Ring finger protein 113a

Overview
NameRing finger protein 113a
Smed IDSMED30032034
Length (bp)904
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ring finger protein 113a (SMED30032034) t-SNE clustered cells

Violin plots show distribution of expression levels for Ring finger protein 113a (SMED30032034) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ring finger protein 113a (SMED30032034) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ring finger protein 113a (SMED30032034) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032034

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
posterior sideSMED30032034SMESG000037494.1 dd_Smed_v4_7536_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30032034SMESG000037494.1 dd_Smed_v4_7536_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ring finger protein 113a vs. Ensembl Human
Match: RNF113A (ring finger protein 113A [Source:HGNC Symbol;Acc:HGNC:12974])

HSP 1 Score: 233.802 bits (595), Expect = 1.351e-74
Identity = 114/222 (51.35%), Postives = 149/222 (67.12%), Query Frame = 2
Query:  188 YEANKTSTKSRPSDLGATSHLEIDTETTQDAQAIFERVQKDKK----KAEDGLYHGMQCYDRLTEVKDTIAGNAASGFNRKGPMRAPTNIRSTTRWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYKFGWQLEQEELNGHSDDSADDKYEIHESDEEDANIPHFCSYCRGEFKEPVVTKCMHYFCSKCAIEMFKSMKGKCQACEKDTEGNFKNADYIFTKI 841
            Y++ +++    P D+GAT+  E+DTE  +DAQAIFER QK ++    K +D +Y G+  Y +  + KDT  GNA+SG  RKGP+RAP ++R+T RWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYK GWQ+E+E   G      D+ YE+   DEE   IP  C  CR  F+ PVVTKC HYFC  CA++ F++   +C  C++ T G F  A  +  K+
Sbjct:  100 YKSTRSAKPVGPEDMGATAVYELDTEKERDAQAIFERSQKIQEELRGKEDDKIYRGINNYQKYMKPKDTSMGNASSGMVRKGPIRAPEHLRATVRWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYKHGWQIERELDEGRYGVYEDENYEVGSDDEE---IPFKCFICRQSFQNPVVTKCRHYFCESCALQHFRTTP-RCYVCDQQTNGVFNPAKELIAKL 317          
BLAST of Ring finger protein 113a vs. Ensembl Human
Match: RNF113B (ring finger protein 113B [Source:HGNC Symbol;Acc:HGNC:17267])

HSP 1 Score: 216.468 bits (550), Expect = 3.581e-68
Identity = 108/233 (46.35%), Postives = 145/233 (62.23%), Query Frame = 2
Query:  188 YEANKTSTKSRPSDLGATSHLEIDTETTQDAQAIF---ERVQKDKKKAE-DGLYHGMQCYDRLTEVKDTIAGNAASGFNRKGPMRAPTNIRSTTRWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYKFGWQLEQEELNGHSDDSADDKYEIHESDEEDANIPHFCSYCRGEFKEPVVTKCMHYFCSKCAIEMFKSMKGKCQACEKDTEGNFKNADYIFTKIAAIEEKRNKKK 874
            Y + +++    P D+GAT+  E DTE       I    +RVQ+  +  E D +Y G+  Y R  + KDT  GN++SG  RKGP+RAP ++R+T RWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYK GW++E+E   G      D+ +E+   +EE   IP  C  CR  F+ PVVTKC HYFC  CA+E F++   +C  C++ T G F  A  +  K+  ++    KK+
Sbjct:   94 YRSTRSAKPVGPEDMGATADFEQDTEKEHHTPTILKCSQRVQEALRGREHDHIYRGIHSYLRYLKPKDTSMGNSSSGMARKGPIRAPGHLRATVRWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYKLGWEIERELEEGRYCICEDENHEVGSEEEE---IPFRCFICRQAFQNPVVTKCRHYFCESCALEHFRATP-RCYICDQPTGGIFNPAKELMAKLQKLQAAEGKKR 322          
BLAST of Ring finger protein 113a vs. Ensembl Celegans
Match: rnf-113 (Probable E3 ubiquitin-protein ligase rnf113 [Source:UniProtKB/Swiss-Prot;Acc:O17917])

HSP 1 Score: 216.853 bits (551), Expect = 4.869e-68
Identity = 111/226 (49.12%), Postives = 142/226 (62.83%), Query Frame = 2
Query:  176 TVHRYEANKTSTKSRPSDLGATSHLEIDTETTQDAQAIFERVQKDKKKA--EDG--LYHGMQCYDRLTEVKDTIAGNAASGFNRKGPMRAPTNIRSTTRWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYKFGWQLEQEELNGHSDDSADDKYEIHESDEEDANIPHFCSYCRGEFKEPVVTKCMHYFCSKCAIEMFKSMKGKCQACEKDTEGNFKNADYIFTKI 841
              H + A+  +  S P D GAT+ LE+DT+ + DAQA FERVQ+  K+   +DG  LY G   Y    E KDT  GNAASG+NR GP+RAP  +R T RWD+ PDICKDYKETGFC FGDSCKF+HDRSDYK GW++++E   G      D  YEIHE D+     P  C  C   F +P+VTKC HYFC+ CA++ F+    KC  C+++TE     A  + T +
Sbjct:   76 ATHSFAASGDAGPSGPRDQGATATLEVDTDYSHDAQAQFERVQQQLKEGVEKDGKILYKGSALYG-AKEAKDTAKGNAASGYNRVGPVRAPQFLRQTVRWDFAPDICKDYKETGFCTFGDSCKFVHDRSDYKHGWEIDEEYEAGKYGAEDDANYEIHEGDD---TFPEDCFICGNPFVDPIVTKCKHYFCTGCALKSFQK-SSKCPICQQNTENIMNTAKELLTYL 296          
BLAST of Ring finger protein 113a vs. Ensembl Fly
Match: mdlc (gene:FBgn0038772 transcript:FBtr0083835)

HSP 1 Score: 227.639 bits (579), Expect = 2.307e-72
Identity = 134/311 (43.09%), Postives = 176/311 (56.59%), Query Frame = 2
Query:   23 FKNCKFIKKSGIRQRKE----------DTDSEGESANPCYL--KRKLVKPVLEFTSKSSKSENTVH------------------RYEANKTSTKSRPSDLGATSHLEIDTETTQDAQAIFERVQKDKK----KAEDGLYHGMQCYDRLTEVKDTIAGNAASGFNRKGPMRAPTNIRSTTRWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYKFGWQLEQEELN---GHSDDSADD-KYEIHESDEEDANIPHFCSYCRGEFKEPVVTKCMHYFCSKCAIEMFKSMKGKCQACEKDTEGNFKNADYIFTKI 841
            FK     K +GIR++KE          D +++G+++       +RK   P  + T   SK++                       Y++ + +  S P D GATS  E+DTE  +DAQAI  R  K  +    KA+D +Y G+  Y +  + +DT AGNA+SG  R GP+RAP ++R+T RWDYQPDICKDYKETG+CGFGDSCKFLHDRSDYK GWQLE +  N   G  D   DD KYEIH SDEE   +P  C  CR  F  PVVTKC HYFC KCA+  +K  + +C  C + T G F  A  +  ++
Sbjct:   13 FKKRNLKKGAGIRRKKETSSDESAKSSDEETKGKASALVRAENRRKRTNPNFQSTKTMSKAKRQAGGVGDDGSSSASDDDKLGIAYKSKREALPSGPQDQGATSINEMDTELDRDAQAIHARALKINEELEGKADDKIYRGINNYAQYYKKQDTAAGNASSGMVRSGPIRAPAHLRATVRWDYQPDICKDYKETGYCGFGDSCKFLHDRSDYKAGWQLEMDHENQRTGDVDSDGDDTKYEIH-SDEE--TLPFKCHICRQSFVNPVVTKCKHYFCEKCALAQYKKSQ-RCIICSQQTNGIFNPAKELIARL 319          
BLAST of Ring finger protein 113a vs. Ensembl Zebrafish
Match: rnf113a (ring finger protein 113A [Source:ZFIN;Acc:ZDB-GENE-040825-1])

