NPYR-5

Overview
NameNPYR-5
Smed IDSMED30032025
Length (bp)1087
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of NPYR-5 (SMED30032025) t-SNE clustered cells

Violin plots show distribution of expression levels for NPYR-5 (SMED30032025) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of NPYR-5 (SMED30032025) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for NPYR-5 (SMED30032025) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032025

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30032025h1SMcG0012277 dd_Smed_v4_16725_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30032025h1SMcG0012277 dd_Smed_v4_16725_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30032025h1SMcG0012277 dd_Smed_v4_16725_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30032025h1SMcG0012277 dd_Smed_v6_16725_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Category 2 cellSMED30032025h1SMcG0012277 dd_Smed_v4_16725_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30032025h1SMcG0012277 SMED30016794smed_20140614PMID:27163480
Saberi et al., 2016
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of NPYR-5 vs. Ensembl Human
Match: NPFFR2 (neuropeptide FF receptor 2 [Source:HGNC Symbol;Acc:HGNC:4525])

HSP 1 Score: 85.1149 bits (209), Expect = 1.288e-17
Identity = 42/88 (47.73%), Postives = 58/88 (65.91%), Query Frame = 1
Query:  361 VFGNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRFQ 624
            + GN +V F VMR + + T  N+FILNLAISDL + IF  P  LL  ++    W +G+ +CK+S L+QG +V  S  T+ AIA+DRFQ
Sbjct:   63 MMGNTVVCFIVMRNKHMHTVTNLFILNLAISDLLVGIFCMPITLLDNIIA--GWPFGNTMCKISGLVQGISVAASVFTLVAIAVDRFQ 148          
BLAST of NPYR-5 vs. Ensembl Human
Match: NPFFR2 (neuropeptide FF receptor 2 [Source:HGNC Symbol;Acc:HGNC:4525])

HSP 1 Score: 85.1149 bits (209), Expect = 1.354e-17
Identity = 42/88 (47.73%), Postives = 58/88 (65.91%), Query Frame = 1
Query:  361 VFGNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRFQ 624
            + GN +V F VMR + + T  N+FILNLAISDL + IF  P  LL  ++    W +G+ +CK+S L+QG +V  S  T+ AIA+DRFQ
Sbjct:   60 MMGNTVVCFIVMRNKHMHTVTNLFILNLAISDLLVGIFCMPITLLDNIIA--GWPFGNTMCKISGLVQGISVAASVFTLVAIAVDRFQ 145          
BLAST of NPYR-5 vs. Ensembl Human
Match: NPFFR2 (neuropeptide FF receptor 2 [Source:HGNC Symbol;Acc:HGNC:4525])

HSP 1 Score: 84.7297 bits (208), Expect = 2.591e-17
Identity = 42/88 (47.73%), Postives = 58/88 (65.91%), Query Frame = 1
Query:  361 VFGNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRFQ 624
            + GN +V F VMR + + T  N+FILNLAISDL + IF  P  LL  ++    W +G+ +CK+S L+QG +V  S  T+ AIA+DRFQ
Sbjct:  162 MMGNTVVCFIVMRNKHMHTVTNLFILNLAISDLLVGIFCMPITLLDNIIA--GWPFGNTMCKISGLVQGISVAASVFTLVAIAVDRFQ 247          
BLAST of NPYR-5 vs. Ensembl Human
Match: NPFFR1 (neuropeptide FF receptor 1 [Source:HGNC Symbol;Acc:HGNC:17425])

HSP 1 Score: 77.0258 bits (188), Expect = 6.928e-15
Identity = 39/86 (45.35%), Postives = 55/86 (63.95%), Query Frame = 1
Query:  367 GNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRFQ 624
            GN LV F V++ R + T  N+FILNLA+SDL + IF  P  L+  L+    W + +  CKMS L+QG +V  S  T+ AIA++RF+
Sbjct:   60 GNTLVCFIVLKNRHMHTVTNMFILNLAVSDLLVGIFCMPTTLVDNLITG--WPFDNATCKMSGLVQGMSVSASVFTLVAIAVERFR 143          
BLAST of NPYR-5 vs. Ensembl Human
Match: CCKAR (cholecystokinin A receptor [Source:HGNC Symbol;Acc:HGNC:1570])

HSP 1 Score: 76.6406 bits (187), Expect = 8.115e-15
Identity = 37/88 (42.05%), Postives = 60/88 (68.18%), Query Frame = 1
Query:  358 GVFGNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRF 621
             V GN LV+  ++R ++++T  N+F+L+LA+SDL LC+F  PFNL+  L+K   + +G  +CK +    GT+V VST  + AI+L+R+
Sbjct:   55 SVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLK--DFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERY 140          
BLAST of NPYR-5 vs. Ensembl Celegans
Match: npr-2 (NeuroPeptide Receptor family [Source:UniProtKB/TrEMBL;Acc:A0A061AKJ8])

HSP 1 Score: 82.4185 bits (202), Expect = 3.401e-17
Identity = 36/90 (40.00%), Postives = 62/90 (68.89%), Query Frame = 1
Query:  358 GVFGNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRFQI 627
            G+ GN+ V++  M++RQLQT +N+FILNL  S++ +C+ + P   +  +  Y  W +   +CK+  L+QG ++FVST +++AIALDR+ +
Sbjct:   40 GILGNSAVLYLTMKHRQLQTVQNIFILNLCASNVLMCLTSLPITFITNV--YKQWFFSSPVCKLIPLVQGASIFVSTFSLSAIALDRYNL 127          
BLAST of NPYR-5 vs. Ensembl Celegans
Match: npr-2 (NeuroPeptide Receptor family [Source:UniProtKB/TrEMBL;Acc:A0A061AKJ8])

HSP 1 Score: 82.4185 bits (202), Expect = 3.652e-17
Identity = 36/90 (40.00%), Postives = 62/90 (68.89%), Query Frame = 1
Query:  358 GVFGNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRFQI 627
            G+ GN+ V++  M++RQLQT +N+FILNL  S++ +C+ + P   +  +  Y  W +   +CK+  L+QG ++FVST +++AIALDR+ +
Sbjct:   65 GILGNSAVLYLTMKHRQLQTVQNIFILNLCASNVLMCLTSLPITFITNV--YKQWFFSSPVCKLIPLVQGASIFVSTFSLSAIALDRYNL 152          
BLAST of NPYR-5 vs. Ensembl Celegans
Match: npr-2 (NeuroPeptide Receptor family [Source:UniProtKB/TrEMBL;Acc:A0A061AKJ8])

HSP 1 Score: 82.4185 bits (202), Expect = 4.058e-17
Identity = 36/90 (40.00%), Postives = 62/90 (68.89%), Query Frame = 1
Query:  358 GVFGNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRFQI 627
            G+ GN+ V++  M++RQLQT +N+FILNL  S++ +C+ + P   +  +  Y  W +   +CK+  L+QG ++FVST +++AIALDR+ +
Sbjct:   83 GILGNSAVLYLTMKHRQLQTVQNIFILNLCASNVLMCLTSLPITFITNV--YKQWFFSSPVCKLIPLVQGASIFVSTFSLSAIALDRYNL 170          
BLAST of NPYR-5 vs. Ensembl Celegans
Match: npr-11 (Putative neuropeptide Y receptor 11 [Source:UniProtKB/Swiss-Prot;Acc:Q18179])

HSP 1 Score: 76.6406 bits (187), Expect = 2.991e-15
Identity = 39/88 (44.32%), Postives = 55/88 (62.50%), Query Frame = 1
Query:  358 GVFGNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRF 621
            G  GN L +  V+    ++T RN FILNLA+SD  +CI T P  L  +L  Y  W +   LCK++  LQG N+F+ST +I +IA+DR+
Sbjct:   53 GAIGNFLTIIVVILNPAMRTTRNFFILNLALSDFFVCIVTAPTTLYTVL--YMFWPFSRTLCKIAGSLQGFNIFLSTFSIASIAVDRY 138          
BLAST of NPYR-5 vs. Ensembl Celegans
Match: npr-10 (NeuroPeptide Receptor family [Source:UniProtKB/TrEMBL;Acc:Q6EUU1])

