HDNR domain-containing protein

Overview
NameHDNR domain-containing protein
Smed IDSMED30032031
Length (bp)813
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of HDNR domain-containing protein (SMED30032031) t-SNE clustered cells

Violin plots show distribution of expression levels for HDNR domain-containing protein (SMED30032031) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of HDNR domain-containing protein (SMED30032031) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for HDNR domain-containing protein (SMED30032031) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032031

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30032031SMESG000008952.1 dd_Smed_v4_6279_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30032031SMESG000008952.1 dd_Smed_v4_6279_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30032031SMESG000008952.1 dd_Smed_v4_6279_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30032031SMESG000008952.1 dd_Smed_v4_6279_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30032031SMESG000008952.1 dd_Smed_v6_6279_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30032031SMESG000008952.1 dd_Smed_v4_6279_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of HDNR domain-containing protein vs. Ensembl Human
Match: C3orf84 (chromosome 3 open reading frame 84 [Source:HGNC Symbol;Acc:HGNC:44666])

HSP 1 Score: 71.633 bits (174), Expect = 1.762e-14
Identity = 38/94 (40.43%), Postives = 53/94 (56.38%), Query Frame = 1
Query:   55 ITGSWFPSGYYGHFRNIPRNEFCGEYRQLAKPQPPKVFITRIKEKPTSHIFSKHDNRFSNLSDATY-LDMGIGKKRRVANTQTFHSNSDLLSWT 333
            + GSW  +G+YGH+R+  ++E   EY   AKPQPP VF+ R +E    H FSKHDNR S   +  Y L  GIG+++ +      H+    L W 
Sbjct:    5 LVGSWHNNGFYGHYRSQFKSESAREYHLAAKPQPPAVFLQRCQEPAQRHFFSKHDNRTSFDKEGPYCLLQGIGRRKDLERLWQRHT---FLRWA 95          
BLAST of HDNR domain-containing protein vs. Ensembl Human
Match: C3orf84 (chromosome 3 open reading frame 84 [Source:HGNC Symbol;Acc:HGNC:44666])

HSP 1 Score: 71.2478 bits (173), Expect = 2.806e-14
Identity = 37/93 (39.78%), Postives = 51/93 (54.84%), Query Frame = 1
Query:   55 ITGSWFPSGYYGHFRNIPRNEFCGEYRQLAKPQPPKVFITRIKEKPTSHIFSKHDNRFSNLSDATYLDMGIGKKRRVANTQTFHSNSDLLSWT 333
            + GSW  +G+YGH+R+  ++E   EY   AKPQPP VF+ R +E    H FSKHDNR S       L  GIG+++ +      H+    L W 
Sbjct:    5 LVGSWHNNGFYGHYRSQFKSESAREYHLAAKPQPPAVFLQRCQEPAQRHFFSKHDNRTSFDKGPYCLLQGIGRRKDLERLWQRHT---FLRWA 94          
BLAST of HDNR domain-containing protein vs. Ensembl Xenopus
Match: csrp1 (cysteine and glycine rich protein 1 [Source:Xenbase;Acc:XB-GENE-941448])

HSP 1 Score: 100.523 bits (249), Expect = 4.365e-25
Identity = 68/216 (31.48%), Postives = 106/216 (49.07%), Query Frame = 1
Query:   58 TGSWFPSGYYGHFRNIPRNEFCGEYRQLAKPQPPKVFITRIKEKPTSHIFSKHDNRFSNLSDATYLDMGIGKKRRVANTQTFHSNSDLLSWT-------MHPTEYSVYRSTFTSYAPSNLIIPNLNIVKSSSPSSRDQRTTTYRYAYGNSNIN------------KDVIEKSYEESLHARPAPVIDLVKLHRRCKSSYDLSGRESVADCLIWHQIE 648
            +GSWFP+G++GHFR+  RN+   EYR+ A+P+PP VF  RIKE+PT+HIFS+HDNR    S     + G+GKK+ +   +++    ++L W        M     S YR  F  + P+   +P L + + SS S    +     +    S  N            +  ++ S  ++ H+R +       +   CK       R +V+DCL WH  E
Sbjct:    6 SGSWFPTGFHGHFRSHMRNDIYQEYRREARPEPPHVFEKRIKEQPTNHIFSRHDNRHIFPSSVYVFENGMGKKKMLNARESY----NVLRWVPLEKNLEMQTPLLSTYRMDFWEHGPTTEKMPQLIVPRLSSTSYPGIKINRQLFWSPQSRQNLAIDRTHSKVPEQPTLKDSIPKTAHSRTSSSSLRRIVSSPCK-------RLTVSDCLNWHSQE 210          
BLAST of HDNR domain-containing protein vs. Ensembl Mouse
Match: BC048562 (cDNA sequence BC048562 [Source:MGI Symbol;Acc:MGI:3618861])

