SIAH-type domain-containing protein

Overview
NameSIAH-type domain-containing protein
Smed IDSMED30032005
Length (bp)3338
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SIAH-type domain-containing protein (SMED30032005) t-SNE clustered cells

Violin plots show distribution of expression levels for SIAH-type domain-containing protein (SMED30032005) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SIAH-type domain-containing protein (SMED30032005) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SIAH-type domain-containing protein (SMED30032005) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032005

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30032005SMESG000042443.1 Contig4940newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30032005SMESG000042443.1 Contig4940uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30032005SMESG000042091.1 Contig4940newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30032005SMESG000042091.1 Contig4940uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
headSMED30032005SMESG000042443.1 SmedASXL_016255SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30032005SMESG000042443.1 dd_Smed_v4_13836_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30032005SMESG000042443.1 dd_Smed_v4_13836_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30032005SMESG000042443.1 dd_Smed_v6_13836_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30032005SMESG000042443.1 dd_Smed_v4_13836_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30032005SMESG000042443.1 dd_Smed_v4_13836_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SIAH-type domain-containing protein vs. TrEMBL
Match: A0A2C9KBA7 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106055386 PE=4 SV=1)

HSP 1 Score: 343.584 bits (880), Expect = 3.341e-97
Identity = 333/1129 (29.50%), Postives = 530/1129 (46.94%), Query Frame = 1
Query:   22 MDNCYLEKLLAKPGKLFPKYNKNTFSYNIILGVSDSKTTLDFYTEESGASYQIFTEGGDGTKTINVEEGKCKTVKIEVTAEDGKTTKCYIIEIKRHSAKVAILESIKINCGILQPNFDSNVFEYFATVGLKVLNIDFILQIPDQKCITKINNEETKSSYSLTLGHSIFNLNVTSPDGSHNQTYKITIIRKLIPYFVFISDPQFRFSYEDPISLSPSFHPVKTNS-----MYSWDILSKCEVEQLINLK-------RNDFQVK-TEIDQIHEMSISNLDGQFLNPNLTLS----EPVKINNPGXXXXXXXXX-----XXXTISYSFYPFNDNINTTPEWQQILCISNCSDSDKTLFKKCEEAVKIYLQCRPQHPIFDVNQTINHEHPSKKLFNAISLAATAIIKQKSESKYHFMLAQLLEENYTNEDIFNLI-LHKIGASELDNKCSMKCTAGQDFKAVNSAKLDEILAICKLHGYVKNPTDTEQLMALDKEYHSLISQNQTGKADAIQNLYEWKSKQYSQEAAMSSQALNEETLFGQIFNXXXXXXXXXXXXXXXNFHVGRLLIIQGKYKEAIERLHTALNGKNNHLPSKLCLGLAMSFVPELTKDKITESIYLIYDSLAPGLRRIFDNSYETNTEDILKDKVFADEDVFFDIRNPLISKAVLQLGCLLMKKSQSKISVKPFLVIHWALHLATLGWSQVGNGNNLLQFEFVIIECHKQLL-LLIHEEIENASDAIYVNRCLWLMNFVRSSSIPLNRXXXXXXXXXSQVPLFFEPGNPHYLTCYGEIL---------SYKADQMMANDE-TFISTIELSIKILTFALDLKRNKKADEAVKFIKDQIWHKERHLLIFQLKPQQEKGKPLDKKGPDVNKPIPATATKTTNIKQPPNTQKKVVSQPPKKGPVKQSNVPSKNL----TAPKDKQIAAXXXXXXXXXXXXXXXXXXLKYERNLGNGTSLNP---YRIELALARACRINKQFAESVKYYKISGIEKHLNNINDMMQE----YVET--LISAENYETALEVYYKLNINDKNPSFDDGYICGEVVRLLMKLEKYQDKMLVKYASLWAXXXXXXXXXXXXXXLEDKSQTETCKEIYATVNGKKKDDPDLKMFFQSRCWI 3267
            MD+CYL KL  KP  L P +NK+   Y+  +     K T D  T + GAS+ I   G  G++ +++ EG    VKIEVT+EDG T K YI+ +KR SAK A L  + I  G L+P+F  NV  Y+  +   +  ++ +   PD +   K+ ++   +   L  G +I  + VTSPDG+  + YK+ + +K IP +V   D +    +E PISLSP + PV          YS  + S  E+ +L  +         +D++++  E+D+       N+  Q     LT S    +P+K      +L   S            S S    + N+    +WQ+ L           L    E ++ +Y +  P+   +   Q    + P   L +AI   ATA+  + + ++ HF LA  LEE Y  ED++ L  L K  A  L+            +KA  S+K +E+ AICKL G   +   +  L ALD EYH LI   Q+ KAD +  LY W SK+ SQE A + +  + ++  GQ + KYL AL LD+  ++YNFHVGRLL+I G Y++AI+RL  AL     H  ++  LGLA+S   E  K +  E+I  +   +   L  +   +     E + K  +FA+        N    + ++QLG +L+ K++ + S+ P  + H A  LA      +  G+   Q E+V+++ H QLL +L+ +++   S     +RC  L   +  S+I  N +LL+L E+  Q  +  +P   + L   G             Y A + +++ + +F+++IE+  K  +            EA K + DQ W   R      +K           K   V K + A     T +      + K  S   K+        P  ++    TA   K +         +K +    K     E  + +   LN    Y   L LAR  R +K+  E+ KYY         N + DM  E    Y+E   +++  N   A++VY +  +++ +P+FDD +I GE+V +LMK E+Y DK L      +AK+ G G++EK  KILE + + +  + IYA ++ K  DDPD++ FF+ + WI
Sbjct:    1 MDDCYLAKLSTKPWILTPHFNKDILEYSTTVPSQQEKITFDISTSDHGASFTIL--GSGGSRDVSLAEGTVTAVKIEVTSEDGHT-KYYIVNVKRLSAKDAYLSDLAIKKGHLEPDFYPNVLLYYCLLPCNLTTVNIVATAPDPRNAVKVCDK-ANAPVPLNPGLTIIEIEVTSPDGTIKKVYKVEVAKKPIPRYVKFVDAKTLSEFECPISLSPFYCPVSIKGSNPKRTYSGPVFS--EITRLSKIDPLTGEHLESDWKIQDIEVDK-------NMANQMAVIPLTFSVDSTKPMKFGELAGILAECSQQPPMKDLAGVFSNSALSISRNLQEH-KWQKALQQIFDETEVSVLLSLAENSLTLYYKNIPKPGQYH-QQYAEGDSPIDALQHAIHCLATALKYKSNNAEIHFKLAMALEEKYWAEDMYGLKKLEKSDAPSLN------------YKARESSKEEEVYAICKLKGVDISEPASHHLKALDNEYHHLIETGQSAKADHVMALYAWYSKKLSQEGASAHKVEDHDSPLGQAYQKYLDALCLDEVKAVYNFHVGRLLVIMGNYEDAIKRLEAALCWNAAHEQARFYLGLAISLSKEEWKKRSQEAIGFLQAGMESLLTALSKEALAAE-ELVAKTSLFAEN--LVRTSNVHFLRGIVQLG-ILLTKNKVQNSMAPSDIFHTAALLACQVLPNICRGDLYKQMEWVLVDAHSQLLEILVQDDV---SKDFIASRCKRLSALIFHSTISGNIKLLELQEKTCQKLVKIQPCVSYSLFLLGSAQFALYEQSPDGYTAMEYLSDAKASFLASIEMEGKPCS-----------GEAPKQLTDQKWWM-RSSSSSSIK---------SNKQTKVGKALTAPTRSGTQLASHKGDKSKTYSPSSKRPTAAAGTAPKSHVQTASTAATSKAVPKPLGPSTLQKKDVKTEKKTETKEVVIVDNVVLNNVPLYESRLGLARVLRASKEPNEAKKYY---------NQVIDMAPEVHDAYIECAEMLAKTNPIEAVDVYSRFPVSE-HPTFDDAFIFGEIVNILMKAEQYDDKRLATNMIAYAKVLGVGVLEKYTKILEQRYKNDVLRTIYAGIHNKPVDDPDMQAFFKFKFWI 1064          
BLAST of SIAH-type domain-containing protein vs. TrEMBL
Match: A0A2C9KBA9 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106055386 PE=4 SV=1)

