAKKGM  +E NA+FY+LVS DT E  +S KRQ+FL DQGY+FKV+    G++ E      +  Q + +A         C +    A +AS+  P + ET   +M+++       SG D  +Y++   P S+  M
Sbjct:    1 APDGHIFLEAFSPVYKYAHDFLIAIAEPVCRPARIHEYRLTAYSLYAAVSVGLQTSDIIEYLQKLSKTSIPDGILTFIRLCTVSYGKVKLVLKHNRYFVESAFPDVIQQLLQDDVVKQCRLRSEEGETPLITETFSGKSALQLNKPSTTSLGGADGACTSQGQTSEQTEAQTVVPSDIFHFYEQMDKEDEDEAV-----------ETHTVSFEIKQDTIELLQKRCIEMEFPLLAEYDFRNDAVNPDLDIDLKPTAVLRPYQEKSLRKMFGNGRARSGVIVLPCGAGKSLVGVTAACTVRKRCLVLCTSAVSVEQWKAQFRMWSTADESQICRFTSDAKDKPSGCGIAISTYSMLGHTTKRSWEAERVMDWMKSQEWGLMLLDEVHTIPARMFRRVLTIVQAHCKLGLTATLVREDDKIVDLNFLIGPKLYEANWMELQNAGYIAKVQCAEVWCPMTPEFYREYVSTRTKKRLLLYVMNPNKFRACQFLIRFHERRNDKVIVFADNVFALKEYAVRLNKPYIYGPTSQGERMQILQNFKHNPKINTIFISKVGDTSFDLPEANVLIQISSHGGSRRQEAQRLGRVLRAKKGMVAEEYNAYFYSLVSQDTQEMAYSAKRQRFLVDQGYSFKVLVLTRGLSVELQTPPARREQQQGMASA-------CRL--TRAATASVTAPME-ETRRGVMSRRVGSMSSMSGADNAMYLEYQVPRSKSSM 700          
BLAST of TFIIH basal transcription factor complex helicase XPB subunit vs. Ensembl Yeast
Match: SSL2 (Component of RNA polymerase transcription factor TFIIH holoenzyme; acts as dsDNA-dependent translocase in context of TFIIH, unwinds DNA strands during initiation and promotes transcription start site (TSS) scanning; has DNA-dependent ATPase/helicase activity; interacts functionally with TFIIB, has roles in TSS selection and gene looping to juxtapose initiation and termination regions; involved in DNA repair; relocalizes to cytosol under hypoxia; homolog of human ERCC3 [Source:SGD;Acc:S000001405])

HSP 1 Score: 660.603 bits (1703), Expect = 0.000e+0
Identity = 332/675 (49.19%), Postives = 453/675 (67.11%), Query Frame = 1
Query:  190 AKDYTSLELKKDHFNRPIWVAP-DGCIYFETFNKLKKITQEFLITIAEPVSRPEHVHTYKLTDTSLYAAVSGGLKSEDIMRYLDKLCKTKLPENIVSFIKTATSNYGKANLVLRHGRLKIESKNLEQLRFLISDPKIKECLI-KDSTGLPIIHKESDDLEDISNPFTNELDRNDSDLAPDIIEFYKNIDRVVEENSSIIDNPVELLKKEKVAYSVEILESHLEKVKKRCIDLRSTLLSEYDFRNDNANPDIKMDLKPTTSLRPYQEKSLRKMFGHNRARSGIIVLPCGAGKTLVGVTAACTIRKRCIVFCTGGVAVEQWRNHFLNYTTIEEKKICRFTGSTKDPAKN-TDVFVTTYNIIGYSGKRSYETKETLEWIKQQEWGLIILDEVHTIPAKTFRSVLQVIHGHCMLGLTATLVREDNKINDLNFLVGPKLYEADWMELQDKGYIARVQCVEVRCTMTPEFYWEYLKAPQNRKMLIYVMNPEKIRRCEYLIKYHEKRGDKIIVFSDNLFALRTYAGLMKRLYLEGDTSHEERIKVMDNFKQNPNVNTIFVSKMADVALDLPEATVLIQISSQGASRRQEAQRLGRITRAKKGMRPDE-VNAFFYTLVSSDTTEQWFSVKRQQFLKDQGYAFKVVTELDGM-NKEDLMFNNKAAQAELLAKVLTAHENDCEIE 2199
            + D++ L L+ DH +RP+W++P DG I  E+F+ L +  Q+FL+TIAEP+SRP H+H YK+T  SLYAAVS GL+++DI+  LD+L K  + E+I++FIK AT +YGK  LV++H R  +E+   + L+ L++D  I    I  D    P        L+  +      ++ ND             ++ V        +   E        +S EI    +E VKKRC ++   +L EYDFRND+ NPD+ +DLKP+T +RPYQEKSL KMFG+ RARSGIIVLPCGAGKTLVG+TAACTI+K  IV CT  V+V QWR  FL + T++ +    FT   K+  +  + + V+TY+++  +  RS+++++ ++++  +EWG IILDEVH +PA  FR V+  I  H  LGLTATLVRED+KI DLNFL+GPKLYEA+WMEL  KG+IA VQC EV C MT EFY EYL+    ++ML+Y+MNP K + C++LI+YHE+RGDKIIVFSDN++AL+ YA  M + ++ G T  +ER+ ++ NF+ N  +NTIF+SK+ D ++DLPEAT LIQISS   SRRQEAQRLGRI RAK+  R DE  NAFFY+LVS DT E ++S KRQ FL DQGYAFKV+T L GM N  +L + +   + ELL +VL  +E    IE