HSP 1 Score: 76.6406 bits (187), Expect = 2.147e-16
Identity = 48/152 (31.58%), Postives = 68/152 (44.74%), Query Frame = 1
Query:   55 ITGSWFPSGYYGHFRNIPRNEFCGEYRQLAKPQPPKVFITRIKEKPTSHIFSKHDNRFSNLSDATYLDMGIGKKRRVANTQTFHSNSDLLSWTMHPTEYSVYRSTFTSYAPSNLIIPNLNIVKSSSPSSRDQRTTTYRYAYGNSNINKDVIE 510
            + GSW  SG+YGH+R   ++E  GEYR  AKP PP VF+ R +E    H FSKHDNR S       L  GIG+++ +              W  H         TF  +AP  L +       S  P       T +R   G + + + +++
Sbjct:    5 LIGSWHNSGFYGHYRGQVKSESAGEYRLAAKPPPPAVFLQRCEEPTKQHYFSKHDNRTSFDKGPYCLLQGIGRRKDLERL-----------WKRH---------TFLRWAPCELEL-------SQQPPLESSYQTDFRSGTGLARLPQRLVQ 129          
BLAST of HDNR domain-containing protein vs. UniProt/SwissProt
Match: sp|H3BNL1|CC084_HUMAN (Uncharacterized protein C3orf84 OS=Homo sapiens OX=9606 GN=C3orf84 PE=2 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 1.347e-13
Identity = 37/93 (39.78%), Postives = 51/93 (54.84%), Query Frame = 1
Query:   55 ITGSWFPSGYYGHFRNIPRNEFCGEYRQLAKPQPPKVFITRIKEKPTSHIFSKHDNRFSNLSDATYLDMGIGKKRRVANTQTFHSNSDLLSWT 333
            + GSW  +G+YGH+R+  ++E   EY   AKPQPP VF+ R +E    H FSKHDNR S       L  GIG+++ +      H+    L W 
Sbjct:    5 LVGSWHNNGFYGHYRSQFKSESAREYHLAAKPQPPAVFLQRCQEPAQRHFFSKHDNRTSFDKGPYCLLQGIGRRKDLERLWQRHT---FLRWA 94          
BLAST of HDNR domain-containing protein vs. TrEMBL
Match: A0A1I8JCM3 (HDNR domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig029886g2 PE=4 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 2.359e-41
Identity = 86/207 (41.55%), Postives = 119/207 (57.49%), Query Frame = 1
Query:   70 FPSGYYGHFRNIPRNEFCGEYRQLAKPQPPKVFITRIKEKPTSHIFSKHDNRFSNLSDATYLDMGIGKKRRVANTQTFHSNSDLLSWTMH--------PTEYSVYRSTFTS-YAPSNLIIPNLNIVKSSSPSSRDQRTTTYRYAYGNS--NINKDVIEKSYEESLHARPA------PVIDLVKLHRRCKSSYDLSGRESVADCLIWH 639
            FPSGYYGH R+  RN+   EYR+LAKPQPP+VF+TR+K+ P  HIFSKHDNR+S ++DATYLD+G+GKKR+V  ++      DL+SW               S Y+  FT+   P+ L++       S    ++ ++TT+YRYA+G    N NK V+E     ++ ARP       P + + +    C       GR SVADCL W 
Sbjct:    1 FPSGYYGHNRDSHRNDIYTEYRRLAKPQPPRVFLTRMKDDPVRHIFSKHDNRYSFITDATYLDLGVGKKRKVPESRCNRVTDDLISWAPQMRNLKEGAEPALSAYKQAFTAGRQPAQLLVSRPKT--SFDEDAQVRQTTSYRYAFGPELYNPNKTVVEAIGRPAVLARPCAVKPKPPAVGVSRARTAC------DGRLSVADCLTWQ 199          
BLAST of HDNR domain-containing protein vs. TrEMBL
Match: A0A267G2W3 (HDNR domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig005280g1 PE=4 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 1.544e-39
Identity = 84/205 (40.98%), Postives = 117/205 (57.07%), Query Frame = 1
Query:   76 SGYYGHFRNIPRNEFCGEYRQLAKPQPPKVFITRIKEKPTSHIFSKHDNRFSNLSDATYLDMGIGKKRRVANTQTFHSNSDLLSWTMH--------PTEYSVYRSTFTS-YAPSNLIIPNLNIVKSSSPSSRDQRTTTYRYAYGNS--NINKDVIEKSYEESLHARPA------PVIDLVKLHRRCKSSYDLSGRESVADCLIWH 639
            SGYYGH R+  RN+   EYR+LAKPQPP+VF+TR+K+ P  HIFSKHDNR+S ++DATYLD+G+GKKR+V  ++      DL+SW               S Y+  FT+   P+ L++       S    ++ ++TT+YRYA+G    N NK V+E     ++ ARP       P + + +    C       GR SVADCL W 
Sbjct:    1 SGYYGHNRDSHRNDIYTEYRRLAKPQPPRVFLTRMKDDPVRHIFSKHDNRYSFITDATYLDLGVGKKRKVPESRCNRVTDDLISWAPQMRNLKEGAEPALSAYKQAFTAGRQPAQLLVSRPKT--SFDEDAQVRQTTSYRYAFGPELYNPNKTVVEAIGRPAVLARPCAVKPKPPAVGVSRARTAC------DGRLSVADCLTWQ 197          