HSP 1 Score: 76.2554 bits (186), Expect = 3.137e-15
Identity = 39/88 (44.32%), Postives = 59/88 (67.05%), Query Frame = 1
Query:  358 GVFGNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRF 621
            GV GN LVV +VMR++ LQ+ RN+FI++L++SD+ + I +     +    K   W +G  LC +  LLQGT +  ST+T+TAIA+DR+
Sbjct:   42 GVTGNLLVVMSVMRFKVLQSVRNMFIVSLSVSDIFVAIVSGSVTPITAFSKV--WLFGGPLCHLLPLLQGTALSFSTLTLTAIAIDRY 127          
BLAST of NPYR-5 vs. Ensembl Fly
Match: NPFR (gene:FBgn0037408 transcript:FBtr0308317)

HSP 1 Score: 103.99 bits (258), Expect = 2.851e-24
Identity = 51/90 (56.67%), Postives = 65/90 (72.22%), Query Frame = 1
Query:  358 GVFGNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRFQI 627
            G  GN LVV AV+R   ++TARN+FILNLAISDL LC+ T P  L+ +L KY P+    +LCK  A+LQ   +FVSTI+ITAIA DR+Q+
Sbjct:  100 GALGNTLVVIAVIRKPIMRTARNLFILNLAISDLLLCLVTMPLTLMEILSKYWPYGSCSILCKTIAMLQALCIFVSTISITAIAFDRYQV 189          
BLAST of NPYR-5 vs. Ensembl Fly
Match: NPFR (gene:FBgn0037408 transcript:FBtr0308316)

HSP 1 Score: 103.99 bits (258), Expect = 2.933e-24
Identity = 51/90 (56.67%), Postives = 65/90 (72.22%), Query Frame = 1
Query:  358 GVFGNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRFQI 627
            G  GN LVV AV+R   ++TARN+FILNLAISDL LC+ T P  L+ +L KY P+    +LCK  A+LQ   +FVSTI+ITAIA DR+Q+
Sbjct:  100 GALGNTLVVIAVIRKPIMRTARNLFILNLAISDLLLCLVTMPLTLMEILSKYWPYGSCSILCKTIAMLQALCIFVSTISITAIAFDRYQV 189          
BLAST of NPYR-5 vs. Ensembl Fly
Match: NPFR (gene:FBgn0037408 transcript:FBtr0308318)

HSP 1 Score: 103.605 bits (257), Expect = 3.773e-24
Identity = 51/90 (56.67%), Postives = 65/90 (72.22%), Query Frame = 1
Query:  358 GVFGNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRFQI 627
            G  GN LVV AV+R   ++TARN+FILNLAISDL LC+ T P  L+ +L KY P+    +LCK  A+LQ   +FVSTI+ITAIA DR+Q+
Sbjct:  100 GALGNTLVVIAVIRKPIMRTARNLFILNLAISDLLLCLVTMPLTLMEILSKYWPYGSCSILCKTIAMLQALCIFVSTISITAIAFDRYQV 189          
BLAST of NPYR-5 vs. Ensembl Fly
Match: NPFR (gene:FBgn0037408 transcript:FBtr0078590)

HSP 1 Score: 103.605 bits (257), Expect = 3.866e-24
Identity = 51/90 (56.67%), Postives = 65/90 (72.22%), Query Frame = 1
Query:  358 GVFGNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRFQI 627
            G  GN LVV AV+R   ++TARN+FILNLAISDL LC+ T P  L+ +L KY P+    +LCK  A+LQ   +FVSTI+ITAIA DR+Q+
Sbjct:  100 GALGNTLVVIAVIRKPIMRTARNLFILNLAISDLLLCLVTMPLTLMEILSKYWPYGSCSILCKTIAMLQALCIFVSTISITAIAFDRYQV 189          
BLAST of NPYR-5 vs. Ensembl Fly
Match: sNPF-R (gene:FBgn0036934 transcript:FBtr0332667)

HSP 1 Score: 86.6557 bits (213), Expect = 3.303e-18
Identity = 39/88 (44.32%), Postives = 59/88 (67.05%), Query Frame = 1
Query:  358 GVFGNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRF 621
            GVFGN LV + V+R R +QT  N+FI NLA+SD+ LC+   PF  L   +    W +G  LC + +  QG ++++ST+T+T+IA+DR+
Sbjct:   77 GVFGNVLVCYVVLRNRAMQTVTNIFITNLALSDILLCVLAVPFTPLYTFMGR--WAFGRSLCHLVSFAQGCSIYISTLTLTSIAIDRY 162          
BLAST of NPYR-5 vs. Ensembl Zebrafish
Match: CU915819.2 (neuropeptide FF receptor 2a [Source:NCBI gene;Acc:560955])

HSP 1 Score: 81.2629 bits (199), Expect = 1.593e-16
Identity = 40/86 (46.51%), Postives = 58/86 (67.44%), Query Frame = 1
Query:  367 GNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRFQ 624
            GN +V F V+R + ++T  N+FILNLAISDL + IF  P  LL  ++    W +G ++CKMS ++QG +V  S  T+ AIA+DRF+
Sbjct:   63 GNGVVCFIVLRSKNMRTVTNLFILNLAISDLLVGIFCMPTTLLDNIIT--GWPFGSMVCKMSGMVQGISVSASVFTLVAIAVDRFR 146          
BLAST of NPYR-5 vs. Ensembl Zebrafish
Match: AL929374.1 (neuropeptide FF receptor 2a [Source:NCBI gene;Acc:560955])

HSP 1 Score: 81.2629 bits (199), Expect = 1.593e-16
Identity = 40/86 (46.51%), Postives = 58/86 (67.44%), Query Frame = 1
Query:  367 GNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRFQ 624
            GN +V F V+R + ++T  N+FILNLAISDL + IF  P  LL  ++    W +G ++CKMS ++QG +V  S  T+ AIA+DRF+
Sbjct:   63 GNGVVCFIVLRSKNMRTVTNLFILNLAISDLLVGIFCMPTTLLDNIIT--GWPFGSMVCKMSGMVQGISVSASVFTLVAIAVDRFR 146          
BLAST of NPYR-5 vs. Ensembl Zebrafish
Match: NPFFR2 (neuropeptide FF receptor 2a [Source:NCBI gene;Acc:560955])

HSP 1 Score: 81.2629 bits (199), Expect = 1.593e-16
Identity = 40/86 (46.51%), Postives = 58/86 (67.44%), Query Frame = 1
Query:  367 GNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRFQ 624
            GN +V F V+R + ++T  N+FILNLAISDL + IF  P  LL  ++    W +G ++CKMS ++QG +V  S  T+ AIA+DRF+
Sbjct:   63 GNGVVCFIVLRSKNMRTVTNLFILNLAISDLLVGIFCMPTTLLDNIIT--GWPFGSMVCKMSGMVQGISVSASVFTLVAIAVDRFR 146          
BLAST of NPYR-5 vs. Ensembl Zebrafish
Match: NPFFR2 (neuropeptide FF receptor 2a [Source:NCBI gene;Acc:560955])

HSP 1 Score: 81.2629 bits (199), Expect = 1.593e-16
Identity = 40/86 (46.51%), Postives = 58/86 (67.44%), Query Frame = 1
Query:  367 GNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRFQ 624
            GN +V F V+R + ++T  N+FILNLAISDL + IF  P  LL  ++    W +G ++CKMS ++QG +V  S  T+ AIA+DRF+
Sbjct:   63 GNGVVCFIVLRSKNMRTVTNLFILNLAISDLLVGIFCMPTTLLDNIIT--GWPFGSMVCKMSGMVQGISVSASVFTLVAIAVDRFR 146          
BLAST of NPYR-5 vs. Ensembl Zebrafish
Match: npffr1l3 (neuropeptide FF receptor 1 like 3 [Source:ZFIN;Acc:ZDB-GENE-070424-44])