Sbjct:  115 SHDFSYLRLRPDHASRPLWISPSDGRIILESFSPLAEQAQDFLVTIAEPISRPSHIHEYKITAYSLYAAVSVGLETDDIISVLDRLSKVPVAESIINFIKGATISYGKVKLVIKHNRYFVETTQADILQMLLNDSVIGPLRIDSDHQVQPPEDVLQQQLQQTAGKPATNVNPND-------------VEAVFSAVIGGDNEREEEDDDIDAVHSFEIANESVEVVKKRCQEIDYPVLEEYDFRNDHRNPDLDIDLKPSTQIRPYQEKSLSKMFGNGRARSGIIVLPCGAGKTLVGITAACTIKKSVIVLCTSSVSVMQWRQQFLQWCTLQPENCAVFTSDNKEMFQTESGLVVSTYSMVANTRNRSHDSQKVMDFLTGREWGFIILDEVHVVPAAMFRRVVSTIAAHAKLGLTATLVREDDKIGDLNFLIGPKLYEANWMELSQKGHIANVQCAEVWCPMTAEFYQEYLRETARKRMLLYIMNPTKFQACQFLIQYHERRGDKIIVFSDNVYALQEYALKMGKPFIYGSTPQQERMNILQNFQYNDQINTIFLSKVGDTSIDLPEATCLIQISSHYGSRRQEAQRLGRILRAKR--RNDEGFNAFFYSLVSKDTQEMYYSTKRQAFLVDQGYAFKVITHLHGMENIPNLAYASPRERRELLQEVLLKNEEAAGIE 774          
BLAST of TFIIH basal transcription factor complex helicase XPB subunit vs. Ensembl Nematostella
Match: EDO43791 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXK7])

HSP 1 Score: 662.529 bits (1708), Expect = 0.000e+0
Identity = 356/748 (47.59%), Postives = 480/748 (64.17%), Query Frame = 1
Query:  178 DENGAKDY-TSLELKKDHFNRPIWVAPDGCIYFETFNKLKKITQEFLITIAEPVSRPEHVHTYKLTDTSLYAAVSGGLKSEDIMRYLDKLCKTKLPENIVSFIKTATSNYGKANLVLRHGRLKIESKNLEQLRFLISDPKIKECLIK-------DSTG------LPIIHKESDDLEDISNPFTNELDRNDSDLAPDIIEFYKNIDRVVEENSSIIDNPVELLKKEKVAYSVEILESHLEKVKKRCIDLRSTL-LSEYDFRNDNANPDIKMDLKPT---TSL-------RPYQEKSLRKMF--GHNRARSGIIVLPCGAGKTLVGVTAACTIRKRCIVFCTGGVAVEQWRNHFLNYTTIEEKKICRFTGSTKDPAKNTDVFVTTYNIIGYSGKRSYETKETLEWIKQQEWGLIILDEVHTIPAKTFRSVLQVIHGHCMLGLTATLVREDNKINDLNFLVGPKLYEADWMELQDKGYIARVQCVEVRCTMTPEFYWEYLKAPQNRKMLIYVMNPEKIRRCEYLIKYHEKRGDKIIVFSDNLFALRTYAGLMKRLYLEGDTSHEERIKVMDNFKQNPNVNTIFVSKMADVALDLPEATVLIQISSQGASRRQEAQRLGRITRAKKGMRPDEVNAFFYTLVSSDTTEQWFSVKRQQFLKDQGYAFKVVTELDGMNKEDLMFNNKAAQAELLAKVLTAHENDCEIEGKPAKSASIKLPSKAETLSNMMAKKRKLHFSGGDGPVYMDTGAPSSR 2340
            DE GAKDY   +ELK DH +RP+WVAPDG I+ E+F+ + K   +FLI I+EPV RPEHVH Y+LT  SLYAAVS GL++ DI+ YL +L KT +P+ I+ FIK  T +YGK  LVL+  +  +ES + + L+ L+ D KI++C  +       D TG      L    K ++    ++N  +N+  + +S L+   I+  K   R  ++ + +         K ++   + IL+ H   +K +C  L   L +  + F+        K  +KP    TSL        PY   S    F  G        + LP GAGKTLVGVTAACT+RKRC+V CT GVAVEQW+N F  ++T+  + IC FT   KD   +  + ++TY+++ + GKRS+E ++ + +++ QEWGL+ILDEVHTIPAK FR VL V+  HC LGLTATLVRED+KI DLNFL+GPKLYEA+WMELQ+ G+IARVQC EV C MTPEFY EYL     ++ L+YVMNP K R CE+LI+YHE+R DK+IVFSDN+FALR YA  +++ ++ G TS  ERI ++ NF+ NP VNTIF+SK+ D + DLPEA VLIQISS G SRRQEAQRLGRI RAKK M  +E NAFFYTLVS+DT E ++S KRQ+FL +QGY+FKV+T L GM +E+L  ++K  Q ELL KVL A + D E E K A     K  + +  + +M +       SG D  +Y++  +  S+
Sbjct:    1 DEFGAKDYRKQIELKPDHASRPLWVAPDGHIFLESFSPVYKHAHDFLIAISEPVCRPEHVHEYRLTAYSLYAAVSVGLQTNDIIEYLRRLSKTTIPDGIIQFIKMCTLSYGKVKLVLKRNQYFVESSHADVLQALLRDSKIQQCRKRAAEEDEADPTGQKDVMVLASTLKPNNSTGSLTNLKSNKERKAESPLS---IKRSKYHTRERDQQTQL---------KTQIDTFILILQVHFHGLKTQCPLLEGFLPVKRHHFKT-------KSLVKPCGTGTSLAFFSTVPHPYWSFSYHFFFKLGGGHMFLTCLYLPPGAGKTLVGVTAACTVRKRCLVLCTSGVAVEQWKNQFKLWSTVNSRIICCFTSDAKDKPTDCSIAISTYSMVSHMGKRSWEAEQVMSFLQSQEWGLMILDEVHTIPAKQFRRVLTVVQAHCKLGLTATLVREDDKIQDLNFLIGPKLYEANWMELQNSGFIARVQCAEVWCPMTPEFYSEYLNIKTRKRKLLYVMNPNKFRSCEFLIRYHERRNDKVIVFSDNVFALRNYAIKLQKPFIYGPTSQGERISILQNFQHNPLVNTIFISKVGDNSFDLPEANVLIQISSHGGSRRQEAQRLGRILRAKKDMAAEEYNAFFYTLVSTDTEEMYYSSKRQRFLVNQGYSFKVITRLAGMEEENLNLSSKKEQHELLQKVLAASDVDAE-EEKTAADFGQKGGAVSRRVGSMAS------MSGADDMIYLEYKSSKSK 722          