HSP 1 Score: 338.961 bits (868), Expect = 1.275e-95
Identity = 333/1125 (29.60%), Postives = 534/1125 (47.47%), Query Frame = 1
Query:   22 MDNCYLEKLLAKPGKLFPKYNKNTFSYNIILGVSDSKTTLDFYTEESGASYQIFTEGGDGTKTINVEEGKCKTVKIEVTAEDGKTTKCYIIEIKRHSAKVAILESIKINCGILQPNFDSNVFEYFATVGLKVLNIDFILQIPDQKCITKINNEETKSSYSLTLGHSIFNLNVTSPDGSHNQTYKITIIRKLIPYFVFISDPQFRFSYEDPISLSPSFHPVKTNS-----MYSWDILSKCEVEQLINLK-------RNDFQVK-TEIDQIHEMSISNLDGQFLNPNLTLS----EPVKINNPGXXXXXXXXX-----XXXTISYSFYPFNDNINTTPEWQQILCISNCSDSDKTLFKKCEEAVKIYLQCRPQHPIFDVNQTINHEHPSKKLFNAISLAATAIIKQKSESKYHFMLAQLLEENYTNEDIFNLI-LHKIGASELDNKCSMKCTAGQDFKAVNSAKLDEILAICKLHGYVKNPTDTEQLMALDKEYHSLISQNQTGKADAIQNLYEWKSKQYSQEAAMSSQALNEETLFGQIFNXXXXXXXXXXXXXXXNFHVGRLLIIQGKYKEAIERLHTALNGKNNHLPSKLCLGLAMSFVPELTKDKITESIYLIYDSLAPGLRRIFDNSYETNTEDILKDKVFADEDVFFDIRNPLISKAVLQLGCLLMKKSQSKISVKPFLVIHWALHLATLGWSQVGNGNNLLQFEFVIIECHKQLL-LLIHEEIENASDAIYVNRCLWLMNFVRSSSIPLNRXXXXXXXXXSQVPLFFEPGNPHYLTCYGEIL---------SYKADQMMANDE-TFISTIELSIKILTFALDLKRNKKADEAVKFIKDQIWHKERHLLIFQLKPQQEKGKPLDKKGPDVNKPIPATATKTTNIKQPPNTQKKVVSQPPKKGPVKQSNVPSKNLTAPKDKQIAAXXXXXXXXXXXXXXXXXXLKYERNLGNGTSLNP---YRIELALARACRINKQFAESVKYYKISGIEKHLNNINDMMQE----YVET--LISAENYETALEVYYKLNINDKNPSFDDGYICGEVVRLLMKLEKYQDKMLVKYASLWAXXXXXXXXXXXXXXLEDKSQTETCKEIYATVNGKKKDDPDLKMFFQSRCWI 3267
            MD+CYL KL  KP  L P +NK+   Y+  +     K T D  T + GAS+ I   G  G++ +++ EG    VKIEVT+EDG T K YI+ +KR SAK A L  + I  G L+P+F  NV  Y+  +   +  ++ +   PD +   K+ ++   +   L  G +I  + VTSPDG+  + YK+ + +K IP +V   D +    +E PISLSP + PV          YS  + S  E+ +L  +         +D++++  E+D+       N+  Q     LT S    +P+K      +L   S            S S    + N+    +WQ+ L           L    E ++ +Y +  P+   +   Q    + P   L +AI   ATA+  + + ++ HF LA  LEE Y  ED++ L  L K  A  L+            +KA  S+K +E+ AICKL G   +   +  L ALD EYH LI   Q+ KAD +  LY W SK+ SQE A + +  + ++  GQ + KYL AL LD+  ++YNFHVGRLL+I G Y++AI+RL  AL     H  ++  LGLA+S   E  K +  E+I  +   +   L  +   +     E + K  +FA+        N    + ++QLG +L+ K++ + S+ P  + H A  LA      +  G+   Q E+V+++ H QLL +L+ +++   S     +RC  L   +  S+I  N +LL+L E+  Q  +  +P   + L   G             Y A + +++ + +F+++IE+  K  +            EA K + DQ W   R      +K  ++      K G  +  P   + T+  + K  P             G   +S+V + + TA   K +         +K +    K     E  + +   LN    Y   L LAR  R +K+  E+ KYY         N + DM  E    Y+E   +++  N   A++VY +  +++ +P+FDD +I GE+V +LMK E+Y DK L      +AK+ G G++EK  KILE + + +  + IYA ++ K  DDPD++ FF+ + WI
Sbjct:    1 MDDCYLAKLSTKPWILTPHFNKDILEYSTTVPSQQEKITFDISTSDHGASFTIL--GSGGSRDVSLAEGTVTAVKIEVTSEDGHT-KYYIVNVKRLSAKDAYLSDLAIKKGHLEPDFYPNVLLYYCLLPCNLTTVNIVATAPDPRNAVKVCDK-ANAPVPLNPGLTIIEIEVTSPDGTIKKVYKVEVAKKPIPRYVKFVDAKTLSEFECPISLSPFYCPVSIKGSNPKRTYSGPVFS--EITRLSKIDPLTGEHLESDWKIQDIEVDK-------NMANQMAVIPLTFSVDSTKPMKFGELAGILAECSQQPPMKDLAGVFSNSALSISRNLQEH-KWQKALQQIFDETEVSVLLSLAENSLTLYYKNIPKPGQYH-QQYAEGDSPIDALQHAIHCLATALKYKSNNAEIHFKLAMALEEKYWAEDMYGLKKLEKSDAPSLN------------YKARESSKEEEVYAICKLKGVDISEPASHHLKALDNEYHHLIETGQSAKADHVMALYAWYSKKLSQEGASAHKVEDHDSPLGQAYQKYLDALCLDEVKAVYNFHVGRLLVIMGNYEDAIKRLEAALCWNAAHEQARFYLGLAISLSKEEWKKRSQEAIGFLQAGMESLLTALSKEALAAE-ELVAKTSLFAEN--LVRTSNVHFLRGIVQLG-ILLTKNKVQNSMAPSDIFHTAALLACQVLPNICRGDLYKQMEWVLVDAHSQLLEILVQDDV---SKDFIASRCKRLSALIFHSTISGNIKLLELQEKTCQKLVKIQPCVSYSLFLLGSAQFALYEQSPDGYTAMEYLSDAKASFLASIEMEGKPCS-----------GEAPKQLTDQKWWM-RSSSSSSIKSNKQT-----KVGKALTAPT-RSGTQLASHKGGPTAA---------AGTAPKSHVQTAS-TAATSKAVPKPLGPSTLQKKDVKTEKKTETKEVVIVDNVVLNNVPLYESRLGLARVLRASKEPNEAKKYY---------NQVIDMAPEVHDAYIECAEMLAKTNPIEAVDVYSRFPVSE-HPTFDDAFIFGEIVNILMKAEQYDDKRLATNMIAYAKVLGVGVLEKYTKILEQRYKNDVLRTIYAGIHNKPVDDPDMQAFFKFKFWI 1053          
BLAST of SIAH-type domain-containing protein vs. TrEMBL
Match: V3Z9U8 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_234972 PE=4 SV=1)