BLAST of HDNR domain-containing protein vs. TrEMBL
Match: A0A210Q949 (HDNR domain-containing protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT11260 PE=4 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 2.064e-38
Identity = 99/243 (40.74%), Postives = 133/243 (54.73%), Query Frame = 1
Query:   49 ENITGSWFPSGYYGHFRNIPRNEFCGEYRQLAKPQPPKVFITRIKEKPTSHIFSKHDNRFSNLSDATYLDMGIGKKRRVANTQTFHSNSDLLSWTMHPTEY--------SVYRSTF-------TSYAPSNLI-------IPNLNIVKSSSPSSRDQRTTTYRYAYGN--SNINKDVIEKSYEESLHARPAPVIDLVKLHRRCKSSYDLSGRESVADCLIWHQIERSSTSKENGRASSAWPETT 705
            E I G+WFPSGYYGHFR+  RN+FC EYR LA+PQPPK F  R K+    H+FS HDNR S L+DA Y + G+G+K RV N +T+    D ++W M   EY        S Y+  F       T Y+ +  +       IP + +VK    S     TT+YRY++G+  SN NK++I     E+L       + L+    R  S+   SGRESVA C+IW Q  ++  S  NG+  S  PE T
Sbjct:    8 EQIVGTWFPSGYYGHFRSKSRNDFCNEYRNLARPQPPKQFFNRSKQPTPRHVFSHHDNRESFLNDALYFEQGLGRK-RVPN-ETYDFKRDFITW-MPEKEYIERSRPLVSTYKVDFKNKKTEITKYSSTTTVERQEHHNIPQI-MVKRPKTSFDGVPTTSYRYSHGDMRSNPNKEMITAVNNEALQ------LSLLNRKNRAMSAKS-SGRESVASCMIW-QSAKTEASSSNGK--SRIPEAT 236          
BLAST of HDNR domain-containing protein vs. TrEMBL
Match: A0A267ESX0 (HDNR domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig025927g1 PE=4 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 3.428e-36
Identity = 80/201 (39.80%), Postives = 113/201 (56.22%), Query Frame = 1
Query:   88 GHFRNIPRNEFCGEYRQLAKPQPPKVFITRIKEKPTSHIFSKHDNRFSNLSDATYLDMGIGKKRRVANTQTFHSNSDLLSWTMH--------PTEYSVYRSTFTS-YAPSNLIIPNLNIVKSSSPSSRDQRTTTYRYAYGNS--NINKDVIEKSYEESLHARPA------PVIDLVKLHRRCKSSYDLSGRESVADCLIWH 639
            GH R+  RN+   EYR+LAKPQPP+VF+TR+K+ P  HIFSKHDNR+S ++DATYLD+G+GKKR+V  ++      DL+SW               S Y+  FT+   P+ L++       S    ++ ++TT+YRYA+G    N NK V+E     ++ ARP       P + + +    C       GR SVADCL W 
Sbjct:    1 GHNRDSHRNDIYTEYRRLAKPQPPRVFLTRMKDDPVRHIFSKHDNRYSFITDATYLDLGVGKKRKVPESRCNRVTDDLISWAPQMRNLKEGAEPALSAYKQAFTAGRQPAQLLVSRPKT--SFDEDAQVRQTTSYRYAFGPELYNPNKTVVEAIGRPAVLARPCAVKPKPPAVGVSRARTAC------DGRLSVADCLTWQ 193          
BLAST of HDNR domain-containing protein vs. TrEMBL
Match: A0A3S1AC14 (HDNR domain-containing protein OS=Elysia chlorotica OX=188477 GN=EGW08_004257 PE=4 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 1.893e-31
Identity = 75/198 (37.88%), Postives = 108/198 (54.55%), Query Frame = 1
Query:   58 TGSWFPSGYYGHFRNIPRNEFCGEYRQLAKPQPPKVFITRIKEKPTSHIFSKHDNRFSNLSDATYLDMGIGKKRRVANTQTFHSNSDLLSWTMHPTEYSVYRSTFTSYAPS-NLIIPNLNIVKSSSPSSRDQ-RTTTYRYAYGNSNINKDVIEKSYEESLHARPAPVIDLVKLHRRCKSSYDLSG-RESVADCLIWHQ 642
            TGSWFPSGYYGH+R+  R +F  EYRQLAKPQPP+ FI R  +   SH+FS HDNR S + DA+Y   G+GKKR    +  F  N   +SW  +  +    R   ++Y     L  P + ++     +S D   +T YR  +G  + N+D+I     E+L         +  +HR+ ++    S  RE+VA CL W++
Sbjct:   10 TGSWFPSGYYGHYRSKTRTDFVNEYRQLAKPQPPRRFIHRSSQPVVSHLFSTHDNRNSFMCDASYFAQGLGKKRHPERSAAFDPN--FMSWHTYRRDARQGRPMTSTYRQDFRLEAPPIQLLTQRPKTSFDGVPSTMYRTVHGADSPNRDLINAMNNEALM--------ITAVHRQQQAKLKKSERRETVASCLTWYR 197          
BLAST of HDNR domain-containing protein vs. Ensembl Nematostella
Match: EDO42577 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S150])