BLAST of TFIIH basal transcription factor complex helicase XPB subunit vs. Ensembl Nematostella
Match: EDO26028 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DVA7])

HSP 1 Score: 144.05 bits (362), Expect = 1.532e-40
Identity = 64/88 (72.73%), Postives = 72/88 (81.82%), Query Frame = 1
Query: 1324 GLIILDEVHTIPAKTFRSVLQVIHGHCMLGLTATLVREDNKINDLNFLVGPKLYEADWMELQDKGYIARVQCVEVRCTMTPEFYWEYL 1587
             +  + EVHTIPAK FR VL V+  HC LGLTATLVRED+KI DLNFL+GPKLYEA+WMELQ+ G+IARVQC EV C MTPEFY EYL
Sbjct:    8 SVFFIAEVHTIPAKQFRRVLTVVQAHCKLGLTATLVREDDKIQDLNFLIGPKLYEANWMELQNSGFIARVQCAEVWCPMTPEFYSEYL 95          
BLAST of TFIIH basal transcription factor complex helicase XPB subunit vs. Ensembl Medaka
Match: ercc3 (ERCC excision repair 3, TFIIH core complex helicase subunit [Source:NCBI gene;Acc:101157522])

HSP 1 Score: 776.933 bits (2005), Expect = 0.000e+0
Identity = 380/737 (51.56%), Postives = 509/737 (69.06%), Query Frame = 1
Query:  175 VDENGAKDY-TSLELKKDHFNRPIWVAPDGCIYFETFNKLKKITQEFLITIAEPVSRPEHVHTYKLTDTSLYAAVSGGLKSEDIMRYLDKLCKTKLPENIVSFIKTATSNYGKANLVLRHGRLKIESKNLEQLRFLISDPKIKECLIKDSTGL------------PIIHKESDDLEDISNPFTNELDRNDSDLAP-DIIEFYKNIDRVVEENSSIIDNPVELLKKEKVAYSVEILESHLEKVKKRCIDLRSTLLSEYDFRNDNANPDIKMDLKPTTSLRPYQEKSLRKMFGHNRARSGIIVLPCGAGKTLVGVTAACTIRKRCIVFCTGGVAVEQWRNHFLNYTTIEEKKICRFTGSTKDPAKNTDVFVTTYNIIGYSGKRSYETKETLEWIKQQEWGLIILDEVHTIPAKTFRSVLQVIHGHCMLGLTATLVREDNKINDLNFLVGPKLYEADWMELQDKGYIARVQCVEVRCTMTPEFYWEYLKAPQNRKMLIYVMNPEKIRRCEYLIKYHEKRGDKIIVFSDNLFALRTYAGLMKRLYLEGDTSHEERIKVMDNFKQNPNVNTIFVSKMADVALDLPEATVLIQISSQGASRRQEAQRLGRITRAKKGMRPDEVNAFFYTLVSSDTTEQWFSVKRQQFLKDQGYAFKVVTELDGMNKEDLMFNNKAAQAELLAKVLTAHENDCEIEGKPAK-SASIKLPSKAETLSNMMAKKRKLHFSGGDGPVYMDTGAPSSR 2340
            +DE GAKDY   + LK DH +RP+WVAPDG I+ E F+ + K  Q+FL+ IAEPV RP H+H YKLT  SLYAAVS GL++ DI+ YL KL KT +P+ IV FIK  T +YGK  LVL+H R  +ES   + ++ L+ D  I++C ++ + G             P I K  ++    S     +  +  +   P DI ++Y+ +D+          +  E  + + V++  EI +  +E+++KRCI L   LL+EYDFRND  NPDI +DLKPT  LRPYQEKSLRKMFG+ RARSG+IVLPCGAGK+LVGVTAACT+RKRC+V     V+VEQW+  F  ++TI+E  ICRFT   KD      V ++TY+++G++ KRS+E +  +EW++ QEWGLIILDEVHTIPA+ FR VL ++  HC LGLTATLVRED+KI DLNFL+GPKLYEA+WMELQ+ GYIA+VQC EV C M+PEFY EY+     +++L+Y MNP K R C++LI++HE+R DKIIVF+DN+FAL+ YA  + + Y+ G TS  ER++++ NFK NP +NTIF+SK+ D + DLPEA VLIQISS G SRRQEAQRLGR+ RAKKGM  +E NA+FY+LVS DT E  +S KRQ+FL DQGY+FKV+T+L GM++EDLMF+ +  Q +LL KVL A + D E E    +     ++  +A T+S+M         SG D  VYM+  + S++