HSP 1 Score: 306.605 bits (784), Expect = 7.570e-84
Identity = 260/842 (30.88%), Postives = 415/842 (49.29%), Query Frame = 1
Query:   22 MDNCYLEKLLAKPGKLFPKYNKNTFSYNIILGVSDSKTTLDFYTEESGASYQIFTEGGDGTKTINVEEGKCKTVKIEVTAEDGKTTKCYIIEIKRHSAKVAILESIKINCGILQPNFDSNVFEYFATVGLKVLNIDFILQIPDQKCITKINNEETKSSYSLTLGHSIFNLNVTSPDGSHNQTYKITIIRKLIPYFVFISDPQFRFSYEDPISLSPSFHPVKTNSMYSWDILSKCEVEQLINLKR---------------NDFQVKTEIDQIHEMSISNLDGQFLNPNLTLSEPVKINN-PGXXXXXXXXXXXXTISYSFYPFNDNINTT---PEWQQILCISNCSDSDKTLFKKCEEAVKIYLQCRPQHPIFDVNQTINHEHPSKKLFNAISLAATAIIKQKSESKYHFMLAQLLEENYTNEDIFNLILHKIGASELDNKCSMKCTAGQDFKAVNSAKLDEILAICKLHGYVKNPTDTEQLMALDKEYHSLISQNQTGKADAIQNLYEWKSKQYSQEAAMSSQALNEETLFGQIFNXXXXXXXXXXXXXXXNFHVGRLLIIQGKYKEAIERLHTALNGKNNHLPSKLCLGLAMSFVPELTKDKITESIYLIYDSLAPGLRRIFDNSYETNTED--ILKDKVFADEDVFFDIRNPLISKAVLQLGCLLMKKSQSKISVKPFLVIHWALHLATLGWSQVGNGNNLLQFEFVIIECHKQLLLLIHEEIENASDAIYVNRCLWLMNFVRSSSIPLNRXXXXXXXXXSQVPLFFEPGNPH--YLTCYGEILSYK-------ADQMMANDETFISTIELSIKILTFALDLKRNKKADEAVKFIKDQIW 2457
            MD+C L+KL  KPGKL  K++KN   YN +L     K  +D  T +SGASY++   GGD  K + + EG    +K+EVTAEDGKT K Y+I  KR SA+ A L S+K++ GIL P F S+   Y   +   V  ++    +PD K    INNE+      L +G +I N+ +TS DGS+ QTY + + RK +P FV +SDP+   +YE PISL+P + P+           +   + +L  + +                D+ V  ++  ++ + I  +DG F       SE VK     G L   +    +  +   F      +N T    +W++ L      +    L K  +E ++ Y    P+  ++   Q    E P   L  AI   ATA+  +  +   H  L  LLEE Y  ED     +H + A   D           + +A   +KL+E LAIC+L G       + +L A+D+EYH L+   Q+ +AD +  +Y W SK+ SQE   + +  +EE+  GQ + KYL ALSLD+  SLYNFHVGRLL++QG YKEAI+RL   +N    H  ++  LGLA++        +  E+I  + +++      + +NS    T+D  IL+ ++  +        N ++ + ++QLG LL+  +Q+  ++    V + A  LA+     +  G+   Q E+++++ H  LL L + +  NA++ + V  C  L   +   +IP N  L +L E   Q  +  +P N H  YL    ++  Y+       AD+++AN +   S+ + SI        L+   K+ +  + +K+Q W
Sbjct:    1 MDDCNLDKLSLKPGKLDKKFDKNVTEYNTVLTSEIEKVAIDALTSDSGASYRVL--GGDEKKQVTLPEGCVTDIKVEVTAEDGKTMKFYVIHAKRLSAQDASLSSLKLDRGILLPEFSSDNLSYSVLLACNVSVLNITTTVPDIKSTITINNEKPDIPVPLNIGLTIINIEITSVDGSNKQTYTLEVARKQVPRFVKLSDPKEALTYECPISLNPFYQPITIKDSDPKRTFTGPLINELTKISKYDPINGRPLPPEWRIQDYNVDKKLSSVN-VVIPCIDGSF-------SESVKFTEIGGLLEKCNISPKVENLQDKFKATTVTLNHTIQSRKWEKNLQQIYHENDVNELVKTGKEELEKYFDALPKPGLY--RQFEEGESPLDYLETAIQNYATAVKNKPKDPSLHLQLGLLLEEKYYVED-----MHGLKAETYD------ALPTANTEAKEGSKLEEALAICQLRGVDSTAPVSLKLKAIDEEYHHLLDSGQSHRADQVMGIYAWFSKKMSQEGMAAQKVTDEESPLGQAYLKYLDALSLDETKSLYNFHVGRLLVLQGDYKEAIKRLEVTINWNPQHQMARFYLGLALALQHGGPGSRSNEAISYLSEAME---TLLTENSKLAMTDDEPILRRELLCEN--LLRSNNVILLRGIIQLGQLLL-SNQNTSTISAEHVFYTASLLASQVLPTLSRGDLYKQIEWILLDSHSNLLEL-YTKSPNATETLIVLHCERLSGLIFHCTIPQNGPLQELQENTCQKLVKIQPCNSHALYLLGTAQMARYENSSAGEAADRLLANAK---SSFKASIA-------LEGQPKSGDVPELVKEQGW 802          