HSP 1 Score: 233.032 bits (593), Expect = 7.109e-75
Identity = 110/222 (49.55%), Postives = 149/222 (67.12%), Query Frame = 2
Query:  188 YEANKTSTKSRPSDLGATSHLEIDTETTQDAQAIFERVQKDKK----KAEDGLYHGMQCYDRLTEVKDTIAGNAASGFNRKGPMRAPTNIRSTTRWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYKFGWQLEQEELNGHSDDSADDKYEIHESDEEDANIPHFCSYCRGEFKEPVVTKCMHYFCSKCAIEMFKSMKGKCQACEKDTEGNFKNADYIFTKI 841
            Y++ +++    P D+GAT+  E+DTE  +DAQAIFER QK ++    K +D +Y G+  Y +  + KD+  GNA+SG  RKGP+RAP ++R+T RWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYK GWQ+E+E   G    + D+ YE+   DE   ++P  C  CR  FK P++TKC HYFC  CA++ ++  K +C  C + T G F  A  +  K+
Sbjct:   88 YKSTRSAKPEGPDDMGATAVYELDTERDKDAQAIFERSQKIQEELTGKEDDKIYRGINNYHKFIKPKDSTMGNASSGMVRKGPIRAPEHLRATVRWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYKHGWQIERELEEGRYGANDDENYEVSSDDE---DLPFKCFICRESFKNPIITKCRHYFCEACALQHYRKSK-RCYVCNQQTNGVFNPAKELMAKM 305          
BLAST of Ring finger protein 113a vs. Ensembl Xenopus
Match: rnf113a (ring finger protein 113A [Source:NCBI gene;Acc:548788])

HSP 1 Score: 238.039 bits (606), Expect = 1.264e-76
Identity = 134/287 (46.69%), Postives = 179/287 (62.37%), Query Frame = 2
Query:   56 IRQRKEDTDSEGESANPCYLK-RKLVKPVLEFTSKSSKSENTVHR-----YEANKTSTKSRPSDLGATSHLEIDTETTQDAQAIFERVQKD----KKKAEDGLYHGMQCYDRLTEVKDTIAGNAASGFNRKGPMRAPTNIRSTTRWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYKFGWQLEQEELNGHSDDSADDKYEIHESDEEDANIPHFCSYCRGEFKEPVVTKCMHYFCSKCAIEMFKSMKGKCQACEKDTEGNFKNADYIFTKIAAIEEKRNKKKESDS 886
            IR+ K+D        NP   K R+  K   ++ + SS+ E+   +     Y++ +++    P D+GAT+  E+DTE  +DAQAIFER QK     K K +D +Y G+  Y +  + KDT  GNA+SG  RKGP+RAP ++R+T RWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYK GWQLE+E   G    + ++ YE+  SDEED   P  C  CR  FK P++TKC HYFC KCA+E ++  K +C  C   T G F  A  +   IA +E+ + ++  SDS
Sbjct:   41 IRRIKKDV------VNPMIQKSRQQPKDCEDYKASSSEDEDKTAKSITVSYKSTRSAKPVGPDDMGATATYELDTEKDKDAQAIFERSQKVQEELKGKEDDKIYRGIHNYQKFVKPKDTSMGNASSGMVRKGPIRAPEHLRATVRWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYKHGWQLERELEEGRYGANDEENYEV-SSDEED--FPFKCFICRDSFKNPIITKCKHYFCEKCALEHYRKSK-RCYVCNTQTNGVFNPAKEL---IAKLEKHKAEEGGSDS 314          
BLAST of Ring finger protein 113a vs. Ensembl Xenopus
Match: rnf113a (ring finger protein 113A [Source:NCBI gene;Acc:548788])

HSP 1 Score: 231.106 bits (588), Expect = 3.944e-74
Identity = 116/215 (53.95%), Postives = 146/215 (67.91%), Query Frame = 2
Query:  188 YEANKTSTKSRPSDLGATSHLEIDTETTQDAQAIFERVQKD----KKKAEDGLYHGMQCYDRLTEVKDTIAGNAASGFNRKGPMRAPTNIRSTTRWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYKFGWQLEQEELNGHSDDSADDKYEIHESDEEDANIPHFCSYCRGEFKEPVVTKCMHYFCSKCAIEMFKSMKGKCQACEKDTEGNFKNA 820
            Y++ +++    P D+GAT+  E+DTE  +DAQAIFER QK     K K +D +Y G+  Y +  + KDT  GNA+SG  RKGP+RAP ++R+T RWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYK GWQLE+E   G    + ++ YE+  SDEED   P  C  CR  FK P++TKC HYFC KCA+E ++  K +C  C   T G F  A
Sbjct:   34 YKSTRSAKPVGPDDMGATATYELDTEKDKDAQAIFERSQKVQEELKGKEDDKIYRGIHNYQKFVKPKDTSMGNASSGMVRKGPIRAPEHLRATVRWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYKHGWQLERELEEGRYGANDEENYEV-SSDEED--FPFKCFICRDSFKNPIITKCKHYFCEKCALEHYRKSK-RCYVCNTQTNGVFNPA 244          
BLAST of Ring finger protein 113a vs. Ensembl Mouse
Match: Rnf113a2 (ring finger protein 113A2 [Source:MGI Symbol;Acc:MGI:1913631])