Sbjct:   51 LDEYGAKDYRVQMLLKNDHSSRPLWVAPDGHIFLEAFSPVYKYAQDFLVAIAEPVCRPNHIHEYKLTAYSLYAAVSVGLQTSDIVEYLQKLSKTSVPDGIVQFIKLCTVSYGKVKLVLKHNRYFVESAFPDVIQRLLQDSVIRDCRLRTAGGADSELITEVIHSKPAITKSVEERGSASTSQQPDDGQTSTQQVPEDIFKYYEQMDK----------DEEEEEETQTVSF--EIRQEMIEELQKRCIQLEYPLLAEYDFRNDTVNPDIAIDLKPTAVLRPYQEKSLRKMFGNGRARSGVIVLPCGAGKSLVGVTAACTVRKRCLVLGNSSVSVEQWKAQFKMWSTIDESLICRFTSDAKDKPIGCSVAISTYSMLGHTTKRSWEAERVMEWMRSQEWGLIILDEVHTIPARMFRRVLTIVQAHCKLGLTATLVREDDKIVDLNFLIGPKLYEANWMELQNNGYIAKVQCAEVWCPMSPEFYREYVAIKTKKRILLYTMNPNKFRACQFLIRFHERRNDKIIVFADNVFALKEYAVRLNKPYIYGPTSQGERMQILQNFKHNPKINTIFISKVGDTSFDLPEANVLIQISSHGGSRRQEAQRLGRVLRAKKGMVAEEYNAYFYSLVSQDTQEMAYSTKRQRFLVDQGYSFKVITKLAGMDEEDLMFSTREEQQQLLQKVLAASDLDAEDEIVATELGVRPQVSRRAGTMSSM---------SGADDTVYMEYQSKSNK 766          
BLAST of TFIIH basal transcription factor complex helicase XPB subunit vs. Planmine SMEST
Match: SMESG000032343.1 (SMESG000032343.1)

HSP 1 Score: 1597.41 bits (4135), Expect = 0.000e+0
Identity = 766/766 (100.00%), Postives = 766/766 (100.00%), Query Frame = 1
Query:   46 MEHSKNKKSKAVQEAIDEFEDYTEYNSDTEESGENALIQDNYPVDENGAKDYTSLELKKDHFNRPIWVAPDGCIYFETFNKLKKITQEFLITIAEPVSRPEHVHTYKLTDTSLYAAVSGGLKSEDIMRYLDKLCKTKLPENIVSFIKTATSNYGKANLVLRHGRLKIESKNLEQLRFLISDPKIKECLIKDSTGLPIIHKESDDLEDISNPFTNELDRNDSDLAPDIIEFYKNIDRVVEENSSIIDNPVELLKKEKVAYSVEILESHLEKVKKRCIDLRSTLLSEYDFRNDNANPDIKMDLKPTTSLRPYQEKSLRKMFGHNRARSGIIVLPCGAGKTLVGVTAACTIRKRCIVFCTGGVAVEQWRNHFLNYTTIEEKKICRFTGSTKDPAKNTDVFVTTYNIIGYSGKRSYETKETLEWIKQQEWGLIILDEVHTIPAKTFRSVLQVIHGHCMLGLTATLVREDNKINDLNFLVGPKLYEADWMELQDKGYIARVQCVEVRCTMTPEFYWEYLKAPQNRKMLIYVMNPEKIRRCEYLIKYHEKRGDKIIVFSDNLFALRTYAGLMKRLYLEGDTSHEERIKVMDNFKQNPNVNTIFVSKMADVALDLPEATVLIQISSQGASRRQEAQRLGRITRAKKGMRPDEVNAFFYTLVSSDTTEQWFSVKRQQFLKDQGYAFKVVTELDGMNKEDLMFNNKAAQAELLAKVLTAHENDCEIEGKPAKSASIKLPSKAETLSNMMAKKRKLHFSGGDGPVYMDTGAPSSRH 2343
            MEHSKNKKSKAVQEAIDEFEDYTEYNSDTEESGENALIQDNYPVDENGAKDYTSLELKKDHFNRPIWVAPDGCIYFETFNKLKKITQEFLITIAEPVSRPEHVHTYKLTDTSLYAAVSGGLKSEDIMRYLDKLCKTKLPENIVSFIKTATSNYGKANLVLRHGRLKIESKNLEQLRFLISDPKIKECLIKDSTGLPIIHKESDDLEDISNPFTNELDRNDSDLAPDIIEFYKNIDRVVEENSSIIDNPVELLKKEKVAYSVEILESHLEKVKKRCIDLRSTLLSEYDFRNDNANPDIKMDLKPTTSLRPYQEKSLRKMFGHNRARSGIIVLPCGAGKTLVGVTAACTIRKRCIVFCTGGVAVEQWRNHFLNYTTIEEKKICRFTGSTKDPAKNTDVFVTTYNIIGYSGKRSYETKETLEWIKQQEWGLIILDEVHTIPAKTFRSVLQVIHGHCMLGLTATLVREDNKINDLNFLVGPKLYEADWMELQDKGYIARVQCVEVRCTMTPEFYWEYLKAPQNRKMLIYVMNPEKIRRCEYLIKYHEKRGDKIIVFSDNLFALRTYAGLMKRLYLEGDTSHEERIKVMDNFKQNPNVNTIFVSKMADVALDLPEATVLIQISSQGASRRQEAQRLGRITRAKKGMRPDEVNAFFYTLVSSDTTEQWFSVKRQQFLKDQGYAFKVVTELDGMNKEDLMFNNKAAQAELLAKVLTAHENDCEIEGKPAKSASIKLPSKAETLSNMMAKKRKLHFSGGDGPVYMDTGAPSSRH
Sbjct:    1 MEHSKNKKSKAVQEAIDEFEDYTEYNSDTEESGENALIQDNYPVDENGAKDYTSLELKKDHFNRPIWVAPDGCIYFETFNKLKKITQEFLITIAEPVSRPEHVHTYKLTDTSLYAAVSGGLKSEDIMRYLDKLCKTKLPENIVSFIKTATSNYGKANLVLRHGRLKIESKNLEQLRFLISDPKIKECLIKDSTGLPIIHKESDDLEDISNPFTNELDRNDSDLAPDIIEFYKNIDRVVEENSSIIDNPVELLKKEKVAYSVEILESHLEKVKKRCIDLRSTLLSEYDFRNDNANPDIKMDLKPTTSLRPYQEKSLRKMFGHNRARSGIIVLPCGAGKTLVGVTAACTIRKRCIVFCTGGVAVEQWRNHFLNYTTIEEKKICRFTGSTKDPAKNTDVFVTTYNIIGYSGKRSYETKETLEWIKQQEWGLIILDEVHTIPAKTFRSVLQVIHGHCMLGLTATLVREDNKINDLNFLVGPKLYEADWMELQDKGYIARVQCVEVRCTMTPEFYWEYLKAPQNRKMLIYVMNPEKIRRCEYLIKYHEKRGDKIIVFSDNLFALRTYAGLMKRLYLEGDTSHEERIKVMDNFKQNPNVNTIFVSKMADVALDLPEATVLIQISSQGASRRQEAQRLGRITRAKKGMRPDEVNAFFYTLVSSDTTEQWFSVKRQQFLKDQGYAFKVVTELDGMNKEDLMFNNKAAQAELLAKVLTAHENDCEIEGKPAKSASIKLPSKAETLSNMMAKKRKLHFSGGDGPVYMDTGAPSSRH 766          