HSP 2 Score: 90.5077 bits (223), Expect = 2.015e-14
Identity = 60/155 (38.71%), Postives = 88/155 (56.77%), Query Frame = 1
Query: 2803 YRIELALARACRINKQFAESVKYYKISGIEKHLNNINDMMQEYVETLISAENYETALEVYYKLNINDKNPSFDDGYICGEVVRLLMKLEKYQDKMLVKYASLWAXXXXXXXXXXXXXXLEDKSQTETCKEIYATVNGKKKDDPDLKMFFQSRCWI 3267
            Y   L L RA + + +  E+ KYY+   +      ++D   E  E L   E    A++++ K  + + NPSFDD YI GE+VRLLMK EKY D  L      + ++ G   +EK +KILE+K ++E  K +YA VN K  DDPD++ FF+ + WI
Sbjct:  949 YLPRLGLGRAFKASNETEEAKKYYE--EVIAMAPEVHDAYIESAEMLTKTEPM-AAVDIFSKFPVPE-NPSFDDAYIFGEIVRLLMKNEKYDDPRLTTNLIAYGRVLGLAALEKNVKILEEKFKSEILKNVYAGVNHKSVDDPDMQQFFKFKLWI 1099          
BLAST of SIAH-type domain-containing protein vs. TrEMBL
Match: A0A433T776 (Uncharacterized protein (Fragment) OS=Elysia chlorotica OX=188477 GN=EGW08_014846 PE=4 SV=1)

HSP 1 Score: 297.36 bits (760), Expect = 3.210e-82
Identity = 245/754 (32.49%), Postives = 372/754 (49.34%), Query Frame = 1
Query:   22 MDNCYLEKLLAKPGKLFPKYNKNTFSYNIILGVSDSKTTLDFYTEESGASYQIFTEGGDGTKTINVEEGKCKTVKIEVTAEDGKTTKCYIIEIKRHSAKVAILESIKINCGILQPNFDSNVFEYFATVGLKVLNIDFILQIPDQKCITKINNEETKSSYSLTLGHSIFNLNVTSPDGSHNQTYKITIIRKLIPYFVFISDPQFRFSYEDPISLSPSFHPVKTNSM-----YSWDILSK----CEVEQLIN------LKRNDFQVKTEIDQIHEMSISNLDGQFLNPNLTLSEPVKINN-PGXXXXXXXXXXXXTISYSFYPFNDNINTTPE---WQQILCISNCSDSDKTLFKKCEEAVKIYLQCRPQHPIFDVNQTINHEHPSKKLFNAISLAATAIIKQKSESKYHFMLAQLLEENYTNEDIFNLILHKIGASELDNKCSMKCTAGQDFKAVNSAKLDEILAICKLHGYVKNPTDTEQLMALDKEYHSLISQNQTGKADAIQNLYEWKSKQYSQEAAMSSQALNEETLFGQIFNXXXXXXXXXXXXXXXNFHVGRLLIIQGKYKEAIERLHTALNGKNNHLPSKLCLGLAMSFVPELTKDKITESI-YLIYDSLAPGLRRIFDN-SYETNT--EDILKDKVFADEDVFFDIRNPLISKAVLQLGCLLMKKSQSKISVKPFLVIHWALHLATLGWSQVGNGNNLLQFEFVIIECHKQLLLLIHEEIENASDAIYVNRCLWLMNFVRSSSIPLN 2214
            MD+C L  L  K G L P +NK+   Y++ +     K TL+  T ++GAS+ I   G DG++ + ++EG    +KIEV++ED  T K Y + +KR SAK A+L  I I  G L+P+F+ + FEY+  +   V       + PD K +  +N  +  S   L  G S   + VTSPDG++ + Y I I RK IP +V  +D +    +E PISLSP + P+   S      YS  I+++     +V+ L         K  DFQ++  +     +      G         +EP K     G L   S  A    +S  F      +N T E   WQ+ L       S + L    +  ++ Y +  P+   F     I  E P  +L  AI   ATA+  +  ++  H  LA LLEE Y  ED+F L        E D   S+      + +A  S+K +E+ AICKL G   N   +  L ALD EYH L+   Q+GKAD +Q+LY W SK+ SQE A + +A + E+  GQ + KYL AL +D+  ++YNFHVGRLL++ G Y +AI+RL   L+    H  ++  LGLA+S   E  K +  E++ YL+      G+  +    S + N   E I K  +FA+        N  + + ++QLG LL   ++ K ++    V H A HL+T     V  G+   Q E+V+++ H QLL L+ +  +   + +  +RC  L   + +S+I  N
Sbjct:    1 MDDCNLSNLTIKSGTLAPTFNKDVTEYSVTVASHVEKITLNPTTSDNGASFSI--SGSDGSRDVPLKEGVITDIKIEVSSEDN-TLKRYFVHVKRLSAKDAVLADISIKSGHLEPDFNPSQFEYYCLLPCNVTEATLTPKAPDPKNVVTVNGGKPGSPLPLNTGLSEIKIEVTSPDGTNKKVYIIEIARKPIPRYVKFTDAKASLDFECPISLSPLYSPITVKSSNPRRSYSGPIINELTRTSKVDPLTGEPLPPGWKVQDFQLEKTLATQSSVIPLTYGGT--------TEPKKFGELAGHLAECSKPAPKEDLSGKFSSLT--LNRTLEDHKWQKSLQQIFDETSPEVLRNNSDSHLEAYYKKIPRPGQFHQQYNIG-ESPMDELQGAIHCMATALKFKPKDADTHLRLAMLLEEKYFAEDMFGL-----KKEEKDGGPSL------NLQAKESSKEEEVFAICKLKGVDPNSPVSHHLKALDSEYHHLLDNGQSGKADHVQSLYVWYSKKVSQEGAAAHKAEDNESPLGQAYQKYLDALCIDETKAVYNFHVGRLLVVMGNYDDAIKRLEATLSWNAQHEMARFYLGLAISLSKEECKKRGKEAVKYLL-----AGMELLLSELSIQANKAEEIIPKTSLFAEN--LVRASNVYLLRGIIQLGNLLT-CNEIKDAMSAMDVYHTAAHLSTQVLPTVCRGDVYKQIEWVLVDAHTQLLELLTK--QQGKEELIASRCQRLSALIFNSTISGN 719          
BLAST of SIAH-type domain-containing protein vs. TrEMBL
Match: K1PGC1 (Uncharacterized protein OS=Crassostrea gigas OX=29159 GN=CGI_10005707 PE=4 SV=1)