HSP 1 Score: 78.9518 bits (193), Expect = 1.163e-15
Identity = 40/88 (45.45%), Postives = 58/88 (65.91%), Query Frame = 1
Query:  361 VFGNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRFQ 624
            + GNALV   V+R R ++T  N+FILNLA+SDL + IF  P  L+  L+    W + + +CK+S L+QG +V  S  T+ AIA+DRF+
Sbjct:   66 LMGNALVCVIVLRNRHMRTVTNIFILNLAVSDLLVGIFCIPTTLVDNLIT--GWPFSNTVCKLSGLVQGMSVSASVFTLVAIAVDRFR 151          
BLAST of NPYR-5 vs. Ensembl Xenopus
Match: clstn2 (calsyntenin 2 [Source:Xenbase;Acc:XB-GENE-958942])

HSP 1 Score: 80.8777 bits (198), Expect = 2.992e-16
Identity = 41/86 (47.67%), Postives = 59/86 (68.60%), Query Frame = 1
Query:  367 GNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRFQ 624
            GN LV F V++ RQ++T  N+FILNLAISDL + IF  P  L+  L+    W + +++CKMS L+QG +V  S  T+ AIA++RF+
Sbjct:   55 GNMLVCFIVLKNRQMRTVTNMFILNLAISDLLVGIFCMPTTLVDNLIT--GWPFDNIMCKMSGLVQGMSVSASVFTLVAIAVERFR 138          
BLAST of NPYR-5 vs. Ensembl Xenopus
Match: clstn2 (calsyntenin 2 [Source:Xenbase;Acc:XB-GENE-958942])

HSP 1 Score: 80.8777 bits (198), Expect = 3.488e-16
Identity = 41/86 (47.67%), Postives = 59/86 (68.60%), Query Frame = 1
Query:  367 GNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRFQ 624
            GN LV F V++ RQ++T  N+FILNLAISDL + IF  P  L+  L+    W + +++CKMS L+QG +V  S  T+ AIA++RF+
Sbjct:   54 GNMLVCFIVLKNRQMRTVTNMFILNLAISDLLVGIFCMPTTLVDNLIT--GWPFDNIMCKMSGLVQGMSVSASVFTLVAIAVERFR 137          
BLAST of NPYR-5 vs. Ensembl Xenopus
Match: NPFFR2 (neuropeptide FF receptor 2 [Source:NCBI gene;Acc:100498122])

HSP 1 Score: 79.337 bits (194), Expect = 1.044e-15
Identity = 39/88 (44.32%), Postives = 57/88 (64.77%), Query Frame = 1
Query:  361 VFGNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRFQ 624
            + GN +V F V+  + ++T  N+FILNLAISDL + IF  P  LL  ++    W +G  +CKMS ++QG +V  S  T+ AIA+DRF+
Sbjct:   57 MLGNGVVCFIVLSSKHMRTVTNLFILNLAISDLLVGIFCMPTTLLDNIIA--GWPFGSTVCKMSGMVQGISVSASVFTLVAIAVDRFR 142          
BLAST of NPYR-5 vs. Ensembl Xenopus
Match: gadd45b (growth arrest and DNA damage inducible beta [Source:Xenbase;Acc:XB-GENE-979559])

HSP 1 Score: 76.6406 bits (187), Expect = 7.430e-15
Identity = 36/90 (40.00%), Postives = 60/90 (66.67%), Query Frame = 1
Query:  358 GVFGNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRFQI 627
             +FGN LV   VM+ +++ +A ++FI+NLA+SD+ + +   PF L+R +     W +G  +C +S  +Q  ++ VST+T+TAIALDR Q+
Sbjct:   86 SLFGNMLVCHVVMKNKRMHSATSLFIVNLAVSDIMITLLNTPFTLVRFVNS--TWVFGKEMCHISRFVQYCSLHVSTLTLTAIALDRHQV 173          
BLAST of NPYR-5 vs. Ensembl Xenopus
Match: NPY2R (neuropeptide Y receptor Y2 [Source:NCBI gene;Acc:100498351])

HSP 1 Score: 76.6406 bits (187), Expect = 7.869e-15
Identity = 41/100 (41.00%), Postives = 64/100 (64.00%), Query Frame = 1
Query:  358 GVFGNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRFQ-ISYILLARLA 654
            GV GN+LV++ V++++ ++T  N FI+NLA+SDL +     PF L+  L+    W +G VLC +    QG  V VST+T+  IALDR + I Y L ++++
Sbjct:   87 GVLGNSLVIYVVIKFKTMRTVTNFFIVNLAVSDLMVNTLCLPFTLVYTLLD--DWKFGTVLCHLVTYSQGLAVQVSTVTLMVIALDRHRCIVYHLESKIS 184          
BLAST of NPYR-5 vs. Ensembl Mouse
Match: Npffr2 (neuropeptide FF receptor 2 [Source:MGI Symbol;Acc:MGI:1860130])

HSP 1 Score: 80.8777 bits (198), Expect = 2.159e-16
Identity = 41/86 (47.67%), Postives = 55/86 (63.95%), Query Frame = 1
Query:  367 GNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRFQ 624
            GN +V F V+R R + T  N FILNLAISDL + IF  P  LL  ++    W +G  +CK+S L+QG +V  S  T+ AIA+DRF+
Sbjct:   62 GNTVVCFIVIRNRHMHTVTNFFILNLAISDLLVGIFCMPITLLDNIIA--GWPFGSSMCKISGLVQGISVAASVFTLVAIAVDRFR 145          
BLAST of NPYR-5 vs. Ensembl Mouse
Match: Npffr1 (neuropeptide FF receptor 1 [Source:MGI Symbol;Acc:MGI:2685082])

HSP 1 Score: 76.6406 bits (187), Expect = 5.600e-15
Identity = 39/86 (45.35%), Postives = 56/86 (65.12%), Query Frame = 1
Query:  367 GNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRFQ 624
            GN LV F V++ R ++T  N+FILNLA+SDL + IF  P  L+  L+    W + +  CKMS L+QG +V  S  T+ AIA++RF+
Sbjct:   60 GNTLVCFIVLKNRHMRTVTNMFILNLAVSDLLVGIFCMPTTLVDNLITG--WPFDNATCKMSGLVQGMSVSASVFTLVAIAVERFR 143          
BLAST of NPYR-5 vs. Ensembl Mouse
Match: Cckar (cholecystokinin A receptor [Source:MGI Symbol;Acc:MGI:99478])

HSP 1 Score: 76.6406 bits (187), Expect = 6.576e-15
Identity = 37/88 (42.05%), Postives = 60/88 (68.18%), Query Frame = 1
Query:  358 GVFGNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRF 621
             V GN LV+  ++R ++++T  N+F+L+LA+SDL LC+F  PFNL+  L+K   + +G  +CK +    GT+V VST  + AI+L+R+
Sbjct:   55 SVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLK--DFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERY 140          
BLAST of NPYR-5 vs. Ensembl Mouse
Match: Npy2r (neuropeptide Y receptor Y2 [Source:MGI Symbol;Acc:MGI:108418])

HSP 1 Score: 75.8702 bits (185), Expect = 9.351e-15
Identity = 47/112 (41.96%), Postives = 67/112 (59.82%), Query Frame = 1
Query:  358 GVFGNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRFQ-ISYILLARLAHWIKWL*LLIIG 690
            GV GN+LV+  V++++ ++T  N FI NLA++DL +     PF L   L+    W  G VLC +    QG  V VSTIT+T IALDR + I Y L ++++  I +   LIIG
Sbjct:   64 GVVGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMG--EWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISF---LIIG 170          
BLAST of NPYR-5 vs. Ensembl Mouse
Match: Npy2r (neuropeptide Y receptor Y2 [Source:MGI Symbol;Acc:MGI:108418])

HSP 1 Score: 75.8702 bits (185), Expect = 9.351e-15
Identity = 47/112 (41.96%), Postives = 67/112 (59.82%), Query Frame = 1
Query:  358 GVFGNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRFQ-ISYILLARLAHWIKWL*LLIIG 690
            GV GN+LV+  V++++ ++T  N FI NLA++DL +     PF L   L+    W  G VLC +    QG  V VSTIT+T IALDR + I Y L ++++  I +   LIIG
Sbjct:   64 GVVGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMG--EWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISF---LIIG 170          
BLAST of NPYR-5 vs. UniProt/SwissProt
Match: sp|Q9VNM1|NPFR_DROME (Neuropeptide F receptor OS=Drosophila melanogaster OX=7227 GN=NPFR PE=1 SV=3)