HSP 1 Score: 234.958 bits (598), Expect = 2.388e-75
Identity = 115/222 (51.80%), Postives = 149/222 (67.12%), Query Frame = 2
Query:  188 YEANKTSTKSRPSDLGATSHLEIDTETTQDAQAIFERVQKDKK----KAEDGLYHGMQCYDRLTEVKDTIAGNAASGFNRKGPMRAPTNIRSTTRWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYKFGWQLEQEELNGHSDDSADDKYEIHESDEEDANIPHFCSYCRGEFKEPVVTKCMHYFCSKCAIEMFKSMKGKCQACEKDTEGNFKNADYIFTKI 841
            Y++ +++    P D+GAT+  E+DTE  +DAQAIFER QK ++    K +D +Y G+  Y +  + KDT  GNA+SG  RKGP+RAP ++R+T RWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYK GWQ+E+E   G      D+ YE+   DEE   IP  C  CR  F+ PVVTKC HYFC  CA++ F++   +C  CE+ T G F  A  +  K+
Sbjct:  100 YKSTRSAKPVGPEDMGATAVYELDTEKERDAQAIFERSQKIQEELRGKEDDKIYRGINNYQKYMKPKDTSMGNASSGMVRKGPIRAPEHLRATVRWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYKHGWQIERELDEGRYGVYEDENYEVESDDEE---IPFKCFICRQTFQNPVVTKCKHYFCETCALQHFRTTP-RCYVCEQQTHGVFNPAKELIAKL 317          
BLAST of Ring finger protein 113a vs. Ensembl Mouse
Match: Rnf113a1 (ring finger protein 113A1 [Source:MGI Symbol;Acc:MGI:1917192])

HSP 1 Score: 234.572 bits (597), Expect = 4.520e-75
Identity = 113/223 (50.67%), Postives = 150/223 (67.26%), Query Frame = 2
Query:  188 YEANKTSTKSRPSDLGATSHLEIDTETTQDAQAIFERVQKDKK----KAEDGLYHGMQCYDRLTEVKDTIAGNAASGFNRKGPMRAPTNIRSTTRWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYKFGWQLEQEELNGHSDDSADDKYEIHESDEEDANIPHFCSYCRGEFKEPVVTKCMHYFCSKCAIEMFKSMKGKCQACEKDTEGNFKNADYIFTKIA 844
            Y++ +++    P D+GAT+  E+DTE  +DAQ+IFER QK ++    K +D +Y G+  Y +  + KDT  GNA+SG  RKGP+RAP ++R+T RWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYK GWQ+E+E   G      D+ YE+   DEE   IP  C  CR  F+ PVVTKC HYFC +CA++ F++   +C  C++ T G F  A  +  K+ 
Sbjct:   98 YKSTRSAKPVGPEDMGATAVYELDTEKDRDAQSIFERSQKIQEELRGKEDDKIYRGINNYQKYVKPKDTSMGNASSGMVRKGPIRAPEHLRATVRWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYKHGWQIERELDEGRYGVYEDENYEVGSDDEE---IPFKCFICRQTFQNPVVTKCRHYFCERCALQHFRTT-SRCYVCDQQTNGVFNPAKELIAKLG 316          
BLAST of Ring finger protein 113a vs. UniProt/SwissProt
Match: sp|O15541|R113A_HUMAN (E3 ubiquitin-protein ligase RNF113A OS=Homo sapiens OX=9606 GN=RNF113A PE=1 SV=1)

HSP 1 Score: 233.802 bits (595), Expect = 6.489e-74
Identity = 114/222 (51.35%), Postives = 149/222 (67.12%), Query Frame = 2
Query:  188 YEANKTSTKSRPSDLGATSHLEIDTETTQDAQAIFERVQKDKK----KAEDGLYHGMQCYDRLTEVKDTIAGNAASGFNRKGPMRAPTNIRSTTRWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYKFGWQLEQEELNGHSDDSADDKYEIHESDEEDANIPHFCSYCRGEFKEPVVTKCMHYFCSKCAIEMFKSMKGKCQACEKDTEGNFKNADYIFTKI 841
            Y++ +++    P D+GAT+  E+DTE  +DAQAIFER QK ++    K +D +Y G+  Y +  + KDT  GNA+SG  RKGP+RAP ++R+T RWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYK GWQ+E+E   G      D+ YE+   DEE   IP  C  CR  F+ PVVTKC HYFC  CA++ F++   +C  C++ T G F  A  +  K+
Sbjct:  100 YKSTRSAKPVGPEDMGATAVYELDTEKERDAQAIFERSQKIQEELRGKEDDKIYRGINNYQKYMKPKDTSMGNASSGMVRKGPIRAPEHLRATVRWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYKHGWQIERELDEGRYGVYEDENYEVGSDDEE---IPFKCFICRQSFQNPVVTKCRHYFCESCALQHFRTTP-RCYVCDQQTNGVFNPAKELIAKL 317          
BLAST of Ring finger protein 113a vs. UniProt/SwissProt
Match: sp|Q67ER4|R113A_BOVIN (E3 ubiquitin-protein ligase RNF113A OS=Bos taurus OX=9913 GN=RNF113A PE=2 SV=1)

HSP 1 Score: 231.491 bits (589), Expect = 4.402e-73
Identity = 112/222 (50.45%), Postives = 149/222 (67.12%), Query Frame = 2
Query:  188 YEANKTSTKSRPSDLGATSHLEIDTETTQDAQAIFERVQKDKK----KAEDGLYHGMQCYDRLTEVKDTIAGNAASGFNRKGPMRAPTNIRSTTRWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYKFGWQLEQEELNGHSDDSADDKYEIHESDEEDANIPHFCSYCRGEFKEPVVTKCMHYFCSKCAIEMFKSMKGKCQACEKDTEGNFKNADYIFTKI 841
            Y++ +++    P D+GAT+  E+DTE  +DAQAIFER QK ++    + +D +Y G+  Y +  + KDT  GNA+SG  RKGP+RAP ++R+T RWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYK GWQ+E+E   G      D+ YE+   +EE   IP  C  CR  F+ PVVTKC HYFC  CA++ F++   +C  C++ T G F  A  +  K+
Sbjct:  100 YKSTRSAKPVGPEDMGATAVYELDTEKERDAQAIFERSQKIQEELRGQEDDKIYRGINNYQKFMKPKDTSMGNASSGMVRKGPIRAPEHLRATVRWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYKHGWQIERELDEGRYGVYEDENYEVGSDEEE---IPFKCFICRQTFQNPVVTKCRHYFCESCALQHFRTTP-RCYVCDQQTNGVFNPAKELIAKL 317          
BLAST of Ring finger protein 113a vs. UniProt/SwissProt
Match: sp|Q8IZP6|R113B_HUMAN (RING finger protein 113B OS=Homo sapiens OX=9606 GN=RNF113B PE=1 SV=3)