HSP 1 Score: 296.204 bits (757), Expect = 3.326e-80
Identity = 239/751 (31.82%), Postives = 379/751 (50.47%), Query Frame = 1
Query:   22 MDNCYLEKLLAKPGKLFPKYNKNTFSYNIILGVSDSKTTLDFYTEESGASYQIFTEGGDGTKTINVEEGKCKTVKIEVTAEDGKTTKCYIIEIKRHSAKVAILESIKINCGILQPNFDSNVFEYFATVGLKVLNIDFILQIPDQKCITKINNEETKSSYSLTLGHSIFNLNVTSPDGSHNQTYKITIIRKLIPYFVFISDPQFRFSYEDPISLSPSFHPVKTNSMYSWDILS---------KCEVEQL--INLKRNDFQVKTEIDQIHEMSISNL---DGQFLNPN--LTLSEPVKINNPGXXXXXXXXXXXXTISYSFYPFNDNINTTPEWQQILC-ISNCSDSDKTLFKKCEEAVKIYLQCRPQHPIFDVNQTINHEHPSKKLFNAISLAATAIIKQKSESKYHFMLAQLLEENYTNEDIFNLILHKIGASELDNKCSMKCTAGQDFKAVNSAKLDEILAICKLHGY-VKNPTDTEQLMALDKEYHSLISQNQTGKADAIQNLYEWKSKQYSQEAAMSSQALNEETLFGQIFNXXXXXXXXXXXXXXXNFHVGRLLIIQGKYKEAIERLHTALNGKNNHLPSKLCLGLAMSFVPELTKDKITESIYLIYDSLAPGLRRIFDNSYETNTEDILKD-KVFADEDVFFDIRNPLISKAVLQLGCLLMKKSQSKISVKPFLVIHWALHLATLGWSQVGNGNNLLQFEFVIIECHKQLL-LLIHEEIENASDAIYVNRCLWLMNFVRSSSIPLN 2214
            MD+C LEKL+ KPGKL P +NK    Y++ +     K  +D  T +SGASY IF  GGDG K + ++EG    +KIEVT+EDG T K Y I  KR SAK A L  ++ + G L P FD +V  Y   +   V  +      PD K +  +  E+  +  +L +G +  ++ VTS DGS+ +TY I +IRK IP FV ++D +    YE P +LS  + P+        +  S         K +++ L  + L ++   V  E+D+   ++++ +   +G+ L+P     L+  ++  N    +  +          +  P    +    +W++ L  + + +D DK L K  EE ++ Y    P+   F   Q  + E P   L NA    A AI  +  ++  H  L Q+LEE Y  ED+F L   + G S              +F+A  S+K +E  AICKL G    +     QL A+D+EYH L+   Q+GKAD +Q L+ WKSKQ SQE   + +A ++E+  GQ + KY+ AL+LD+  ++YNFHVGR+L+IQG + EA++RL   LN    H  S+  LGLA++        +  E+I  + +++   L     ++    T D  +D       D      N  + + ++ LG LL K +  K  + P  V H +  LA+     +  G+   Q E+V++E H  LL +L+ +  +NA  A+   RC  L   + +S++P++
Sbjct:    1 MDDCTLEKLVVKPGKLTPSFNKVHLEYDVTVPSDVEKIHIDPLTSDSGASYCIF--GGDGGKDVPLKEGAVTDIKIEVTSEDG-TIKHYFIHAKRLSAKDAFLNDLQFSVGNLNPAFDPDVLSYSCLLPCNVAQVVLKPVAPDTKNVVLVCGEKPGTPTALNVGETNVSVEVTSADGSNKKTYVIDVIRKQIPRFVKLTDEKLAKEYECPFTLSALYRPITIRGSNPKNTYSAPNIDEKTRKSKIDPLSGMPLGKDWRIVDYELDKKIAVAMATIPLTNGKSLDPAKFSELASQIESCN----IAPTVADVTDKFKNASAPLKHTVEVR-KWEKNLHQVFDETDVDK-LCKSGEEYLQKYFDSLPRSGQF--KQWPHGETPLDFLDNASHCFACAIKGKPKDAALHMKLGQVLEERYYAEDLFGLKKEEGGES----------LPSFNFEAKESSKEEECAAICKLRGVDAASAPIALQLKAIDEEYHHLVGSGQSGKADHVQGLFLWKSKQASQEGMAAQKAQDQESPLGQAYQKYMDALTLDEPKAIYNFHVGRMLVIQGNFDEAVKRLEVTLNWNPKHQFSRFYLGLALALQKNGPGPRAKETISYLLEAMETLLTL---HTKSAMTPDDPRDIPAILHSDNLLRSSNVHLLRGIVNLGKLLQKNTDVKDCMSPEHVFHTSALLASQVLPYISQGDAYKQLEWVLLESHSNLLDILLKDPAKNA--ALIEQRCQRLSALIMNSTLPMS 725          

HSP 2 Score: 106.686 bits (265), Expect = 1.871e-19
Identity = 68/160 (42.50%), Postives = 102/160 (63.75%), Query Frame = 1
Query: 2794 LNP--YRIELALARACRINKQFAESVKYYKISGIEKHLNNINDMMQEYVETLISAENYETALEVYYKLNINDKNPSFDDGYICGEVVRLLMKLEKYQDKMLVKYASLWAXXXXXXXXXXXXXXLEDKSQTETCKEIYATVNGKKKDDPDLKMFFQSRCWI 3267
            +NP  Y   L LARA R      +S K+Y  + +      ++D   E  E +++  + + A++VY K +I+D  P+FDDGYI GE+VRLLMK E Y+DK LVK   L+ K++G  ++EK +KILE+K + +  +E+YA VNGK  DD D++ FF+ +CWI
Sbjct:  959 INPKTYHARLGLARAYRAAGDIDQSKKFY--NEVMTMAPEVHDACIELAE-MLAKTDPKGAVDVYCKFHISDP-PTFDDGYILGEIVRLLMKAEDYEDKRLVKNMILYGKVYGLAVLEKYVKILEEKFKNKILQEVYAGVNGKSVDDADMQAFFKFKCWI 1114          
BLAST of SIAH-type domain-containing protein vs. Ensembl Nematostella
Match: EDO25403 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DWK7])

HSP 1 Score: 102.064 bits (253), Expect = 2.182e-25
Identity = 55/117 (47.01%), Postives = 71/117 (60.68%), Query Frame = 1
Query:   22 MDNCYLEKLLAKPGKLFPKYNKNTFSYNIILGVSDSKTTLDFYTEESGASYQIFTEGGDGTKTINVEEGKCKTVKIEVTAEDGKTTKCYIIEIKRHSAKVAILESIKINCGILQPNF 372
            MDN  LEKL   PGKL PK++ NT  Y + LG    +  +D  T +SGASY I   G  G KT++++EG+  T+KIEV+AEDG T K Y I   R SA  A L  +K++ G L P F
Sbjct:    1 MDNADLEKLAISPGKLSPKFHANTTEYQVTLGSEVGQLKVDPLTSDSGASYAI--SGSGGGKTVSLKEGEVTTIKIEVSAEDGSTIKNYYIYANRLSASDAFLSELKLSSGHLSPEF 115          
BLAST of SIAH-type domain-containing protein vs. Planmine SMEST
Match: SMESG000042443.1 (SMESG000042443.1)