HSP 1 Score: 103.605 bits (257), Expect = 3.875e-23
Identity = 51/90 (56.67%), Postives = 65/90 (72.22%), Query Frame = 1
Query:  358 GVFGNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRFQI 627
            G  GN LVV AV+R   ++TARN+FILNLAISDL LC+ T P  L+ +L KY P+    +LCK  A+LQ   +FVSTI+ITAIA DR+Q+
Sbjct:  100 GALGNTLVVIAVIRKPIMRTARNLFILNLAISDLLLCLVTMPLTLMEILSKYWPYGSCSILCKTIAMLQALCIFVSTISITAIAFDRYQV 189          
BLAST of NPYR-5 vs. UniProt/SwissProt
Match: sp|Q9Y5X5|NPFF2_HUMAN (Neuropeptide FF receptor 2 OS=Homo sapiens OX=9606 GN=NPFFR2 PE=1 SV=2)

HSP 1 Score: 84.7297 bits (208), Expect = 1.244e-16
Identity = 42/88 (47.73%), Postives = 58/88 (65.91%), Query Frame = 1
Query:  361 VFGNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRFQ 624
            + GN +V F VMR + + T  N+FILNLAISDL + IF  P  LL  ++    W +G+ +CK+S L+QG +V  S  T+ AIA+DRFQ
Sbjct:  162 MMGNTVVCFIVMRNKHMHTVTNLFILNLAISDLLVGIFCMPITLLDNIIA--GWPFGNTMCKISGLVQGISVAASVFTLVAIAVDRFQ 247          
BLAST of NPYR-5 vs. UniProt/SwissProt
Match: sp|Q924H0|NPFF2_MOUSE (Neuropeptide FF receptor 2 OS=Mus musculus OX=10090 GN=Npffr2 PE=2 SV=2)

HSP 1 Score: 80.8777 bits (198), Expect = 1.510e-15
Identity = 41/86 (47.67%), Postives = 55/86 (63.95%), Query Frame = 1
Query:  367 GNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRFQ 624
            GN +V F V+R R + T  N FILNLAISDL + IF  P  LL  ++    W +G  +CK+S L+QG +V  S  T+ AIA+DRF+
Sbjct:   62 GNTVVCFIVIRNRHMHTVTNFFILNLAISDLLVGIFCMPITLLDNIIA--GWPFGSSMCKISGLVQGISVAASVFTLVAIAVDRFR 145          
BLAST of NPYR-5 vs. UniProt/SwissProt
Match: sp|O97772|CCKAR_RABIT (Cholecystokinin receptor type A OS=Oryctolagus cuniculus OX=9986 GN=CCKAR PE=2 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 2.086e-15
Identity = 40/88 (45.45%), Postives = 62/88 (70.45%), Query Frame = 1
Query:  358 GVFGNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRF 621
             V GN LV+  ++R ++++T  N+F+L+LAISDL LC+F  PFNL+  L+K   + +G  LCK +  L GT+V VST+ + AI+L+R+
Sbjct:   55 SVLGNTLVITVLIRNKRMRTVTNIFLLSLAISDLMLCLFCMPFNLIPNLLK--DFIFGSALCKTTTYLMGTSVSVSTLNLVAISLERY 140          
BLAST of NPYR-5 vs. UniProt/SwissProt
Match: sp|Q9EQD2|NPFF2_RAT (Neuropeptide FF receptor 2 OS=Rattus norvegicus OX=10116 GN=Npffr2 PE=2 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 7.641e-15
Identity = 40/86 (46.51%), Postives = 54/86 (62.79%), Query Frame = 1
Query:  367 GNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRFQ 624
            GN +V F V+R R + T  N FI NLAISDL + IF  P  LL  ++    W +G  +CK+S L+QG +V  S  T+ AIA+DRF+
Sbjct:   62 GNTVVCFVVIRNRYMHTVTNFFIFNLAISDLLVGIFCMPITLLDNIIA--GWPFGSSMCKISGLVQGISVAASVFTLVAIAVDRFR 145          
BLAST of NPYR-5 vs. TrEMBL
Match: A0A193KUX4 (NPYR-5 OS=Schmidtea mediterranea OX=79327 GN=npyr-5 PE=2 SV=1)

HSP 1 Score: 322.398 bits (825), Expect = 1.066e-103
Identity = 169/170 (99.41%), Postives = 170/170 (100.00%), Query Frame = 1
Query:  118 MMEQFNQSCHIYFKNSNEIPVRSIEMMINYYKYCGQFTDIERETFIQVIKDSIPKPNKLEKLELAGXXXXXXXXXXXXXXGVFGNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRFQI 627
            MMEQFNQSCHIYFKNSNEIPVRSIEMMINYYKYCGQFTDIERETFIQVIKDSIPKPNKLEKLELAGLITILTIFILMIIFGVFGNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRFQ+
Sbjct:    1 MMEQFNQSCHIYFKNSNEIPVRSIEMMINYYKYCGQFTDIERETFIQVIKDSIPKPNKLEKLELAGLITILTIFILMIIFGVFGNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRFQV 170          
BLAST of NPYR-5 vs. TrEMBL
Match: A0A5J4NQ82 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Paragonimus westermani OX=34504 GN=DEA37_0011624 PE=4 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 4.862e-31
Identity = 55/92 (59.78%), Postives = 73/92 (79.35%), Query Frame = 1
Query:  358 GVFGNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRFQISY 633
            G  G+ LV+F ++R   ++T  N+FI+NLAISDL LC+ TQPF L RLL+ +HPWT G  +CK SA+ QGTN+FVSTI+ITAIALDRF++S+
Sbjct:   81 GTIGSGLVIFVILRNPAMRTRSNLFIMNLAISDLTLCLITQPFTLYRLLIGHHPWTLGQFMCKFSAMFQGTNIFVSTISITAIALDRFKVSW 172          
BLAST of NPYR-5 vs. TrEMBL
Match: A0A075A1F7 (G_PROTEIN_RECEP_F1_2 domain-containing protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=T265_12603 PE=4 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 6.787e-31
Identity = 57/89 (64.04%), Postives = 71/89 (79.78%), Query Frame = 1
Query:  358 GVFGNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRFQ 624
            G FG+ LV+F V+R   ++T  N+FI+NLAISDL LC+FTQPF L RLL+ +HPW  G  +CK SA+ QGTN+FVSTI+ITAIALDRFQ
Sbjct:  226 GTFGSGLVIFVVLRKPSMRTRSNLFIMNLAISDLTLCLFTQPFTLYRLLIGHHPWALGSFMCKFSAMFQGTNIFVSTISITAIALDRFQ 314          
BLAST of NPYR-5 vs. TrEMBL
Match: A0A183VXF4 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Trichobilharzia regenti OX=157069 GN=TRE_LOCUS5160 PE=4 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 1.490e-30
Identity = 67/139 (48.20%), Postives = 92/139 (66.19%), Query Frame = 1
Query:  214 YCGQFTDIERETFIQVIKDSIPKPNKLEKLELAGXXXXXXXXXXXXXXGVFGNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRFQIS 630
            +  Q    +RE  + +  +   +     K+      T + IF+ MI+FG FG++LV++ V+R R ++T  N+FILNLAISDL LC+ TQPFNLLRLL     W  G  +CK SA+ QGTN+FVSTI+ITAIA+DRFQ+S
Sbjct:   18 FSTQLNSSKREELLSIFWEEFEESRNQSKIPTVLFATTIIIFLGMILFGAFGSSLVIYVVLRKRSMRTRGNLFILNLAISDLTLCLITQPFNLLRLLTGNRNWALGLFMCKFSAMFQGTNIFVSTISITAIAIDRFQVS 156          
BLAST of NPYR-5 vs. TrEMBL
Match: A0A183JYA6 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS7709 PE=4 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 1.466e-29
Identity = 56/94 (59.57%), Postives = 72/94 (76.60%), Query Frame = 1
Query:  358 GVFGNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRFQISYIL 639
            G+FG++LV+F ++  R ++T  N+FILNLAISDL LC+ TQPFNLLRLL   + W  G  +CK SA+ QGTN+FVST +ITAIA+DRFQ  Y L
Sbjct:   48 GIFGSSLVIFIILNNRSMRTRGNLFILNLAISDLTLCLITQPFNLLRLLTNNYNWILGQFMCKFSAMFQGTNIFVSTFSITAIAIDRFQNDYCL 141          
BLAST of NPYR-5 vs. Ensembl Cavefish
Match: NPFFR2 (neuropeptide FF receptor 2 [Source:NCBI gene;Acc:103039748])