HSP 1 Score: 216.468 bits (550), Expect = 1.720e-67
Identity = 108/233 (46.35%), Postives = 145/233 (62.23%), Query Frame = 2
Query:  188 YEANKTSTKSRPSDLGATSHLEIDTETTQDAQAIF---ERVQKDKKKAE-DGLYHGMQCYDRLTEVKDTIAGNAASGFNRKGPMRAPTNIRSTTRWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYKFGWQLEQEELNGHSDDSADDKYEIHESDEEDANIPHFCSYCRGEFKEPVVTKCMHYFCSKCAIEMFKSMKGKCQACEKDTEGNFKNADYIFTKIAAIEEKRNKKK 874
            Y + +++    P D+GAT+  E DTE       I    +RVQ+  +  E D +Y G+  Y R  + KDT  GN++SG  RKGP+RAP ++R+T RWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYK GW++E+E   G      D+ +E+   +EE   IP  C  CR  F+ PVVTKC HYFC  CA+E F++   +C  C++ T G F  A  +  K+  ++    KK+
Sbjct:   94 YRSTRSAKPVGPEDMGATADFEQDTEKEHHTPTILKCSQRVQEALRGREHDHIYRGIHSYLRYLKPKDTSMGNSSSGMARKGPIRAPGHLRATVRWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYKLGWEIERELEEGRYCICEDENHEVGSEEEE---IPFRCFICRQAFQNPVVTKCRHYFCESCALEHFRATP-RCYICDQPTGGIFNPAKELMAKLQKLQAAEGKKR 322          
BLAST of Ring finger protein 113a vs. UniProt/SwissProt
Match: sp|O17917|RN113_CAEEL (Probable E3 ubiquitin-protein ligase rnf113 OS=Caenorhabditis elegans OX=6239 GN=rnf-113 PE=2 SV=2)

HSP 1 Score: 216.853 bits (551), Expect = 6.193e-67
Identity = 111/226 (49.12%), Postives = 142/226 (62.83%), Query Frame = 2
Query:  176 TVHRYEANKTSTKSRPSDLGATSHLEIDTETTQDAQAIFERVQKDKKKA--EDG--LYHGMQCYDRLTEVKDTIAGNAASGFNRKGPMRAPTNIRSTTRWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYKFGWQLEQEELNGHSDDSADDKYEIHESDEEDANIPHFCSYCRGEFKEPVVTKCMHYFCSKCAIEMFKSMKGKCQACEKDTEGNFKNADYIFTKI 841
              H + A+  +  S P D GAT+ LE+DT+ + DAQA FERVQ+  K+   +DG  LY G   Y    E KDT  GNAASG+NR GP+RAP  +R T RWD+ PDICKDYKETGFC FGDSCKF+HDRSDYK GW++++E   G      D  YEIHE D+     P  C  C   F +P+VTKC HYFC+ CA++ F+    KC  C+++TE     A  + T +
Sbjct:   76 ATHSFAASGDAGPSGPRDQGATATLEVDTDYSHDAQAQFERVQQQLKEGVEKDGKILYKGSALYG-AKEAKDTAKGNAASGYNRVGPVRAPQFLRQTVRWDFAPDICKDYKETGFCTFGDSCKFVHDRSDYKHGWEIDEEYEAGKYGAEDDANYEIHEGDD---TFPEDCFICGNPFVDPIVTKCKHYFCTGCALKSFQK-SSKCPICQQNTENIMNTAKELLTYL 296          
BLAST of Ring finger protein 113a vs. UniProt/SwissProt
Match: sp|Q8GX84|C3H1_ARATH (Zinc finger CCCH domain-containing protein 1 OS=Arabidopsis thaliana OX=3702 GN=At1g01350 PE=2 SV=2)

HSP 1 Score: 171.785 bits (434), Expect = 6.234e-50
Identity = 128/300 (42.67%), Postives = 168/300 (56.00%), Query Frame = 2
Query:   35 KFIKKSGIRQRKEDTDSEGESANPCYLKRKLVKP--VLEFTSKSSKS--------ENTVHRYEANKTSTKSRPSDLGATSHLEIDTETTQDAQAIFERVQK--------DKKKAED-GLYHGMQCY-DRLTEVK--DTIAGNAASGFNRKGPMRAPTNIRSTTRWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYKFGWQLEQE--------ELNGHSDDSADDKYEIHESDEEDANIPHFCSYCRGEFKEPVVTKCMHYFCSKCAIEMFKSMKGKCQACEKDTEGNFKNADYIFTKIA 844
            K I+K  I   +ED DS+ ES+    LK K+ KP   L F+S  SKS        E +V  Y+++K       +D GAT+ LE +T+  QDA+AI ERV K        +KKKA D  LY G+  Y D     +   TI+   A G +  GP+RA  +IR + R+DYQPDICKDYKETG+CG+GDSCKFLHDR DYK GWQ+E+E        + N       +D     +SDE++  +P  C  CR  F +PVVTKC HYFC  CA++     K KC  C + T G F  A  I  ++A
Sbjct:   40 KNIRKRTIDADEEDGDSKSESSILQNLK-KVAKPDSKLYFSSGPSKSSTTTSGAPERSVFHYDSSKEIQVQ--NDSGATATLETETDFNQDARAIRERVLKKADEALKGNKKKASDEKLYKGIHGYTDHKAGFRREQTISSEKAGGSH--GPLRASAHIRVSARFDYQPDICKDYKETGYCGYGDSCKFLHDRGDYKPGWQIEKEWEEAEKVRKRNKAMGVEDEDDEADKDSDEDENALPFACFICREPFVDPVVTKCKHYFCEHCALKHHTKNK-KCFVCNQPTMGIFNAAHEIKKRMA 333          
BLAST of Ring finger protein 113a vs. TrEMBL
Match: A0A1S3DH06 (RING finger protein 113A OS=Diaphorina citri OX=121845 GN=LOC103518216 PE=4 SV=1)

HSP 1 Score: 267.7 bits (683), Expect = 3.277e-85
Identity = 147/294 (50.00%), Postives = 193/294 (65.65%), Query Frame = 2
Query:   20 MFKNCKFIKKSGIRQRKEDTDSEGESANPCYLKRKLVK--PVLEFTSKSSKS-----------ENTVH---RYEANKTSTKSRPSDLGATSHLEIDTETTQDAQAIFERVQKD----KKKAEDGLYHGMQCYDRLTEVKDTIAGNAASGFNRKGPMRAPTNIRSTTRWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYKFGWQLEQEELNGHSDDSADDKYEIHESDEEDANIPHFCSYCRGEFKEPVVTKCMHYFCSKCAIEMFKSMKGKCQACEKDTEGNFKNADYIFTKI 841
            MFK  +   K   R+R+ D++SE E       K K ++  P  + T+K +K+           E++      Y++ K+S +  PSD+GAT+ LEI+TET +DAQAI+E+  K     K K +D +Y G+  Y +  E KDT  GNAASGF RKGP+RAP N+RST RWDYQPDICKDYKETGFCGFGDSCKFLHDR+DYK+GWQLEQE  +G + +     YEI +SDEED ++P  C  CR  FK+PV+TKC HYFC+KCA+E FK    KC  C+K+T G F+ A+ I  K+
Sbjct:    1 MFKKRQV--KQNTRKRQNDSESESEDETQIVRKEKKIREDPNFQKTTKQTKAAKPQVEDSESDESSCQVGVSYKSRKSSARDGPSDMGATATLEIETETDKDAQAIYEKSLKINAELKGKEDDKVYRGLANYAQYFEKKDTAQGNAASGFVRKGPIRAPANVRSTVRWDYQPDICKDYKETGFCGFGDSCKFLHDRTDYKYGWQLEQEHEDGDNKN-----YEIPDSDEED-HLPFKCYICRNSFKDPVMTKCKHYFCTKCALEHFKKTP-KCYICQKNTFGEFRTAEKIVQKL 285          
BLAST of Ring finger protein 113a vs. TrEMBL
Match: A0A0X3PH46 (Uncharacterized protein (Fragment) OS=Schistocephalus solidus OX=70667 GN=TR99365 PE=4 SV=1)