The following BLAST results are available for this feature:
BLAST of TFIIH basal transcription factor complex helicase XPB subunit vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ERCC30.000e+052.72ERCC excision repair 3, TFIIH core complex helicas... [more]
ERCC30.000e+050.99ERCC excision repair 3, TFIIH core complex helicas... [more]
ERCC32.854e-13349.51ERCC excision repair 3, TFIIH core complex helicas... [more]
ERCC31.514e-13249.63ERCC excision repair 3, TFIIH core complex helicas... [more]
ERCC36.988e-7366.45ERCC excision repair 3, TFIIH core complex helicas... [more]
back to top
BLAST of TFIIH basal transcription factor complex helicase XPB subunit vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
xpb-10.000e+050.07XPB (Xeroderma Pigmentosum complementation group B... [more]
xpb-10.000e+050.07XPB (Xeroderma Pigmentosum complementation group B... [more]
xpb-10.000e+050.07XPB (Xeroderma Pigmentosum complementation group B... [more]
back to top
BLAST of TFIIH basal transcription factor complex helicase XPB subunit vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
hay0.000e+050.77gene:FBgn0001179 transcript:FBtr0076253[more]
hay0.000e+050.77gene:FBgn0001179 transcript:FBtr0114599[more]
back to top
BLAST of TFIIH basal transcription factor complex helicase XPB subunit vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ercc30.000e+051.69excision repair cross-complementation group 3 [Sou... [more]
back to top
BLAST of TFIIH basal transcription factor complex helicase XPB subunit vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ercc30.000e+052.46excision repair cross-complementation group 3 [Sou... [more]
ercc30.000e+051.06excision repair cross-complementation group 3 [Sou... [more]
back to top
BLAST of TFIIH basal transcription factor complex helicase XPB subunit vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Ercc30.000e+052.24excision repair cross-complementing rodent repair ... [more]
back to top
BLAST of TFIIH basal transcription factor complex helicase XPB subunit vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q1RMT1|ERCC3_BOVIN0.000e+051.58General transcription and DNA repair factor IIH he... [more]
sp|Q60HG1|ERCC3_MACFA0.000e+052.72General transcription and DNA repair factor IIH he... [more]
sp|P19447|ERCC3_HUMAN0.000e+052.72General transcription and DNA repair factor IIH he... [more]
sp|Q5RA62|ERCC3_PONAB0.000e+052.58General transcription and DNA repair factor IIH he... [more]
sp|P49135|ERCC3_MOUSE0.000e+052.24General transcription and DNA repair factor IIH he... [more]
back to top
BLAST of TFIIH basal transcription factor complex helicase XPB subunit vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2Y9E4T70.000e+052.99TFIIH basal transcription factor complex helicase ... [more]
A0A5N5PXS70.000e+050.91Uncharacterized protein OS=Pangasianodon hypophtha... [more]