HSP 1 Score: 2065.81 bits (5351), Expect = 0.000e+0
Identity = 1079/1082 (99.72%), Postives = 1080/1082 (99.82%), Query Frame = 1
Query:   22 MDNCYLEKLLAKPGKLFPKYNKNTFSYNIILGVSDSKTTLDFYTEESGASYQIFTEGGDGTKTINVEEGKCKTVKIEVTAEDGKTTKCYIIEIKRHSAKVAILESIKINCGILQPNFDSNVFEYFATVGLKVLNIDFILQIPDQKCITKINNEETKSSYSLTLGHSIFNLNVTSPDGSHNQTYKITIIRKLIPYFVFISDPQFRFSYEDPISLSPSFHPVKTNSMYSWDILSKCEVEQLINLKRNDFQVKTEIDQIHEMSISNLDGQFLNPNLTLSEPVKINNPGXXXXXXXXXXXXTISYSFYPFNDNINTTPEWQQILCISNCSDSDKTLFKKCEEAVKIYLQCRPQHPIFDVNQTINHEHPSKKLFNAISLAATAIIKQKSESKYHFMLAQLLEENYTNEDIFNLILHKIGASELDNKCSMKCTAGQDFKAVNSAKLDEILAICKLHGYVKNPTDTEQLMALDKEYHSLISQNQTGKADAIQNLYEWKSKQYSQEAAMSSQALNEETLFGQIFNXXXXXXXXXXXXXXXNFHVGRLLIIQGKYKEAIERLHTALNGKNNHLPSKLCLGLAMSFVPELTKDKITESIYLIYDSLAPGLRRIFDNSYETNTEDILKDKVFADEDVFFDIRNPLISKAVLQLGCLLMKKSQSKISVKPFLVIHWALHLATLGWSQVGNGNNLLQFEFVIIECHKQLLLLIHEEIENASDAIYVNRCLWLMNFVRSSSIPLNRXXXXXXXXXSQVPLFFEPGNPHYLTCYGEILSYKADQMMANDETFISTIELSIKILTFALDLKRNKKADEAVKFIKDQIWHKERHLLIFQLKPQQEKGKPLDKKGPDVNKPIPATATKTTNIKQPPNTQKKVVSQPPKKGPVKQSNVPSKNLTAPKDKQIAAXXXXXXXXXXXXXXXXXXLKYERNLGNGTSLNPYRIELALARACRINKQFAESVKYYKISGIEKHLNNINDMMQEYVETLISAENYETALEVYYKLNINDKNPSFDDGYICGEVVRLLMKLEKYQDKMLVKYASLWAXXXXXXXXXXXXXXLEDKSQTETCKEIYATVNGKKKDDPDLKMFFQSRCWI 3267
            MDNC LEKLLAKPGKLFPKYNKNTFSYNIILGVSDSKTTLDFYTEESGASYQIFTEGGDGTKTINVEEGKCKTVKIEVTAEDGKTTKCYIIEIKRHSAKVAILESIKINCGILQPNFDSNVFEYFATVGLKVLNIDFILQIPDQKCITKINNEE KSSYSLTLGHSIFNLNVTSPDGSHNQTYKITIIRKLIPYFVFISDPQFRFSYEDPISLSPSFHPV+TNSMYSWDILSKCEVEQLINLKRNDFQVKTEIDQIHEMSISNLDGQFLNPNLTLSEPVKINNPGSLLLNSSDANLSTISYSFYPFNDNINTTPEWQQILCISNCSDSDKTLFKKCEEAVKIYLQCRPQHPIFDVNQTINHEHPSKKLFNAISLAATAIIKQKSESKYHFMLAQLLEENYTNEDIFNLILHKIGASELDNKCSMKCTAGQDFKAVNSAKLDEILAICKLHGYVKNPTDTEQLMALDKEYHSLISQNQTGKADAIQNLYEWKSKQYSQEAAMSSQALNEETLFGQIFNKYLAALSLDKKSSLYNFHVGRLLIIQGKYKEAIERLHTALNGKNNHLPSKLCLGLAMSFVPELTKDKITESIYLIYDSLAPGLRRIFDNSYETNTEDILKDKVFADEDVFFDIRNPLISKAVLQLGCLLMKKSQSKISVKPFLVIHWALHLATLGWSQVGNGNNLLQFEFVIIECHKQLLLLIHEEIENASDAIYVNRCLWLMNFVRSSSIPLNRELLKLLEELSQVPLFFEPGNPHYLTCYGEILSYKADQMMANDETFISTIELSIKILTFALDLKRNKKADEAVKFIKDQIWHKERHLLIFQLKPQQEKGKPLDKKGPDVNKPIPATATKTTNIKQPPNTQKKVVSQPPKKGPVKQSNVPSKNLTAPKDKQIAAVESKEESEKSNDNVNKSVLKYERNLGNGTSLNPYRIELALARACRINKQFAESVKYYKISGIEKHLNNINDMMQEYVETLISAENYETALEVYYKLNINDKNPSFDDGYICGEVVRLLMKLEKYQDKMLVKYASLWAKIFGFGIIEKEIKILEDKSQTETCKEIYATVNGKKKDDPDLKMFFQSRCWI
Sbjct:    1 MDNCSLEKLLAKPGKLFPKYNKNTFSYNIILGVSDSKTTLDFYTEESGASYQIFTEGGDGTKTINVEEGKCKTVKIEVTAEDGKTTKCYIIEIKRHSAKVAILESIKINCGILQPNFDSNVFEYFATVGLKVLNIDFILQIPDQKCITKINNEEIKSSYSLTLGHSIFNLNVTSPDGSHNQTYKITIIRKLIPYFVFISDPQFRFSYEDPISLSPSFHPVRTNSMYSWDILSKCEVEQLINLKRNDFQVKTEIDQIHEMSISNLDGQFLNPNLTLSEPVKINNPGSLLLNSSDANLSTISYSFYPFNDNINTTPEWQQILCISNCSDSDKTLFKKCEEAVKIYLQCRPQHPIFDVNQTINHEHPSKKLFNAISLAATAIIKQKSESKYHFMLAQLLEENYTNEDIFNLILHKIGASELDNKCSMKCTAGQDFKAVNSAKLDEILAICKLHGYVKNPTDTEQLMALDKEYHSLISQNQTGKADAIQNLYEWKSKQYSQEAAMSSQALNEETLFGQIFNKYLAALSLDKKSSLYNFHVGRLLIIQGKYKEAIERLHTALNGKNNHLPSKLCLGLAMSFVPELTKDKITESIYLIYDSLAPGLRRIFDNSYETNTEDILKDKVFADEDVFFDIRNPLISKAVLQLGCLLMKKSQSKISVKPFLVIHWALHLATLGWSQVGNGNNLLQFEFVIIECHKQLLLLIHEEIENASDAIYVNRCLWLMNFVRSSSIPLNRELLKLLEELSQVPLFFEPGNPHYLTCYGEILSYKADQMMANDETFISTIELSIKILTFALDLKRNKKADEAVKFIKDQIWHKERHLLIFQLKPQQEKGKPLDKKGPDVNKPIPATATKTTNIKQPPNTQKKVVSQPPKKGPVKQSNVPSKNLTAPKDKQIAAVESKEESEKSNDNVNKSVLKYERNLGNGTSLNPYRIELALARACRINKQFAESVKYYKISGIEKHLNNINDMMQEYVETLISAENYETALEVYYKLNINDKNPSFDDGYICGEVVRLLMKLEKYQDKMLVKYASLWAKIFGFGIIEKEIKILEDKSQTETCKEIYATVNGKKKDDPDLKMFFQSRCWI 1082          
BLAST of SIAH-type domain-containing protein vs. Planmine SMEST
Match: SMESG000042443.1 (SMESG000042443.1)