HSP 1 Score: 268.855 bits (686), Expect = 2.031e-84
Identity = 146/305 (47.87%), Postives = 196/305 (64.26%), Query Frame = 2
Query:   32 CKFIK---KSGIRQRKEDTDSEGESANPCYLKRK--------LVKPVLEFTSKSSKSEN----------TVHRYEANKTSTKSRPSDLGATSHLEIDTETTQDAQAIF---ERVQKDKKKAEDGLYHGMQCYDRLTEVKDTIAGNAASGFNRKGPMRAPTNIRSTTRWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYKFGWQLEQEELNG-HSDDSADDKYEI---HESDEEDANIPHFCSYCRGEFKEPVVTKCMHYFCSKCAIEMFKSMKGKCQACEKDTEGNFKNADYIFTKIAAIEEKR 862
            C F++   K+ +R RK+ + SE E     ++ RK        L++    F +K SKS +          T   ++AN   T S P D GAT+  EIDT+ T DAQ+IF   +++ ++ K  +D +Y G+  Y R  E KDT+ GNAASGFNR+GPMRAP ++R+T RWDYQPDICKDYKETGFC FGDSCKFLHDRSDYK GWQ++QE   G +  +  DD+YEI      D+ D ++P  C  CRG++K+PVVT+C HYFCS CA++ FK    +C AC +DT+G FK A  +  +IAAI+EKR
Sbjct:   22 CTFVRRRNKASLRTRKKSSSSEEE----VHIVRKRNKIESNPLIQHTSHFVAKRSKSSSGEDSDEDDVATSVAFKANYEPTHSGPKDQGATAISEIDTDITHDAQSIFIQAQKIDREVKSNKDKVYRGINNYARYIEQKDTVLGNAASGFNRRGPMRAPAHLRATVRWDYQPDICKDYKETGFCSFGDSCKFLHDRSDYKHGWQIDQEVAEGTYGVEGVDDRYEIKDEEGDDDADEHLPLKCLICRGDYKDPVVTRCKHYFCSNCALKRFKKT-ARCYACTEDTKGTFKIAKDLLARIAAIKEKR 321          
BLAST of Ring finger protein 113a vs. TrEMBL
Match: A0A564Z210 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS11549 PE=4 SV=1)

HSP 1 Score: 266.159 bits (679), Expect = 2.639e-83
Identity = 132/234 (56.41%), Postives = 167/234 (71.37%), Query Frame = 2
Query:  188 YEANKTSTKSRPSDLGATSHLEIDTETTQDAQAIF---ERVQKDKKKAEDGLYHGMQCYDRLTEVKDTIAGNAASGFNRKGPMRAPTNIRSTTRWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYKFGWQLEQEELNG-HSDDSADDKYEIH--ESDEEDANIPHFCSYCRGEFKEPVVTKCMHYFCSKCAIEMFKSMKGKCQACEKDTEGNFKNADYIFTKIAAIEEKRNKK 871
            ++A+  S  + P D GAT+ LEIDTE TQDAQA+F   + + K+ K  +D +Y GM  Y +  E KDT+ GNAASGFNRKGPMRAP ++R+T RWDYQPD+CKDYKETGFC FGDSCKFLHDRSDYK GWQLEQE   G +  +  D++YEI   E ++ED  +P  C  CRG+FK+PVVT C HYFCS CAI+  K    +C AC +DT+G FK A  + ++I AI+ KR +K
Sbjct:   74 FKADYNSVTTGPKDQGATATLEIDTEITQDAQALFIKSQEINKEVKSNKDNVYRGMNNYAQYLEKKDTVMGNAASGFNRKGPMRAPAHLRATVRWDYQPDVCKDYKETGFCSFGDSCKFLHDRSDYKHGWQLEQEFQEGVYGVEGNDNRYEIKSDEDEDEDQYLPLKCIICRGDFKDPVVTNCKHYFCSACAIKRLKKTT-RCYACTEDTKGVFKMARDLLSRIEAIKAKRKEK 306          
BLAST of Ring finger protein 113a vs. TrEMBL
Match: A0A504YI39 (Uncharacterized protein OS=Fasciola gigantica OX=46835 GN=FGIG_03717 PE=4 SV=1)

HSP 1 Score: 261.536 bits (667), Expect = 2.167e-82
Identity = 131/237 (55.27%), Postives = 166/237 (70.04%), Query Frame = 2
Query:  188 YEANKTSTKSRPSDLGATSHLEIDTETTQDAQAIFERVQKDKKKAEDG---LYHGMQCYDRLTEVKDTIAGNAASGFNRKGPMRAPTNIRSTTRWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYKFGWQLEQEELNG-HSDDSADDKYEI-HESDEE--DANIPHFCSYCRGEFKEPVVTKCMHYFCSKCAIEMFKSMKGKCQACEKDTEGNFKNADYIFTKIAAIEEKRNKKKE 877
            Y+A+++   S   +  AT+ LEIDT+ T DAQAIFE+ Q+  K+   G   +Y GM  Y++  E KDT+ GNA+SGFNRKGPMRAPTN+R+T RWDYQPDICKDYKETGFC FGDSCKFLHDRSDYK GWQ++QE   G +  D  D++YEI H S EE  D +IP  C  CR E+K+PVVT C HYFC  CA++ +K    +C AC  DT G FK A  +  ++ AI +KRN+ K+
Sbjct:   32 YKASRSMDPSVSREHCATASLEIDTDVTNDAQAIFEKAQQLNKEPGSGKSKIYKGMNNYNQYIEKKDTVMGNASSGFNRKGPMRAPTNLRATVRWDYQPDICKDYKETGFCSFGDSCKFLHDRSDYKHGWQIDQELAEGTYGIDGNDNRYEIVHNSSEEELDEDIPPLCLICRKEYKDPVVTNCRHYFCGDCALKRYKKT-ARCYACTADTRGFFKFAKDLLPRLKAIRQKRNRAKD 267          
BLAST of Ring finger protein 113a vs. TrEMBL
Match: A0A1B6F179 (Uncharacterized protein OS=Cuerna arida OX=1464854 GN=g.12584 PE=4 SV=1)