A0A4W2DNG50.000e+051.03ERCC excision repair 3, TFIIH core complex helicas... [more]
K9IMP70.000e+052.31Putative rna polymer OS=Desmodus rotundus OX=9430 ... [more]
A0A3B1JE200.000e+052.65Excision repair cross-complementation group 3 OS=A... [more]
back to top
BLAST of TFIIH basal transcription factor complex helicase XPB subunit vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ercc30.000e+052.65ERCC excision repair 3, TFIIH core complex helicas... [more]
back to top
BLAST of TFIIH basal transcription factor complex helicase XPB subunit vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ercc30.000e+048.54excision repair cross-complementation group 3 [Sou... [more]
back to top
BLAST of TFIIH basal transcription factor complex helicase XPB subunit vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SSL20.000e+049.19Component of RNA polymerase transcription factor T... [more]
back to top
BLAST of TFIIH basal transcription factor complex helicase XPB subunit vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO437910.000e+047.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO260281.532e-4072.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
back to top
BLAST of TFIIH basal transcription factor complex helicase XPB subunit vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ercc30.000e+051.56ERCC excision repair 3, TFIIH core complex helicas... [more]
back to top
BLAST of TFIIH basal transcription factor complex helicase XPB subunit vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000032343.10.000e+0100.00SMESG000032343.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032044 ID=SMED30032044|Name=TFIIH basal transcription factor complex helicase XPB subunit|organism=Schmidtea mediterranea sexual|type=transcript|length=2390bp
TAAATCTTATATGTTTTATTTTAGCGATTCCATACTAATATATAAATGGA
ACATTCAAAAAACAAAAAATCTAAGGCAGTTCAAGAAGCAATAGATGAAT
TCGAAGATTATACTGAATATAATTCAGATACAGAAGAATCTGGAGAAAAT
GCATTAATTCAAGATAATTATCCCGTTGATGAAAATGGTGCTAAAGATTA
CACCTCATTAGAACTCAAGAAAGATCATTTTAATCGACCTATTTGGGTTG
CACCTGACGGGTGTATATATTTTGAAACATTTAATAAATTAAAAAAAATT
ACACAAGAATTTTTAATTACTATAGCTGAACCAGTATCACGACCAGAACA
TGTCCACACTTACAAGTTAACAGATACATCTTTGTATGCTGCAGTTTCTG
GTGGGTTAAAATCCGAAGACATCATGCGATATTTGGATAAGTTATGCAAA
ACTAAACTTCCTGAAAATATTGTTTCTTTTATTAAAACAGCAACCTCAAA
TTATGGCAAAGCAAATTTAGTTCTTCGACATGGTAGATTAAAAATTGAAA
GTAAAAATCTAGAACAACTTAGATTTTTAATTAGTGATCCAAAAATAAAA
GAATGCTTAATAAAAGATTCTACTGGACTGCCAATAATTCACAAAGAATC
AGATGATTTGGAAGATATATCTAATCCATTTACTAATGAATTAGATCGCA
ATGATTCGGATTTAGCTCCAGATATCATAGAATTTTATAAAAATATTGAT
AGAGTGGTTGAAGAAAATTCTAGCATTATTGATAATCCAGTTGAGCTTTT
GAAAAAAGAAAAAGTTGCTTATTCTGTGGAAATTTTAGAATCACATTTGG
AAAAGGTGAAAAAACGTTGCATTGATCTACGATCAACTTTATTATCGGAA
TATGATTTTCGAAATGACAATGCCAATCCCGACATTAAAATGGATTTAAA
ACCGACAACATCTCTCCGGCCATATCAAGAGAAATCACTGAGGAAAATGT
TCGGACATAATCGAGCTAGATCGGGAATAATCGTGTTGCCATGTGGAGCT
GGTAAAACATTGGTTGGAGTAACGGCAGCTTGTACGATTAGAAAACGATG
CATTGTGTTTTGTACTGGCGGTGTTGCCGTTGAACAATGGCGAAATCACT
TTCTAAACTATACGACGATCGAAGAAAAGAAAATCTGTCGATTTACAGGT