HSP 1 Score: 2060.8 bits (5338), Expect = 0.000e+0
Identity = 1079/1084 (99.54%), Postives = 1080/1084 (99.63%), Query Frame = 1
Query:   22 MDNCYLEKLLAKPGKLFPKYNKNTFSYNIILGVSDSKTTLDFYTEESGASYQIFTEGGDGTKTINVEEGKCKTVKIEVTAEDGKTTKCYIIEIKRHSAKVAILESIKINCGILQPNFDSNVFEYFATVGLKVLNIDFILQIPDQKCITKINNEETKSSYSLTLGHSIFNLNVTSPDGSHNQTYKITIIRKLIPYFVFISDPQFRFSYEDPISLSPSFHPVKTNSMYSWDILSKCEVEQLINLKRNDFQVKTEIDQIHEMSISNLDGQFLNPNLTLSEPVKINNPGXXXXXXXXXXXXTISYSFYPFNDNINTTPEWQQILCISNCSDSDKTLFKKCEEAVKIYLQCRPQHPIFDVNQTINHEHPSKKLFNAISLAATAIIKQKSESKYHFMLAQLLEENYTNEDIFNLILHKIGASELDNKCSMKCTAGQDFKAVNSAKLDEILAICKLHGYVKNPTDTEQLMALDKEYHSLISQNQTGKADAIQNLYEWKSKQYSQEAAMSSQALNEETLFGQIFNXXXXXXXXXXXXXXXNFHVGRLLIIQGKYKEAIERLHTALNGKNNHLPSKLCLGLAMSFVPELTKDKITESIYLIYDSLAPGLRRIFDNSYETNTEDILKDKVFADEDVFFDIRNPLISKAVLQLGCLLMKKSQSKISVKPFLVIHWALHLATLGWSQVGNGNNLLQFEFVIIECHKQLLLLIHEEIENASDAIYVNRCLWLMNFVRSSSIPLNRXXXXXXXXXSQVPLFFEPGNPHYLTCYGEILSYKADQMMANDETFISTIELSIKILTFALDLKRNKKADEAVKFIKDQIWHKERHLLIFQLKPQQEKGKPLDKKGPDVNKPIPATATKTTNIKQPPNTQKKVVSQPPKKGPVKQSNVPSKNLTAPKDKQ--IAAXXXXXXXXXXXXXXXXXXLKYERNLGNGTSLNPYRIELALARACRINKQFAESVKYYKISGIEKHLNNINDMMQEYVETLISAENYETALEVYYKLNINDKNPSFDDGYICGEVVRLLMKLEKYQDKMLVKYASLWAXXXXXXXXXXXXXXLEDKSQTETCKEIYATVNGKKKDDPDLKMFFQSRCWI 3267
            MDNC LEKLLAKPGKLFPKYNKNTFSYNIILGVSDSKTTLDFYTEESGASYQIFTEGGDGTKTINVEEGKCKTVKIEVTAEDGKTTKCYIIEIKRHSAKVAILESIKINCGILQPNFDSNVFEYFATVGLKVLNIDFILQIPDQKCITKINNEE KSSYSLTLGHSIFNLNVTSPDGSHNQTYKITIIRKLIPYFVFISDPQFRFSYEDPISLSPSFHPV+TNSMYSWDILSKCEVEQLINLKRNDFQVKTEIDQIHEMSISNLDGQFLNPNLTLSEPVKINNPGSLLLNSSDANLSTISYSFYPFNDNINTTPEWQQILCISNCSDSDKTLFKKCEEAVKIYLQCRPQHPIFDVNQTINHEHPSKKLFNAISLAATAIIKQKSESKYHFMLAQLLEENYTNEDIFNLILHKIGASELDNKCSMKCTAGQDFKAVNSAKLDEILAICKLHGYVKNPTDTEQLMALDKEYHSLISQNQTGKADAIQNLYEWKSKQYSQEAAMSSQALNEETLFGQIFNKYLAALSLDKKSSLYNFHVGRLLIIQGKYKEAIERLHTALNGKNNHLPSKLCLGLAMSFVPELTKDKITESIYLIYDSLAPGLRRIFDNSYETNTEDILKDKVFADEDVFFDIRNPLISKAVLQLGCLLMKKSQSKISVKPFLVIHWALHLATLGWSQVGNGNNLLQFEFVIIECHKQLLLLIHEEIENASDAIYVNRCLWLMNFVRSSSIPLNRELLKLLEELSQVPLFFEPGNPHYLTCYGEILSYKADQMMANDETFISTIELSIKILTFALDLKRNKKADEAVKFIKDQIWHKERHLLIFQLKPQQEKGKPLDKKGPDVNKPIPATATKTTNIKQPPNTQKKVVSQPPKKGPVKQSNVPSKNLTAPKDKQ  IAAVESKEESEKSNDNVNKSVLKYERNLGNGTSLNPYRIELALARACRINKQFAESVKYYKISGIEKHLNNINDMMQEYVETLISAENYETALEVYYKLNINDKNPSFDDGYICGEVVRLLMKLEKYQDKMLVKYASLWAKIFGFGIIEKEIKILEDKSQTETCKEIYATVNGKKKDDPDLKMFFQSRCWI
Sbjct:    1 MDNCSLEKLLAKPGKLFPKYNKNTFSYNIILGVSDSKTTLDFYTEESGASYQIFTEGGDGTKTINVEEGKCKTVKIEVTAEDGKTTKCYIIEIKRHSAKVAILESIKINCGILQPNFDSNVFEYFATVGLKVLNIDFILQIPDQKCITKINNEEIKSSYSLTLGHSIFNLNVTSPDGSHNQTYKITIIRKLIPYFVFISDPQFRFSYEDPISLSPSFHPVRTNSMYSWDILSKCEVEQLINLKRNDFQVKTEIDQIHEMSISNLDGQFLNPNLTLSEPVKINNPGSLLLNSSDANLSTISYSFYPFNDNINTTPEWQQILCISNCSDSDKTLFKKCEEAVKIYLQCRPQHPIFDVNQTINHEHPSKKLFNAISLAATAIIKQKSESKYHFMLAQLLEENYTNEDIFNLILHKIGASELDNKCSMKCTAGQDFKAVNSAKLDEILAICKLHGYVKNPTDTEQLMALDKEYHSLISQNQTGKADAIQNLYEWKSKQYSQEAAMSSQALNEETLFGQIFNKYLAALSLDKKSSLYNFHVGRLLIIQGKYKEAIERLHTALNGKNNHLPSKLCLGLAMSFVPELTKDKITESIYLIYDSLAPGLRRIFDNSYETNTEDILKDKVFADEDVFFDIRNPLISKAVLQLGCLLMKKSQSKISVKPFLVIHWALHLATLGWSQVGNGNNLLQFEFVIIECHKQLLLLIHEEIENASDAIYVNRCLWLMNFVRSSSIPLNRELLKLLEELSQVPLFFEPGNPHYLTCYGEILSYKADQMMANDETFISTIELSIKILTFALDLKRNKKADEAVKFIKDQIWHKERHLLIFQLKPQQEKGKPLDKKGPDVNKPIPATATKTTNIKQPPNTQKKVVSQPPKKGPVKQSNVPSKNLTAPKDKQIVIAAVESKEESEKSNDNVNKSVLKYERNLGNGTSLNPYRIELALARACRINKQFAESVKYYKISGIEKHLNNINDMMQEYVETLISAENYETALEVYYKLNINDKNPSFDDGYICGEVVRLLMKLEKYQDKMLVKYASLWAKIFGFGIIEKEIKILEDKSQTETCKEIYATVNGKKKDDPDLKMFFQSRCWI 1084          
BLAST of SIAH-type domain-containing protein vs. Planmine SMEST
Match: SMESG000053995.1 (SMESG000053995.1)