HSP 1 Score: 83.9593 bits (206), Expect = 3.183e-19
Identity = 46/117 (39.32%), Postives = 72/117 (61.54%), Query Frame = 1
Query:   52 NITGSWFPSGYYGHFRNIPRNEFCGEYRQLAKPQPPKVFITRIKEKPTSHIFSKHDNR--FSNLSD-ATYLDMGIGKK---RRVANTQTFHSNS--DLLSWTMHPTE--YSVYRSTF 372
            ++TGSW+ +G++GH+R+  R +F   +RQ  KP PP+ F+   KE+  SH+FS+HDNR   S++ D  T+  MG+GK+   R  A   T H+ S  DL++W  +  +   S YR+ F
Sbjct:   13 DLTGSWYNTGFHGHYRSRTRTDFAIPFRQRVKPAPPQKFLNYSKERSNSHLFSRHDNRNTHSDMGDLETFFGMGLGKRKYTRASAGIATQHTKSTQDLITWRGNENDSMVSTYRTHF 129          
BLAST of HDNR domain-containing protein vs. Planmine SMEST
Match: SMESG000008952.1 (SMESG000008952.1)

HSP 1 Score: 484.952 bits (1247), Expect = 3.598e-176
Identity = 232/234 (99.15%), Postives = 233/234 (99.57%), Query Frame = 1
Query:   25 MTAIDNRRENITGSWFPSGYYGHFRNIPRNEFCGEYRQLAKPQPPKVFITRIKEKPTSHIFSKHDNRFSNLSDATYLDMGIGKKRRVANTQTFHSNSDLLSWTMHPTEYSVYRSTFTSYAPSNLIIPNLNIVKSSSPSSRDQRTTTYRYAYGNSNINKDVIEKSYEESLHARPAPVIDLVKLHRRCKSSYDLSGRESVADCLIWHQIERSSTSKENGRASSAWPETTQLECSTA 726
            MTAIDNRRENITGSWFPSGYYGHFRNIPRNEFCGEYRQLAKPQPPKVFITRIKEKPTSHIFSKHDNRFSNLSDATYLDMGIGKKRRVANTQTFHSNSDLLSWTMHPTEYSVYRSTFTS+APSNLIIPNLNIVKSSSPSSRDQRTTTYRYAYGNSNINKDVIEKSYEESLHARPAPVIDLVKLHRRCKSSYDLSGRESVADCLIWHQIERSS SKENGRASSAWPETTQLECSTA
Sbjct:    1 MTAIDNRRENITGSWFPSGYYGHFRNIPRNEFCGEYRQLAKPQPPKVFITRIKEKPTSHIFSKHDNRFSNLSDATYLDMGIGKKRRVANTQTFHSNSDLLSWTMHPTEYSVYRSTFTSHAPSNLIIPNLNIVKSSSPSSRDQRTTTYRYAYGNSNINKDVIEKSYEESLHARPAPVIDLVKLHRRCKSSYDLSGRESVADCLIWHQIERSSISKENGRASSAWPETTQLECSTA 234          
The following BLAST results are available for this feature:
BLAST of HDNR domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
C3orf841.762e-1440.43chromosome 3 open reading frame 84 [Source:HGNC Sy... [more]
C3orf842.806e-1439.78chromosome 3 open reading frame 84 [Source:HGNC Sy... [more]
back to top
BLAST of HDNR domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HDNR domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HDNR domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HDNR domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
csrp14.365e-2531.48cysteine and glycine rich protein 1 [Source:Xenbas... [more]
back to top
BLAST of HDNR domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
BC0485622.147e-1631.58cDNA sequence BC048562 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of HDNR domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|H3BNL1|CC084_HUMAN1.347e-1339.78Uncharacterized protein C3orf84 OS=Homo sapiens OX... [more]
back to top
BLAST of HDNR domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8JCM32.359e-4141.55HDNR domain-containing protein OS=Macrostomum lign... [more]