HSP 1 Score: 259.225 bits (661), Expect = 7.966e-82
Identity = 135/271 (49.82%), Postives = 170/271 (62.73%), Query Frame = 2
Query:   98 ANPCYLK---RKLVKPVLEFTSKSSKSENTVHRYEANKTSTKSRPSDLGATSHLEIDTETTQDAQAIFERVQKDKK----KAEDGLYHGMQCYDRLTEVKDTIAGNAASGFNRKGPMRAPTNIRSTTRWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYKFGWQLEQEELNGHSDDSADDKYEIHESDEEDANIPHFCSYCRGEFKEPVVTKCMHYFCSKCAIEMFKSMKGKCQACEKDTEGNFKNADYIFTKIAAIEEKRNKKKESDSD 889
            +NP   K   +K VKP     + SS+ E     Y + + +    PSD GAT+ LEI+TE  +DAQAIFER  K  K    K +D +Y GM  Y +  E +DT  GNA+SG  RKGP+RAP ++RST RWDYQPDICKD+KETG+CGFGDSCKFLHDRSDYKFGWQ+E +   G  DD  D KYEI   D++D N+P  C  CR  F +P+VTKC HYFC KCA+  +K    +C  C K T G F  A  I  K+   + K   + +SDS+
Sbjct:   50 SNPLIQKSNLKKAVKPDETCDATSSEDEGVTVSYRSKRIAAPEGPSDQGATAVLEIETEVDRDAQAIFERSLKINKELKGKEDDSVYRGMANYTQFYEKRDTAQGNASSGMVRKGPIRAPAHLRSTVRWDYQPDICKDFKETGYCGFGDSCKFLHDRSDYKFGWQIETDAAAGVVDDEDDSKYEI---DDDDNNLPFKCFICRNSFTDPIVTKCKHYFCEKCALSHYKK-SARCYICSKQTHGVFNPAKEIINKLKNSKTKSEVQSDSDSE 316          
BLAST of Ring finger protein 113a vs. Ensembl Cavefish
Match: rnf113a (ring finger protein 113A [Source:NCBI gene;Acc:103032577])

HSP 1 Score: 232.261 bits (591), Expect = 1.449e-74
Identity = 120/256 (46.88%), Postives = 166/256 (64.84%), Query Frame = 2
Query:   95 SANPCYLKRKLVKPVLEFTSKSSK---SENTVHRYEANKTSTKSRPSDLGATSHLEIDTETTQDAQAIFERVQKDKK----KAEDGLYHGMQCYDRLTEVKDTIAGNAASGFNRKGPMRAPTNIRSTTRWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYKFGWQLEQEELNGHSDDSADDKYEIHESDEEDANIPHFCSYCRGEFKEPVVTKCMHYFCSKCAIEMFKSMKGKCQACEKDTEGNFKNADYIFTKI 841
            SANP + + K V+     +S+S +   ++     Y++ +++    P D+GAT+   +DTE  +DAQAIFER QK ++    K +D +Y GM  Y +  + KD+  GNA+SG  RKGP+RAP ++R+T RWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYK GWQ+E+E   G    + ++ YE+  SDEED  +P  C  CR  FK P++TKC HYFC  CA++ ++  K +C  C + T G F  A  +  K+
Sbjct:   54 SANPMFQRTKKVERETVSSSESEEDKEAKKITVAYKSTRSAKPEGPEDMGATAVYALDTEKDKDAQAIFERSQKIQEELTGKEDDKIYRGMNNYHKFIKPKDSTMGNASSGMVRKGPIRAPEHLRATVRWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYKHGWQIERELDEGRYGANDEENYEV-SSDEED--LPFKCFICRESFKNPIITKCRHYFCEACALQHYRKSK-RCYVCNEQTNGVFNPAKELMAKM 305          
BLAST of Ring finger protein 113a vs. Ensembl Sea Lamprey
Match: rnf113a (ring finger protein 113A [Source:ZFIN;Acc:ZDB-GENE-040825-1])

HSP 1 Score: 240.35 bits (612), Expect = 8.704e-79
Identity = 124/272 (45.59%), Postives = 175/272 (64.34%), Query Frame = 2
Query:   92 ESANPCYL-KRKLVKPVLEFTSKSSKSENTVH-RYEANKTSTKSRPSDLGATSHLEIDTETTQDAQAIFERVQKD----KKKAEDGLYHGMQCYDRLTEVKDTIAGNAASGFNRKGPMRAPTNIRSTTRWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYKFGWQLEQEELNGHSDDSADDKYEIHESDEEDANIPHFCSYCRGEFKEPVVTKCMHYFCSKCAIEMFKSMKGKCQACEKDTEGNFKNADYIFTKIAAIEEKRNKKKESDSD 889
            ++ANP     +++ +   +++S  S+ +  +   Y++++++    P D+GAT+  E+DTE   DAQAIFER Q+     K K +D +Y G+  Y +  + K+T  GNA+SG  RKGP+RAP ++R+T RWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYK GWQ+E+E   G    +A++ YE+   DE   ++P  C  CR  F+ PV+TKC HYFC KCA++ +K  K +C  C + T G F  A  +  K+  I  K+N K  SD D
Sbjct:   20 QAANPMVQGTKRVTREKQKYSSSESEEDRGITVAYKSSRSAKPLGPDDMGATATYELDTEKVNDAQAIFERSQQIQEEIKGKEDDKVYRGIHNYTKFIKPKETAMGNASSGMVRKGPIRAPEHLRATVRWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYKHGWQIERELEEGRYGATAEENYEVSSGDE---DLPFKCFICRESFQHPVITKCKHYFCEKCALQHYKKSK-RCFVCGQQTMGVFNPAKELIAKMEKI--KQNMKGNSDED 285          
BLAST of Ring finger protein 113a vs. Ensembl Yeast
Match: CWC24 (General splicing factor; required for stable U2 snRNP binding to primary transcripts; essential for the first step of splicing; component of the pre-catalytic spliceosome complex containing Cef1p; similar to S. pombe Cwf24p [Source:SGD;Acc:S000004315])

HSP 1 Score: 128.257 bits (321), Expect = 4.914e-36
Identity = 67/143 (46.85%), Postives = 89/143 (62.24%), Query Frame = 2
Query:  401 SGFNRK--GPMRAPTNIRSTTRWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYKFGWQLEQEELNGHSDDSADDKYEIHESDEEDANIPHFCSYCRGEFKEPVVTKCMHYFCSKC-AIEMFKSMKGKCQACEKDTEGNFKNA 820
            SG N++    +  PTNIR+T   D+QPD+CKDYK+TG+CG+GDSCKFLH R D+K GW+L Q E N   +DS     ++ +       IP  C+ C+ ++K PVVT C HYFC  C A +M K    KC  C K+T G+ K A
Sbjct:  115 SGKNKRLTKQINQPTNIRTTVLMDFQPDVCKDYKQTGYCGYGDSCKFLHSRDDFKTGWKLNQ-EWNADKEDSKAVTLDLEK-------IPFKCTLCKEDYKSPVVTNCGHYFCGSCFAKDMKKGT--KCFICHKETHGSAKVA 247          
BLAST of Ring finger protein 113a vs. Ensembl Nematostella
Match: EDO32505 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUV2])