HSP 1 Score: 80.4925 bits (197), Expect = 2.355e-16
Identity = 39/86 (45.35%), Postives = 58/86 (67.44%), Query Frame = 1
Query:  367 GNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRFQ 624
            GN +V F V+R + ++T  N+FILNLA+SDL + IF  P  LL  ++    W +G ++CKMS ++QG +V  S  T+ AIA+DRF+
Sbjct:   63 GNGVVCFIVLRSKNMRTVTNLFILNLAVSDLLVGIFCMPTTLLDNIIT--GWPFGSMVCKMSGMVQGISVSASVFTLVAIAVDRFR 146          
BLAST of NPYR-5 vs. Ensembl Cavefish
Match: npffr1l3 (neuropeptide FF receptor 1-like [Source:NCBI gene;Acc:111195007])

HSP 1 Score: 79.7221 bits (195), Expect = 5.254e-16
Identity = 41/88 (46.59%), Postives = 57/88 (64.77%), Query Frame = 1
Query:  361 VFGNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRFQ 624
            + GN +V   V+R R + T  N FILNL+ISDL + IF  P  L+  L+    W + DV+CK+S L+QGT+V  S  T+ AIA+DRF+
Sbjct:   73 MIGNGVVCLIVLRNRHMWTVTNAFILNLSISDLLVGIFCIPTTLVDNLIT--GWPFSDVMCKLSGLVQGTSVCASVFTLVAIAVDRFR 158          
BLAST of NPYR-5 vs. Ensembl Cavefish
Match: npffr2b (neuropeptide FF receptor 2-like [Source:NCBI gene;Acc:103031865])

HSP 1 Score: 78.5666 bits (192), Expect = 1.330e-15
Identity = 38/86 (44.19%), Postives = 57/86 (66.28%), Query Frame = 1
Query:  367 GNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRFQ 624
            GN LV F V+R + ++T  N+FILNLAISDL + IF  P  L+  ++    W +G ++CK+S ++QG +V  S  T+  IA+DRF+
Sbjct:   71 GNGLVCFIVLRSKSMRTVTNLFILNLAISDLLVGIFCMPTTLVDNIIT--GWPFGSLVCKLSGMVQGISVSASVFTLVVIAVDRFR 154          
BLAST of NPYR-5 vs. Ensembl Cavefish
Match: npffr2b (neuropeptide FF receptor 2-like [Source:NCBI gene;Acc:103031865])

HSP 1 Score: 78.5666 bits (192), Expect = 1.418e-15
Identity = 38/86 (44.19%), Postives = 57/86 (66.28%), Query Frame = 1
Query:  367 GNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRFQ 624
            GN LV F V+R + ++T  N+FILNLAISDL + IF  P  L+  ++    W +G ++CK+S ++QG +V  S  T+  IA+DRF+
Sbjct:   65 GNGLVCFIVLRSKSMRTVTNLFILNLAISDLLVGIFCMPTTLVDNIIT--GWPFGSLVCKLSGMVQGISVSASVFTLVVIAVDRFR 148          
BLAST of NPYR-5 vs. Ensembl Cavefish
Match: npy2r (neuropeptide Y receptor Y2 [Source:ZFIN;Acc:ZDB-GENE-040924-8])

HSP 1 Score: 77.0258 bits (188), Expect = 3.066e-15
Identity = 40/89 (44.94%), Postives = 55/89 (61.80%), Query Frame = 1
Query:  358 GVFGNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRFQ 624
            GV GNALV++ V ++R L T  N FI+NLA++DL +     PF L+  L  Y  W +G  +C +    QG  V VSTIT+  IALDR++
Sbjct:   70 GVTGNALVIYVVYKFRNLHTVTNFFIVNLAVADLLVNTLCLPFTLMYTL--YGEWKFGQAMCYLLPYAQGLAVNVSTITLNIIALDRYR 156          
BLAST of NPYR-5 vs. Ensembl Sea Lamprey
Match: npffr1l3 (neuropeptide FF receptor 1 like 3 [Source:ZFIN;Acc:ZDB-GENE-070424-44])

HSP 1 Score: 83.1889 bits (204), Expect = 4.044e-18
Identity = 42/86 (48.84%), Postives = 60/86 (69.77%), Query Frame = 1
Query:  367 GNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRFQ 624
            GN LV + V++ R+++T  N+FILNLA+SDL + IF  P  L+  L+    W +G V+CKMS L+QGT+V  S  T+ AIA+DRF+
Sbjct:   66 GNGLVCYVVLQSRRMRTVTNLFILNLAVSDLLVGIFCMPITLVDNLIT--GWPFGVVVCKMSGLVQGTSVSASVFTLVAIAVDRFR 149          
BLAST of NPYR-5 vs. Ensembl Sea Lamprey
Match: si:dkey-202l22.3 (prolactin releasing hormone receptor [Source:HGNC Symbol;Acc:HGNC:4464])

HSP 1 Score: 69.707 bits (169), Expect = 1.469e-13
Identity = 40/102 (39.22%), Postives = 61/102 (59.80%), Query Frame = 1
Query:  358 GVFGNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHP--WTYGDVLCKMSALLQGTNVFVSTITITAIALDRF-QISYILLARLA 654
            GV GN L++  + R ++L  A N  + NLA+SDL +C+   P +       + P  W YG +LC + ALLQ   V VS +++TAIALDR+  ++Y +  R+A
Sbjct:   81 GVSGNLLLILVIARTKRLHNATNFLLGNLALSDLLVCLTCVPISAA---FAFEPRGWVYGALLCYLVALLQPATVHVSVLSLTAIALDRYVVVAYPIRRRVA 179          
BLAST of NPYR-5 vs. Ensembl Sea Lamprey
Match: sstr1a (somatostatin receptor 1a [Source:ZFIN;Acc:ZDB-GENE-090429-1])

HSP 1 Score: 69.3218 bits (168), Expect = 1.918e-13
Identity = 32/88 (36.36%), Postives = 56/88 (63.64%), Query Frame = 1
Query:  358 GVFGNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRF 621
            G+FGN++V++ ++RY +++TA N++ILNLA++D  L + + PF  L      H W +G  LC++   + G N+F S   +T +  DR+
Sbjct:   27 GLFGNSMVIYVILRYAKMKTATNIYILNLAVADE-LFMMSVPF--LATSTALHHWPFGSSLCRLVLSVDGINMFTSVFCLTVLTFDRY 111          
BLAST of NPYR-5 vs. Ensembl Sea Lamprey
Match: qrfpr4 (pyroglutamylated RFamide peptide receptor 4 [Source:ZFIN;Acc:ZDB-GENE-091204-354])

HSP 1 Score: 68.9366 bits (167), Expect = 2.865e-13
Identity = 36/86 (41.86%), Postives = 52/86 (60.47%), Query Frame = 1
Query:  367 GNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRFQ 624
            GNALV+F V R + L T  NVF+ +LA+SDL + +F  P  L++    +  W  G  LCK+   +Q T V  S +T+  IA++RFQ
Sbjct:   62 GNALVIFVVARRKALHTVANVFVCSLAVSDLMITVFCIPITLMQNF--FSNWIAGVALCKLVPFIQVTAVTTSMLTMACIAVERFQ 145          
BLAST of NPYR-5 vs. Ensembl Sea Lamprey
Match: kiss1rb (KISS1 receptor b [Source:ZFIN;Acc:ZDB-GENE-060526-54])