A0A267G2W31.544e-3940.98HDNR domain-containing protein (Fragment) OS=Macro... [more]
A0A210Q9492.064e-3840.74HDNR domain-containing protein OS=Mizuhopecten yes... [more]
A0A267ESX03.428e-3639.80HDNR domain-containing protein (Fragment) OS=Macro... [more]
A0A3S1AC141.893e-3137.88HDNR domain-containing protein OS=Elysia chlorotic... [more]
back to top
BLAST of HDNR domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HDNR domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HDNR domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HDNR domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO425773.183e-1939.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of HDNR domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HDNR domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000008952.13.598e-17699.15SMESG000008952.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032031 ID=SMED30032031|Name=HDNR domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=813bp
TACAATGGCAACTGAATAATATAAATGACTGCAATTGATAATAGGAGAGA
AAACATTACTGGATCATGGTTTCCTTCTGGATATTATGGTCATTTCAGAA
ATATTCCTAGAAATGAGTTCTGTGGAGAATACCGTCAGCTGGCGAAACCA
CAGCCACCTAAAGTATTTATCACCAGAATCAAAGAAAAACCAACCAGTCA
CATTTTCTCAAAACATGACAACAGATTCAGTAATTTGTCCGATGCTACAT
ATTTGGATATGGGCATCGGTAAAAAACGAAGAGTTGCAAATACACAAACG
TTTCATTCAAATTCAGATTTACTGTCATGGACAATGCATCCTACAGAATA
CTCAGTTTATAGGTCAACTTTTACCAGTTATGCTCCGTCGAATTTGATCA
TCCCGAATTTGAATATCGTCAAATCTTCGTCCCCTTCATCAAGGGATCAG
CGCACAACTACATATCGATACGCTTATGGCAATTCAAATATAAATAAAGA
TGTTATTGAAAAAAGTTACGAAGAATCATTACATGCTCGTCCAGCTCCAG
TTATAGATTTGGTAAAATTACATAGACGATGTAAATCATCTTATGATTTA
TCTGGGCGTGAGAGCGTGGCAGATTGCTTAATCTGGCACCAAATTGAAAG
ATCCTCAACCTCAAAAGAGAATGGTAGGGCGTCGAGTGCATGGCCAGAGA
CCACTCAACTTGAATGTTCAACTGCTTAATGAATTCCAGCAATTGAATGG
ATTGATAAATATTTTATTAGTATTTTGTAGCAGCAGTTTATTATTAGTGA
ATAAAAATTGGAC
back to top

protein sequence of SMED30032031-orf-1

>SMED30032031-orf-1 ID=SMED30032031-orf-1|Name=SMED30032031-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=235bp
MTAIDNRRENITGSWFPSGYYGHFRNIPRNEFCGEYRQLAKPQPPKVFIT
RIKEKPTSHIFSKHDNRFSNLSDATYLDMGIGKKRRVANTQTFHSNSDLL
SWTMHPTEYSVYRSTFTSYAPSNLIIPNLNIVKSSSPSSRDQRTTTYRYA
YGNSNINKDVIEKSYEESLHARPAPVIDLVKLHRRCKSSYDLSGRESVAD
CLIWHQIERSSTSKENGRASSAWPETTQLECSTA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR029369HDNR
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR029369Domain of unknown function with conserved HDNR motifPFAMPF15115HDNRcoord: 9..130
e-value: 2.1E-23
score: 83.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 215..234
NoneNo IPR availablePANTHERPTHR35539FAMILY NOT NAMEDcoord: 8..206