HSP 1 Score: 235.343 bits (599), Expect = 2.632e-76
Identity = 134/288 (46.53%), Postives = 180/288 (62.50%), Query Frame = 2
Query:   32 CKFIKKSG----IRQRK-EDTDSEGESANPCYLKRKLV--KPVLEFTS-----KSSKSENTVHR-YEANKTSTKSRPSDLGATSHLEIDTETTQDAQAIFER-VQKDK----KKAEDGLYHGMQCYDRLTEVKDTIAGNAASGFNRKGPMRAPTNIRSTTRWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYKFGWQLEQEELNGHSDDSADDKYEIHESDEEDANIPHFCSYCRGEFKEPVVTKCMHYFCSKCAIEMFKSMKGKCQACEKDTEGNFKNADYIFTKI 841
            C F KKS     +R+RK E + SE E       K K     P+++ T      K    E  +H  +++ +++  + P+D GAT+  E+DT+  +DAQA++E+ +Q +K    K+ ++ +Y G+  Y +  E +DT  GNAASG  R+GP+RAP N+R+T RWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYK GWQLE+E  +G  D +   +YEI +SD ED N+P  C  CR  FK PVVTKC+HYFC  CA++ +K    KC  C   T G F  A  I  K+
Sbjct:   16 CTFFKKSNRSKNVRKRKAESSGSEDEGQTVVIRKEKKTGFNPMIQKTEGFAKEKGQDEEEKIHVDFKSTRSAMSAGPTDAGATATYELDTDFDRDAQALYEKKLQVNKELMEKEVDEKVYKGLNNYMQFYEKRDTAQGNAASGMVRQGPIRAPKNLRATIRWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYKHGWQLEREWEHGKPDSADPHQYEI-DSDNED-NLPFACIMCRKTFKNPVVTKCLHYFCEACALQHYKK-NSKCFVCGVQTYGVFNPAKDIIKKM 300          
BLAST of Ring finger protein 113a vs. Ensembl Medaka
Match: rnf113a (ring finger protein 113A [Source:NCBI gene;Acc:100049396])

HSP 1 Score: 232.261 bits (591), Expect = 1.240e-74
Identity = 130/297 (43.77%), Postives = 178/297 (59.93%), Query Frame = 2
Query:   20 MFKNCKFIKKSGIRQRK---EDTDSEGESANPCYLKRK----LVKPVLEFTSK-------SSKSEN-----TVHRYEANKTSTKSRPSDLGATSHLEIDTETTQDAQAIFERVQKDKK----KAEDGLYHGMQCYDRLTEVKDTIAGNAASGFNRKGPMRAPTNIRSTTRWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYKFGWQLEQEELNGHSDDSADDKYEIHESDEEDANIPHFCSYCRGEFKEPVVTKCMHYFCSKCAIEMFKSMKGKCQACEKDTEGNFKNADYIFTKI 841
            +FK  K  KK   R+RK    D D+  E      ++R      V P+++ T K       SS SE+         Y++++++    P D+GAT+  E+DTE  +DAQAIFER QK ++    K +D +Y G+  Y +  + KDT  GNA+SG  RKGP+RAP ++R+T RWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYK GWQ+E+E   G    + ++ YE+   DE   ++P  C  CR  +K P+VTKC HYFC  CA++ ++  K +C  C   T G F  A  +  K+
Sbjct:   15 LFK--KSAKKFCGRKRKASDSDKDANSEEEQSVVVRRDKKEGRVNPMIQRTKKVERDAVSSSDSEDDNEGKITVAYKSSRSAKPEGPEDMGATATYELDTEKDKDAQAIFERSQKIQEELTGKEDDKIYRGINNYQKFIKPKDTSMGNASSGMVRKGPIRAPEHLRATVRWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYKHGWQIERELEEGRYGANDEENYEVSSDDE---DVPFKCFICRESYKNPIVTKCKHYFCEACALQHYRKSK-RCYVCNTQTNGVFNPAKELMAKL 305          
BLAST of Ring finger protein 113a vs. Planmine SMEST
Match: SMESG000037494.1 (SMESG000037494.1)