HSP 1 Score: 65.4698 bits (158), Expect = 3.096e-12
Identity = 34/100 (34.00%), Postives = 56/100 (56.00%), Query Frame = 1
Query:  358 GVFGNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRFQISYILLARLAH 657
            G+ GN+LV+F + + RQ++T  N FI+NLA +D+   +   PF     L     W +GD +CK    LQ   V  + +T+TA+++DR  ++   +  L H
Sbjct:   50 GLVGNSLVIFVITKNRQMRTVTNFFIVNLAGTDIIFLVCCVPFT--ATLYPLPSWVFGDFMCKFVNYLQQVTVQATCMTLTAMSVDRCYVTVYPIRSLQH 147          
BLAST of NPYR-5 vs. Ensembl Nematostella
Match: EDO38342 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SD89])

HSP 1 Score: 70.8626 bits (172), Expect = 1.190e-13
Identity = 31/88 (35.23%), Postives = 53/88 (60.23%), Query Frame = 1
Query:  358 GVFGNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRF 621
             + GN+L++ A+ R+R LQT  NVF++NLAI+D+ L +   PF +   +   + W +GD  CK+  +        S +T+T ++L+RF
Sbjct:   51 AIIGNSLILTAIYRFRSLQTKTNVFVVNLAIADISLAVLAMPFTMTSSIT--YEWIFGDTFCKVQGIFNSLFCEASILTLTFVSLERF 136          
BLAST of NPYR-5 vs. Ensembl Nematostella
Match: EDO46030 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR08])

HSP 1 Score: 68.9366 bits (167), Expect = 2.825e-13
Identity = 35/89 (39.33%), Postives = 55/89 (61.80%), Query Frame = 1
Query:  358 GVFGNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRFQ 624
               GN+L VF +MR R+++T  N FILNLAI+DL L +   PF++    + Y  W YG  +CK+   LQ   +F S  T+T++++ R++
Sbjct:   18 SAIGNSLTVFVIMRRRKMKTVTNYFILNLAIADLTLTLICIPFDIPVQEMDYI-WPYGPFMCKILYPLQTMCLFASVFTLTSVSVARYR 105          
BLAST of NPYR-5 vs. Ensembl Nematostella
Match: EDO45537 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSB3])

HSP 1 Score: 67.0106 bits (162), Expect = 1.155e-12
Identity = 34/89 (38.20%), Postives = 56/89 (62.92%), Query Frame = 1
Query:  358 GVFGNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRFQ 624
            GV GN LV   V +  ++ TA N+F++NLA+ D+ +C+F   F L+   ++Y  W +G V CKM   LQ TN+  ST ++ A+ ++R++
Sbjct:    7 GVVGNILVCVVVYKNHRMHTAMNMFLVNLAVCDIFVCVFNIIFTLIYFQLQY--WPFGLVWCKMLPTLQITNISASTGSLVAMTVERYR 93          
BLAST of NPYR-5 vs. Ensembl Nematostella
Match: EDO40944 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5Q4])

HSP 1 Score: 66.2402 bits (160), Expect = 2.259e-12
Identity = 34/85 (40.00%), Postives = 53/85 (62.35%), Query Frame = 1
Query:  367 GNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRF 621
            GN+LV   ++R R+++T  N F+LNLAI+DL L     PF++    + Y  W YG  +CK+   LQ  ++F S  T+TA++L R+
Sbjct:   10 GNSLVCIVILRRRRMKTVTNYFVLNLAIADLALTCICIPFDIPVQEMNY-VWPYGGFMCKILYPLQTLSLFASVFTLTAVSLTRY 93          
BLAST of NPYR-5 vs. Ensembl Nematostella
Match: EDO30086 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1S5])

HSP 1 Score: 62.3882 bits (150), Expect = 4.112e-12
Identity = 32/90 (35.56%), Postives = 55/90 (61.11%), Query Frame = 1
Query:  358 GVFGNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLV--KYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRF 621
             + GN+LV+F V R+  L+ A N  I+N+AI+DL + IFT P+++  L +  ++    +G++LCK+       ++  S  T+T I +DRF
Sbjct:   19 SLLGNSLVLFVVYRHHTLRNALNYLIVNMAIADLLVTIFTMPYSVSYLYIQNRWFGGVFGEILCKVVQSAVAISIAASIFTLTTITIDRF 108          
BLAST of NPYR-5 vs. Ensembl Medaka
Match: npffr2b (neuropeptide FF receptor 2-like [Source:NCBI gene;Acc:101174760])

HSP 1 Score: 80.4925 bits (197), Expect = 2.384e-16
Identity = 39/86 (45.35%), Postives = 58/86 (67.44%), Query Frame = 1
Query:  367 GNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRFQ 624
            GN +V F V+R + ++T  N+FILNLAISDL + IF  P  LL  ++    W +G ++CK+S ++QG +V  S  T+ AIA+DRF+
Sbjct:   62 GNGVVCFIVLRSKNMRTVTNLFILNLAISDLLVGIFCMPTTLLDNIIT--GWPFGSIVCKLSGMVQGISVSASVFTLVAIAVDRFR 145          
BLAST of NPYR-5 vs. Ensembl Medaka
Match: npffr2b (neuropeptide FF receptor 2-like [Source:NCBI gene;Acc:101174760])

HSP 1 Score: 80.1073 bits (196), Expect = 2.940e-16
Identity = 39/86 (45.35%), Postives = 58/86 (67.44%), Query Frame = 1
Query:  367 GNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRFQ 624
            GN +V F V+R + ++T  N+FILNLAISDL + IF  P  LL  ++    W +G ++CK+S ++QG +V  S  T+ AIA+DRF+
Sbjct:   61 GNGVVCFIVLRSKNMRTVTNLFILNLAISDLLVGIFCMPTTLLDNIIT--GWPFGSIVCKLSGMVQGISVSASVFTLVAIAVDRFR 144          
BLAST of NPYR-5 vs. Ensembl Medaka
Match: ENSORLT00000042596.1 (neuropeptide FF receptor 2 [Source:NCBI gene;Acc:101169169])

HSP 1 Score: 79.7221 bits (195), Expect = 5.188e-16
Identity = 39/86 (45.35%), Postives = 57/86 (66.28%), Query Frame = 1
Query:  367 GNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRFQ 624
            GN +V F V+R + + T  N+FILNLA+SDL + IF  P  LL  ++    W +G ++CKMS ++QG +V  S  T+ AIA+DRF+
Sbjct:  109 GNGVVCFIVLRSKNMWTVTNLFILNLAVSDLLVGIFCMPTTLLDNIIT--GWPFGSLVCKMSGMVQGISVSASVFTLVAIAVDRFR 192          
BLAST of NPYR-5 vs. Ensembl Medaka
Match: npy2r (neuropeptide Y receptor Y2 [Source:ZFIN;Acc:ZDB-GENE-040924-8])

HSP 1 Score: 78.5666 bits (192), Expect = 8.242e-16
Identity = 42/89 (47.19%), Postives = 56/89 (62.92%), Query Frame = 1
Query:  358 GVFGNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRFQ 624
            GV GN+LVV+ V ++R L+T  N FI+NLA++DL +     PF L+  L  Y  W +G VLC +    QG  V VSTIT+  IALDR +
Sbjct:   61 GVTGNSLVVYVVYKFRNLRTVTNFFIINLAVADLLVNTLCLPFTLIYTL--YDEWMFGQVLCYLLPFAQGMTVQVSTITLNIIALDRHR 147          
BLAST of NPYR-5 vs. Ensembl Medaka
Match: GPR83 (G protein-coupled receptor 83 [Source:NCBI gene;Acc:101172125])