TCAACAAAAGATCCGGCAAAAAATACCGATGTATTCGTTACGACTTACAA
CATCATCGGTTACTCCGGGAAACGATCATACGAAACAAAGGAAACACTTG
AATGGATTAAACAACAAGAATGGGGCTTGATTATATTGGATGAAGTCCAC
ACGATTCCAGCGAAAACTTTCCGCAGTGTTTTGCAAGTCATTCACGGTCA
CTGCATGCTGGGATTGACTGCAACTCTCGTTCGAGAGGACAACAAAATCA
ATGATTTAAATTTCCTGGTAGGCCCGAAACTCTATGAAGCTGATTGGATG
GAACTGCAGGACAAAGGTTACATAGCACGTGTCCAGTGCGTTGAGGTCCG
GTGCACAATGACGCCTGAATTTTACTGGGAATATCTCAAGGCCCCGCAAA
ACCGGAAAATGCTCATCTACGTCATGAATCCAGAAAAGATCCGACGCTGT
GAATATTTGATCAAATACCATGAGAAGCGTGGCGATAAAATTATTGTGTT
TTCCGATAACCTTTTCGCGTTGCGTACTTATGCCGGTCTTATGAAGCGTT
TGTATCTTGAAGGGGACACTAGTCACGAGGAACGGATCAAGGTCATGGAT
AACTTCAAGCAAAATCCTAATGTGAATACAATTTTCGTGTCTAAAATGGC
AGATGTTGCATTAGATTTACCAGAAGCAACAGTTCTAATACAAATCTCAT
CCCAGGGTGCTTCACGGCGCCAAGAGGCTCAAAGACTCGGCCGTATTACC
CGAGCTAAAAAAGGAATGAGACCTGATGAAGTCAATGCGTTTTTCTACAC
TTTGGTTTCGTCAGACACGACAGAACAATGGTTCAGTGTCAAACGACAAC
AATTCCTTAAAGATCAAGGTTACGCTTTTAAAGTCGTAACAGAATTGGAT
GGTATGAACAAAGAAGATCTCATGTTCAATAACAAAGCTGCTCAAGCAGA
ACTGCTAGCTAAAGTGCTTACTGCTCATGAAAATGATTGCGAAATTGAAG
GAAAACCAGCCAAATCAGCATCAATTAAACTCCCCAGTAAAGCTGAAACA
TTATCCAATATGATGGCGAAAAAACGAAAGTTGCATTTTTCTGGCGGCGA
TGGACCGGTTTATATGGATACCGGTGCTCCCAGCAGCAGGCATTAGATGA
TATGTTTGAAATATATGTATTTGTTTGCTTCTATAAATAG
back to top

protein sequence of SMED30032044-orf-1

>SMED30032044-orf-1 ID=SMED30032044-orf-1|Name=SMED30032044-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=767bp
MEHSKNKKSKAVQEAIDEFEDYTEYNSDTEESGENALIQDNYPVDENGAK
DYTSLELKKDHFNRPIWVAPDGCIYFETFNKLKKITQEFLITIAEPVSRP
EHVHTYKLTDTSLYAAVSGGLKSEDIMRYLDKLCKTKLPENIVSFIKTAT
SNYGKANLVLRHGRLKIESKNLEQLRFLISDPKIKECLIKDSTGLPIIHK
ESDDLEDISNPFTNELDRNDSDLAPDIIEFYKNIDRVVEENSSIIDNPVE
LLKKEKVAYSVEILESHLEKVKKRCIDLRSTLLSEYDFRNDNANPDIKMD
LKPTTSLRPYQEKSLRKMFGHNRARSGIIVLPCGAGKTLVGVTAACTIRK
RCIVFCTGGVAVEQWRNHFLNYTTIEEKKICRFTGSTKDPAKNTDVFVTT
YNIIGYSGKRSYETKETLEWIKQQEWGLIILDEVHTIPAKTFRSVLQVIH
GHCMLGLTATLVREDNKINDLNFLVGPKLYEADWMELQDKGYIARVQCVE
VRCTMTPEFYWEYLKAPQNRKMLIYVMNPEKIRRCEYLIKYHEKRGDKII
VFSDNLFALRTYAGLMKRLYLEGDTSHEERIKVMDNFKQNPNVNTIFVSK
MADVALDLPEATVLIQISSQGASRRQEAQRLGRITRAKKGMRPDEVNAFF
YTLVSSDTTEQWFSVKRQQFLKDQGYAFKVVTELDGMNKEDLMFNNKAAQ
AELLAKVLTAHENDCEIEGKPAKSASIKLPSKAETLSNMMAKKRKLHFSG
GDGPVYMDTGAPSSRH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003678DNA helicase activity
GO:0016787hydrolase activity
GO:0003677DNA binding
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0004003ATP-dependent DNA helicase activity
GO:0004386helicase activity
GO:0004672protein kinase activity
GO:0008022protein C-terminus binding
GO:0008094DNA-dependent ATPase activity
GO:0008134transcription factor binding
GO:0008353RNA polymerase II carboxy-terminal domain kinase activity
GO:0016887ATPase activity
GO:00431383'-5' DNA helicase activity
GO:0047485protein N-terminus binding
Vocabulary: biological process
TermDefinition
GO:0032508DNA duplex unwinding
GO:0000717nucleotide-excision repair, DNA duplex unwinding
GO:0006265DNA topological change
GO:0006281DNA repair
GO:0006283transcription-coupled nucleotide-excision repair