HSP 1 Score: 603.979 bits (1556), Expect = 0.000e+0
Identity = 290/290 (100.00%), Postives = 290/290 (100.00%), Query Frame = 2
Query:   20 MFKNCKFIKKSGIRQRKEDTDSEGESANPCYLKRKLVKPVLEFTSKSSKSENTVHRYEANKTSTKSRPSDLGATSHLEIDTETTQDAQAIFERVQKDKKKAEDGLYHGMQCYDRLTEVKDTIAGNAASGFNRKGPMRAPTNIRSTTRWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYKFGWQLEQEELNGHSDDSADDKYEIHESDEEDANIPHFCSYCRGEFKEPVVTKCMHYFCSKCAIEMFKSMKGKCQACEKDTEGNFKNADYIFTKIAAIEEKRNKKKESDSD 889
            MFKNCKFIKKSGIRQRKEDTDSEGESANPCYLKRKLVKPVLEFTSKSSKSENTVHRYEANKTSTKSRPSDLGATSHLEIDTETTQDAQAIFERVQKDKKKAEDGLYHGMQCYDRLTEVKDTIAGNAASGFNRKGPMRAPTNIRSTTRWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYKFGWQLEQEELNGHSDDSADDKYEIHESDEEDANIPHFCSYCRGEFKEPVVTKCMHYFCSKCAIEMFKSMKGKCQACEKDTEGNFKNADYIFTKIAAIEEKRNKKKESDSD
Sbjct:    1 MFKNCKFIKKSGIRQRKEDTDSEGESANPCYLKRKLVKPVLEFTSKSSKSENTVHRYEANKTSTKSRPSDLGATSHLEIDTETTQDAQAIFERVQKDKKKAEDGLYHGMQCYDRLTEVKDTIAGNAASGFNRKGPMRAPTNIRSTTRWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYKFGWQLEQEELNGHSDDSADDKYEIHESDEEDANIPHFCSYCRGEFKEPVVTKCMHYFCSKCAIEMFKSMKGKCQACEKDTEGNFKNADYIFTKIAAIEEKRNKKKESDSD 290          
The following BLAST results are available for this feature:
BLAST of Ring finger protein 113a vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
RNF113A1.351e-7451.35ring finger protein 113A [Source:HGNC Symbol;Acc:H... [more]
RNF113B3.581e-6846.35ring finger protein 113B [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Ring finger protein 113a vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rnf-1134.869e-6849.12Probable E3 ubiquitin-protein ligase rnf113 [Sour... [more]
back to top
BLAST of Ring finger protein 113a vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mdlc2.307e-7243.09gene:FBgn0038772 transcript:FBtr0083835[more]
back to top
BLAST of Ring finger protein 113a vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rnf113a7.109e-7549.55ring finger protein 113A [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Ring finger protein 113a vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rnf113a1.264e-7646.69ring finger protein 113A [Source:NCBI gene;Acc:548... [more]
rnf113a3.944e-7453.95ring finger protein 113A [Source:NCBI gene;Acc:548... [more]
back to top
BLAST of Ring finger protein 113a vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Rnf113a22.388e-7551.80ring finger protein 113A2 [Source:MGI Symbol;Acc:M... [more]
Rnf113a14.520e-7550.67ring finger protein 113A1 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Ring finger protein 113a vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O15541|R113A_HUMAN6.489e-7451.35E3 ubiquitin-protein ligase RNF113A OS=Homo sapien... [more]
sp|Q67ER4|R113A_BOVIN4.402e-7350.45E3 ubiquitin-protein ligase RNF113A OS=Bos taurus ... [more]
sp|Q8IZP6|R113B_HUMAN1.720e-6746.35RING finger protein 113B OS=Homo sapiens OX=9606 G... [more]
sp|O17917|RN113_CAEEL6.193e-6749.12Probable E3 ubiquitin-protein ligase rnf113 OS=Cae... [more]
sp|Q8GX84|C3H1_ARATH6.234e-5042.67Zinc finger CCCH domain-containing protein 1 OS=Ar... [more]
back to top
BLAST of Ring finger protein 113a vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3DH063.277e-8550.00RING finger protein 113A OS=Diaphorina citri OX=12... [more]
A0A0X3PH462.031e-8447.87Uncharacterized protein (Fragment) OS=Schistocepha... [more]
A0A564Z2102.639e-8356.41Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A504YI392.167e-8255.27Uncharacterized protein OS=Fasciola gigantica OX=4... [more]
A0A1B6F1797.966e-8249.82Uncharacterized protein OS=Cuerna arida OX=1464854... [more]
back to top
BLAST of Ring finger protein 113a vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rnf113a1.449e-7446.88ring finger protein 113A [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of Ring finger protein 113a vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rnf113a8.704e-7945.59ring finger protein 113A [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Ring finger protein 113a vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
CWC244.914e-3646.85General splicing factor; required for stable U2 sn... [more]
back to top
BLAST of Ring finger protein 113a vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO325052.632e-7646.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ring finger protein 113a vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rnf113a1.240e-7443.77ring finger protein 113A [Source:NCBI gene;Acc:100... [more]
back to top
BLAST of Ring finger protein 113a vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000037494.10.000e+0100.00SMESG000037494.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032034 ID=SMED30032034|Name=Ring finger protein 113a|organism=Schmidtea mediterranea sexual|type=transcript|length=904bp
TGATCTCATAATTTTGTAAATGTTTAAAAACTGCAAGTTTATTAAAAAAA
GTGGGATACGTCAGAGAAAGGAGGACACTGATAGTGAAGGAGAAAGTGCA
AATCCGTGTTATTTAAAAAGAAAATTAGTTAAACCTGTTTTAGAATTTAC
TTCCAAATCTTCCAAATCGGAAAATACTGTTCATCGATATGAAGCTAACA
AGACATCAACAAAATCTAGACCATCAGATCTTGGTGCAACGTCACACCTT
GAAATTGACACAGAAACAACACAAGATGCTCAAGCAATATTTGAACGAGT
TCAAAAAGATAAAAAGAAAGCTGAAGATGGACTTTATCATGGTATGCAAT
GCTATGATCGATTGACTGAAGTAAAGGACACAATTGCTGGAAATGCTGCA
AGTGGATTTAATCGTAAAGGACCAATGAGAGCTCCTACTAATATTCGTTC
TACAACTAGATGGGATTATCAACCAGACATATGCAAGGATTATAAAGAAA
CAGGATTTTGTGGGTTTGGAGACAGCTGTAAATTTCTCCACGATAGATCA
GATTACAAATTTGGATGGCAACTTGAACAAGAAGAATTAAATGGTCATTC
AGACGACAGTGCTGATGATAAATACGAAATCCACGAATCCGATGAGGAAG
ATGCAAATATTCCACATTTTTGCAGTTATTGTCGAGGGGAGTTCAAAGAA
CCGGTAGTTACGAAATGTATGCATTATTTCTGTTCAAAATGCGCCATCGA
AATGTTCAAGTCAATGAAAGGCAAATGCCAAGCATGTGAAAAAGACACAG
AGGGAAACTTCAAAAATGCTGATTATATTTTCACAAAAATTGCAGCAATT
GAAGAGAAACGGAATAAGAAAAAAGAAAGCGACTCAGATTAATTATTTAG
ATCG
back to top

protein sequence of SMED30032034-orf-1

>SMED30032034-orf-1 ID=SMED30032034-orf-1|Name=SMED30032034-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=291bp
MFKNCKFIKKSGIRQRKEDTDSEGESANPCYLKRKLVKPVLEFTSKSSKS
ENTVHRYEANKTSTKSRPSDLGATSHLEIDTETTQDAQAIFERVQKDKKK
AEDGLYHGMQCYDRLTEVKDTIAGNAASGFNRKGPMRAPTNIRSTTRWDY
QPDICKDYKETGFCGFGDSCKFLHDRSDYKFGWQLEQEELNGHSDDSADD
KYEIHESDEEDANIPHFCSYCRGEFKEPVVTKCMHYFCSKCAIEMFKSMK
GKCQACEKDTEGNFKNADYIFTKIAAIEEKRNKKKESDSD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002056medial muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR039971CWC24-like
IPR036855Znf_CCCH_sf
IPR001841Znf_RING
IPR000571Znf_CCCH
IPR013083Znf_RING/FYVE/PHD
IPR018957Znf_C3HC4_RING-type
IPR017907Znf_RING_CS
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0005515protein binding
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001841Zinc finger, RING-typeSMARTSM00184ring_2coord: 218..256
e-value: 9.7E-4
score: 28.4
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 218..257
score: 9.893
IPR000571Zinc finger, CCCH-typeSMARTSM00356c3hfinal6coord: 149..176
e-value: 2.1E-7
score: 40.6
IPR000571Zinc finger, CCCH-typePFAMPF00642zf-CCCHcoord: 150..175
e-value: 5.0E-9
score: 35.9
IPR000571Zinc finger, CCCH-typePROSITEPS50103ZF_C3H1coord: 149..177
score: 15.366
IPR018957Zinc finger, C3HC4 RING-typePFAMPF00097zf-C3HC4coord: 218..256
e-value: 9.0E-7
score: 28.7
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 217..276
e-value: 3.2E-12
score: 47.9
NoneNo IPR availableGENE3DG3DSA:4.10.1000.10coord: 145..180
e-value: 3.1E-5
score: 25.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..27
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 49..63
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 45..73
NoneNo IPR availablePANTHERPTHR12930:SF0RING FINGER PROTEIN 113A1-RELATEDcoord: 9..287
NoneNo IPR availableCDDcd16539RING-HC_RNF113A_Bcoord: 218..256
e-value: 2.34535E-13
score: 61.0923
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 216..259
IPR039971Pre-mRNA-splicing factor CWC24-likePANTHERPTHR12930ZINC FINGER PROTEIN 183coord: 9..287
IPR017907Zinc finger, RING-type, conserved sitePROSITEPS00518ZF_RING_1coord: 233..242
IPR036855Zinc finger, CCCH-type superfamilySUPERFAMILYSSF90229CCCH zinc fingercoord: 146..181