HSP 1 Score: 73.9442 bits (180), Expect = 3.878e-14
Identity = 35/90 (38.89%), Postives = 60/90 (66.67%), Query Frame = 1
Query:  358 GVFGNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRFQI 627
             +FGN LV   V++ +  Q++ ++FILNLA++D+ + +   PF L+R +  +  W +G  +C +S  +Q  ++ VST+T+TAIALDR Q+
Sbjct:   99 SLFGNTLVCHVVVKNKSTQSSTSLFILNLAVADIFITVLNTPFTLVRFV--HSTWVFGRAMCHISRFVQYCSLHVSTLTLTAIALDRRQM 186          
BLAST of NPYR-5 vs. Planmine SMEST
Match: SMESG000004267.1 (SMESG000004267.1)

HSP 1 Score: 322.398 bits (825), Expect = 3.564e-107
Identity = 169/170 (99.41%), Postives = 170/170 (100.00%), Query Frame = 1
Query:  118 MMEQFNQSCHIYFKNSNEIPVRSIEMMINYYKYCGQFTDIERETFIQVIKDSIPKPNKLEKLELAGXXXXXXXXXXXXXXGVFGNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRFQI 627
            MMEQFNQSCHIYFKNSNEIPVRSIEMMINYYKYCGQFTDIERETFIQVIKDSIPKPNKLEKLELAGLITILTIFILMIIFGVFGNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRFQ+
Sbjct:    1 MMEQFNQSCHIYFKNSNEIPVRSIEMMINYYKYCGQFTDIERETFIQVIKDSIPKPNKLEKLELAGLITILTIFILMIIFGVFGNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRFQV 170          
BLAST of NPYR-5 vs. Planmine SMEST
Match: SMESG000062221.1 (SMESG000062221.1)

HSP 1 Score: 124.79 bits (312), Expect = 8.397e-32
Identity = 56/90 (62.22%), Postives = 73/90 (81.11%), Query Frame = 1
Query:  358 GVFGNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRFQI 627
            G  G+ LV++AV+  R +++ RN+FI+NLAISDL LC+ T+PFNL+RLL     W  GD +CK+SALLQGTN+FVSTI+ITAIALDRFQ+
Sbjct:   68 GACGSTLVIYAVVHGRSMRSPRNIFIVNLAISDLILCVLTEPFNLIRLLSGQQEWILGDSMCKLSALLQGTNIFVSTISITAIALDRFQV 157          
BLAST of NPYR-5 vs. Planmine SMEST
Match: SMESG000053241.1 (SMESG000053241.1)

HSP 1 Score: 122.094 bits (305), Expect = 2.566e-31
Identity = 62/149 (41.61%), Postives = 105/149 (70.47%), Query Frame = 1
Query:  181 RSIEMMINYYKYCGQFTDIERETFIQVIKDSIPKPNKLEKLELAGXXXXXXXXXXXXXXGVFGNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRFQI 627
            +S ++++++   C    +  R+ ++++++D + +   + K  L+ LI ++  +I MI+ G  G++LV++ V+R + L+T RN+FILNLAI+DL LC F+QPFN++RLL  +  W +G+ +CK+  L  GTNV VSTI+ITAIALDR+Q+
Sbjct:    9 KSYQLIVSFVNKC--LNESFRQAYLEILQDEMIRGRNMGKFSLSFLIPLVLSYIAMIVIGTLGSSLVIYVVLRSKTLRTPRNMFILNLAITDLILCAFSQPFNIIRLLSFHKEWIFGEWVCKLVGLFTGTNVCVSTISITAIALDRYQV 155          
BLAST of NPYR-5 vs. Planmine SMEST
Match: SMESG000078214.1 (SMESG000078214.1)

HSP 1 Score: 115.931 bits (289), Expect = 3.379e-29
Identity = 51/90 (56.67%), Postives = 69/90 (76.67%), Query Frame = 1
Query:  358 GVFGNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRFQI 627
            G  G+ +V+  V + + ++T RN+FILNL ISDL LC FT+PFNLLRLL  +  W  G+ +CK++++LQGTN+ VST +ITAIALDRFQI
Sbjct:   74 GSIGSFMVILVVAKNKMMRTPRNLFILNLGISDLILCAFTEPFNLLRLLSGHQEWNLGETICKLTSMLQGTNILVSTFSITAIALDRFQI 163          
BLAST of NPYR-5 vs. Planmine SMEST
Match: SMESG000052051.1 (SMESG000052051.1)