GO:0006289nucleotide-excision repair
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0006366transcription from RNA polymerase II promoter
GO:0006367transcription initiation from RNA polymerase II promoter
GO:0006468protein phosphorylation
GO:0006915apoptotic process
GO:0006974cellular response to DNA damage stimulus
GO:0006979response to oxidative stress
GO:0008104protein localization
GO:0009411response to UV
GO:0009650UV protection
GO:0033683nucleotide-excision repair, DNA incision
GO:0035315hair cell differentiation
GO:0043065positive regulation of apoptotic process
GO:0045944positive regulation of transcription from RNA polymerase II promoter
GO:1901990regulation of mitotic cell cycle phase transition
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR001161XPB/Ssl2
IPR001650Helicase_C
IPR014001Helicase_ATP-bd
IPR027417P-loop_NTPase
IPR032830XPB/Ssl2_N
IPR006935Helicase/UvrB_N
IPR032438ERCC3_RAD25_C
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005669transcription factor TFIID complex
GO:0005675holo TFIIH complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00851XRODRMPGMNTBcoord: 547..569
score: 59.78
coord: 594..612
score: 63.16
coord: 491..513
score: 71.2
coord: 644..667
score: 61.46
coord: 150..169
score: 52.5
coord: 288..314
score: 74.07
coord: 64..84
score: 47.62
coord: 613..638
score: 82.21
coord: 740..759
score: 25.62
coord: 319..341
score: 85.87
coord: 528..543
score: 60.94
coord: 425..445
score: 74.4
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 488..720
e-value: 3.0E-64
score: 218.5
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 296..487
e-value: 1.1E-36
score: 128.0
NoneNo IPR availablePANTHERPTHR11274:SF0GENERAL TRANSCRIPTION AND DNA REPAIR FACTOR IIH HELICASE SUBUNIT XPBcoord: 46..724
NoneNo IPR availablePANTHERPTHR11274RAD25/XP-B DNA REPAIR HELICASEcoord: 46..724
NoneNo IPR availableCDDcd18029DEXHc_XPBcoord: 299..467
e-value: 4.19524E-91
score: 280.727
NoneNo IPR availableCDDcd18789SF2_C_XPBcoord: 498..654
e-value: 1.27029E-67
score: 218.273
IPR001650Helicase, C-terminalSMARTSM00490helicmild6coord: 560..638
e-value: 1.3E-6
score: 37.9
IPR001650Helicase, C-terminalPROSITEPS51194HELICASE_CTERcoord: 533..693
score: 11.121
IPR014001Helicase superfamily 1/2, ATP-binding domainSMARTSM00487ultradead3coord: 303..483
e-value: 6.8E-21
score: 85.4
IPR014001Helicase superfamily 1/2, ATP-binding domainPROSITEPS51192HELICASE_ATP_BIND_1coord: 318..479
score: 17.991
IPR006935Helicase/UvrB, N-terminalPFAMPF04851ResIIIcoord: 306..461
e-value: 5.7E-19
score: 68.8
IPR001161Helicase XPB/Ssl2TIGRFAMTIGR00603TIGR00603coord: 51..759
e-value: 1.1E-292
score: 970.6
IPR032438ERCC3/RAD25/XPB helicase, C-terminal domainPFAMPF16203ERCC3_RAD25_Ccoord: 487..723
e-value: 1.0E-105
score: 352.4
IPR032830Helicase XPB/Ssl2, N-terminal domainPFAMPF13625Helicase_C_3coord: 66..190
e-value: 5.5E-30
score: 104.1
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 424..678
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 251..481