HSP 1 Score: 117.087 bits (292), Expect = 4.274e-29
Identity = 51/90 (56.67%), Postives = 70/90 (77.78%), Query Frame = 1
Query:  358 GVFGNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQGTNVFVSTITITAIALDRFQI 627
            G  G+ LVV  V+R +Q+Q  RN+FILN+A++D  LCIFTQPFNL+RLL ++  W YG+ LCKM +   GTN+FVST++I+AIA+DRF +
Sbjct:   82 GACGSILVVLVVLRKKQMQNPRNLFILNVAVTDFILCIFTQPFNLIRLLSQHKEWVYGETLCKMVSFFTGTNMFVSTMSISAIAVDRFYV 171          
The following BLAST results are available for this feature:
BLAST of NPYR-5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NPFFR21.288e-1747.73neuropeptide FF receptor 2 [Source:HGNC Symbol;Acc... [more]
NPFFR21.354e-1747.73neuropeptide FF receptor 2 [Source:HGNC Symbol;Acc... [more]
NPFFR22.591e-1747.73neuropeptide FF receptor 2 [Source:HGNC Symbol;Acc... [more]
NPFFR16.928e-1545.35neuropeptide FF receptor 1 [Source:HGNC Symbol;Acc... [more]
CCKAR8.115e-1542.05cholecystokinin A receptor [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of NPYR-5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npr-23.401e-1740.00NeuroPeptide Receptor family [Source:UniProtKB/Tr... [more]
npr-23.652e-1740.00NeuroPeptide Receptor family [Source:UniProtKB/Tr... [more]
npr-24.058e-1740.00NeuroPeptide Receptor family [Source:UniProtKB/Tr... [more]
npr-112.991e-1544.32Putative neuropeptide Y receptor 11 [Source:UniPr... [more]
npr-103.137e-1544.32NeuroPeptide Receptor family [Source:UniProtKB/Tr... [more]
back to top
BLAST of NPYR-5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NPFR2.851e-2456.67gene:FBgn0037408 transcript:FBtr0308317[more]
NPFR2.933e-2456.67gene:FBgn0037408 transcript:FBtr0308316[more]
NPFR3.773e-2456.67gene:FBgn0037408 transcript:FBtr0308318[more]
NPFR3.866e-2456.67gene:FBgn0037408 transcript:FBtr0078590[more]
sNPF-R3.303e-1844.32gene:FBgn0036934 transcript:FBtr0332667[more]
back to top
BLAST of NPYR-5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CU915819.21.593e-1646.51neuropeptide FF receptor 2a [Source:NCBI gene;Acc:... [more]
AL929374.11.593e-1646.51neuropeptide FF receptor 2a [Source:NCBI gene;Acc:... [more]
NPFFR21.593e-1646.51neuropeptide FF receptor 2a [Source:NCBI gene;Acc:... [more]
NPFFR21.593e-1646.51neuropeptide FF receptor 2a [Source:NCBI gene;Acc:... [more]
npffr1l31.163e-1545.45neuropeptide FF receptor 1 like 3 [Source:ZFIN;Acc... [more]
back to top
BLAST of NPYR-5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
clstn22.992e-1647.67calsyntenin 2 [Source:Xenbase;Acc:XB-GENE-958942][more]
clstn23.488e-1647.67calsyntenin 2 [Source:Xenbase;Acc:XB-GENE-958942][more]
NPFFR21.044e-1544.32neuropeptide FF receptor 2 [Source:NCBI gene;Acc:1... [more]
gadd45b7.430e-1540.00growth arrest and DNA damage inducible beta [Sourc... [more]
NPY2R7.869e-1541.00neuropeptide Y receptor Y2 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of NPYR-5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Npffr22.159e-1647.67neuropeptide FF receptor 2 [Source:MGI Symbol;Acc:... [more]
Npffr15.600e-1545.35neuropeptide FF receptor 1 [Source:MGI Symbol;Acc:... [more]
Cckar6.576e-1542.05cholecystokinin A receptor [Source:MGI Symbol;Acc:... [more]
Npy2r9.351e-1541.96neuropeptide Y receptor Y2 [Source:MGI Symbol;Acc:... [more]
Npy2r9.351e-1541.96neuropeptide Y receptor Y2 [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of NPYR-5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9VNM1|NPFR_DROME3.875e-2356.67Neuropeptide F receptor OS=Drosophila melanogaster... [more]
sp|Q9Y5X5|NPFF2_HUMAN1.244e-1647.73Neuropeptide FF receptor 2 OS=Homo sapiens OX=9606... [more]
sp|Q924H0|NPFF2_MOUSE1.510e-1547.67Neuropeptide FF receptor 2 OS=Mus musculus OX=1009... [more]
sp|O97772|CCKAR_RABIT2.086e-1545.45Cholecystokinin receptor type A OS=Oryctolagus cun... [more]
sp|Q9EQD2|NPFF2_RAT7.641e-1546.51Neuropeptide FF receptor 2 OS=Rattus norvegicus OX... [more]
back to top
BLAST of NPYR-5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A193KUX41.066e-10399.41NPYR-5 OS=Schmidtea mediterranea OX=79327 GN=npyr-... [more]
A0A5J4NQ824.862e-3159.78G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A075A1F76.787e-3164.04G_PROTEIN_RECEP_F1_2 domain-containing protein (Fr... [more]
A0A183VXF41.490e-3048.20G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A183JYA61.466e-2959.57G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
back to top
BLAST of NPYR-5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NPFFR22.355e-1645.35neuropeptide FF receptor 2 [Source:NCBI gene;Acc:1... [more]
npffr1l35.254e-1646.59neuropeptide FF receptor 1-like [Source:NCBI gene;... [more]
npffr2b1.330e-1544.19neuropeptide FF receptor 2-like [Source:NCBI gene;... [more]
npffr2b1.418e-1544.19neuropeptide FF receptor 2-like [Source:NCBI gene;... [more]
npy2r3.066e-1544.94neuropeptide Y receptor Y2 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of NPYR-5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npffr1l34.044e-1848.84neuropeptide FF receptor 1 like 3 [Source:ZFIN;Acc... [more]
si:dkey-202l22.31.469e-1339.22prolactin releasing hormone receptor [Source:HGNC ... [more]
sstr1a1.918e-1336.36somatostatin receptor 1a [Source:ZFIN;Acc:ZDB-GENE... [more]
qrfpr42.865e-1341.86pyroglutamylated RFamide peptide receptor 4 [Sourc... [more]
kiss1rb3.096e-1234.00KISS1 receptor b [Source:ZFIN;Acc:ZDB-GENE-060526-... [more]
back to top
BLAST of NPYR-5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NPYR-5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO383421.190e-1335.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460302.825e-1339.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO455371.155e-1238.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO409442.259e-1240.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO300864.112e-1235.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of NPYR-5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npffr2b2.384e-1645.35neuropeptide FF receptor 2-like [Source:NCBI gene;... [more]
npffr2b2.940e-1645.35neuropeptide FF receptor 2-like [Source:NCBI gene;... [more]
ENSORLT00000042596.15.188e-1645.35neuropeptide FF receptor 2 [Source:NCBI gene;Acc:1... [more]
npy2r8.242e-1647.19neuropeptide Y receptor Y2 [Source:ZFIN;Acc:ZDB-GE... [more]
GPR833.878e-1438.89G protein-coupled receptor 83 [Source:NCBI gene;Ac... [more]
back to top
BLAST of NPYR-5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000004267.13.564e-10799.41SMESG000004267.1[more]
SMESG000062221.18.397e-3262.22SMESG000062221.1[more]
SMESG000053241.12.566e-3141.61SMESG000053241.1[more]
SMESG000078214.13.379e-2956.67SMESG000078214.1[more]
SMESG000052051.14.274e-2956.67SMESG000052051.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032025 ID=SMED30032025|Name=NPYR-5|organism=Schmidtea mediterranea sexual|type=transcript|length=1087bp
TCCAATTACCGTTTTAAATAAAACAATCTCATGATTGGCTGATAAATCGA
CCAATCATTTTAACAATATAAAACAAGTTTATCTGAAATCAAATTGAGAA
CTTCTTCTAATTTTCTTATGATGGAACAGTTCAATCAATCCTGTCATATT
TACTTTAAAAATTCAAATGAGATTCCCGTTAGAAGCATAGAAATGATGAT
CAACTATTACAAATATTGTGGACAATTCACCGACATTGAACGAGAAACAT
TTATCCAAGTCATAAAAGACAGCATACCAAAACCAAATAAATTGGAAAAA
TTAGAACTGGCCGGTCTGATAACAATTTTAACAATATTCATTCTCATGAT
CATTTTCGGTGTTTTTGGTAACGCACTTGTTGTATTTGCAGTTATGCGGT
ACCGGCAGTTACAAACTGCTCGAAATGTTTTCATTCTTAACTTAGCTATT
TCCGATTTATGTCTTTGCATATTTACTCAACCCTTTAATCTTTTGCGGCT
TCTAGTAAAATACCACCCATGGACATATGGAGATGTACTTTGCAAGATGT
CAGCTTTGCTTCAAGGAACAAATGTATTTGTCAGTACAATTACAATCACT
GCAATCGCGTTAGATAGATTCCAGATTTCTTATATTCTACTTGCACGATT
AGCACACTGGATAAAATGGCTCTGATTATTGATCATCGGAGAATATGAAT
AATGTTAAGGGATATTTACACATGCAACATCTACCAAATTCTAGCCTGTG
ACTTTGAGCAGTTTCTCTTGCGGTTTATTGATTGTGATGTCAAATTCAAA
GGGTGAAAATGGCAAACAAGAATGACTGGTGTAAATTTCACGCTACTACT
TTTCATAGTTTAATAGGAGCTTTTGTGATAGACAGATACATTTGTTGTAT
ATATATTAAAATTAAGCCTAATAAAAAAATTATGAAAAAAATGTTCATAC
GATTATTAAAAAATAAGGAAGATAACTAAGCAATGTCATGATCATTTTTA
TCCAGATTAATTTTTGAAAATTGTTAAATTTATTATTTTGGAAAAGCACA
AATTTTTGATATAGTCTTTATCACGTGTTGGTCAACT
back to top

protein sequence of SMED30032025-orf-1

>SMED30032025-orf-1 ID=SMED30032025-orf-1|Name=SMED30032025-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=186bp
MMEQFNQSCHIYFKNSNEIPVRSIEMMINYYKYCGQFTDIERETFIQVIK
DSIPKPNKLEKLELAGLITILTIFILMIIFGVFGNALVVFAVMRYRQLQT
ARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHPWTYGDVLCKMSALLQG
TNVFVSTITITAIALDRFQISYILLARLAHWIKWL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000028Category 2 cell
PLANA:0000099neuron
PLANA:0000208testis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007165signal transduction
GO:0007218neuropeptide signaling pathway
GO:0007268chemical synaptic transmission
GO:0007631feeding behavior
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0005886plasma membrane
GO:0016020membrane
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
GO:0004871signal transducer activity
GO:0004983neuropeptide Y receptor activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 149..171
score: 24.77
coord: 69..93
score: 27.05
coord: 102..123
score: 34.29
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 84..169
e-value: 4.1E-20
score: 72.2
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 41..178
e-value: 1.7E-33
score: 117.5
NoneNo IPR availablePANTHERPTHR24235FAMILY NOT NAMEDcoord: 2..170
NoneNo IPR availablePANTHERPTHR24235:SF7NEUROPEPTIDE F RECEPTORcoord: 2..170
NoneNo IPR availableCDDcd152037tmA_NPYR-likecoord: 68..169
e-value: 1.74967E-41
score: 139.277
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 68..169
NoneNo IPR availableTMHMMTMhelixcoord: 104..126
NoneNo IPR availableTMHMMTMhelixcoord: 70..92
NoneNo IPR availableTMHMMTMhelixcoord: 146..165
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 84..185
score: 18.345