HSP 1 Score: 316.62 bits (810), Expect = 5.108e-91
Identity = 249/826 (30.15%), Postives = 376/826 (45.52%), Query Frame = 1
Query:   31 CYLEKLLAKPGKLFPKYNKNTFSYNIILGVSDSKTTLDFYTEESGASYQIFTEGGDGTKTINVEEGKCKTVKIEVTAEDGKTTKCYIIEIKRHSAKVAILESIKINCGILQPNFDSNVFEYFATVGLKVLNIDFILQIPDQKCITKINNEETKSSYSLTLGHSIFNLNVTSPDGSHNQTYKITIIRKLIPYFVFISDPQFRFSYEDPISLSPSFHPVKTNSMYSWDILSK---CEVEQL---------INLKRNDFQVKTEID-QIHEM--SISNLDGQFLNPNLTLSEPVKINNPGXXXXXXXXXXXXTISYSFYPFNDNINTTPEWQQILCISNCSDSDKTLFKKCEEAVKIYLQCRPQHPIFDVNQTINHEHPSKKLFNAISLAATAIIKQKSESKYHFMLAQLLEENYTNEDIFNLILHKIGASELDNKCSMKCTAGQDFKAVNSAKLDEILAICKLHGYVKNPTDTEQLMALDKEYHSLISQNQTGKADAIQNLYEWKSKQYSQEAAMSSQALNEETLFGQIFNXXXXXXXXXXXXXXXNFHVGRLLIIQGKYKEAIERLHTALNGKNNHLPSKLCLGLAMSFVPELTKDKITESIYLIYDSLAPGLRRIFDNSYETNTEDILKDKVFADEDVFFDIRNPLISKAVLQLGCLLMKKSQSKISVKPFLVIHWALHLATLGWSQVGNGNNLLQFEFVIIECHKQLLLLIHEEIENASDAIYVNRCLWLMNFVRSSSIPLNRXXXXXXXXXSQVPLFFEPGNPHYLTCYGEILSYKADQMMANDETFISTIELSIKILTFALDLKRNKKADEAVKFIKDQIWHK 2463
            CYLE L  KPG L P ++K    Y +IL   +  T L+   EE   +Y+IF    +    I V EG          A   +  K                         L P F S  + Y   V   V +I    Q+PD KC   +N EE    Y L LG + F + V SPD +H + Y I + RK IP ++ ISD   R  +EDPISLSP + P++      W+++S     +++QL         +  K    +   E+D ++ ++  +I    G F N N  LS    I N            +   S     F +     P W++  C +     ++ L +  +E +  Y    P  P+ +        +P  KL   I      +      S  HF LA+LLEE +  +D  N+   K G   L+N+     T+G   K       D I +IC   G+ ++P+  +QL AL  E+  LI+     +AD I N+YEWK K+ S+E  ++    +     GQ   KY  AL LD  S + NF VGR+LI +GKY EAI RL  AL+  + H PSK  LGLA S + +LT  K  +++ L+ D +   L     N+   +       K+F  ++ FF + NPLI +    L  +L+++  +   +KP  V H AL  AT+GW+ V  G  + QFE VII CH +LL ++++E+      + V RC WL  F+ S+ +PL+  LL++ E++ Q  ++ EP    Y+   G +L  KA+        F   I  +I+ L  A+D+         V +  D  W K
Sbjct:    7 CYLEYLFTKPGTLVPSFDKELLEYTLILNADEPTTVLEIELEEPNDTYKIFVNNEESNNIIEVNEG----------ANKQRFWK-------------------------LMPAFKSQSYHYTCQVPANVSSIKLFFQVPDSKCTVNVNQEEPMPVYELNLGCTSFKIKVISPDENHFKKYLIDVYRKEIPRYILISDRIKRIRFEDPISLSPLYCPMRIREYNIWNMISTPTCMKIKQLDRIGHGKSVLEHKSYSMKFDREVDKRLSDLLGTIPLTYGGFSNEN-RLSHLGNILNKCKEPSPFKPWKIHKRSV----FPEKFELNPLWEEQYCSNTPEAEERDLKEVLDETMVEYFFYLPSSPVTNSFIFSMETNPIIKLQIMIERHVKELKIHSHSSDLHFTLAKLLEEKFMIQDTLNI---KSGLFPLENEDE---TSGFPLK-----HHDRINSICLKWGFKEHPSIGQQLQALKDEHRVLIANENFNEADEILNIYEWKYKEISEEGKLAMLISDTNNPLGQAAYKYGTALYLDLNSYVKNFQVGRMLIFEGKYGEAIIRLEHALSINSVHQPSKFLLGLAQSHLRKLTDQKFEKTLELLLDGMEIALSHFSGNATMASESRKGMKKLFGSDENFFRLENPLICRGFFALAEMLVRRELNAF-IKPVHVFHTALLAATMGWANVSPGYVMSQFEHVIINCHDELLRILNDELREIPTEVSVRRCEWLNAFISSTCLPLSERLLEIQEKVCQQLVYHEPCCEFYILNLGMVLMKKAELYPPKSSQFTEYIVNAIRTLRIAVDMNNQPIMGPPVPYFNDAAWFK 780          

HSP 2 Score: 54.6842 bits (130), Expect = 4.661e-7
Identity = 36/114 (31.58%), Postives = 64/114 (56.14%), Query Frame = 1
Query: 2785 GTSLNPYRI--ELALARACRINKQFAESVKYY----KISGIEKHLNNINDMMQEYVETLISAENYETALEVYYKLNINDKNPSFDDGYICGEVVRLLMKLEKYQDKMLVKYASL 3108
            G  LNP  +   L LARA ++N+Q+ E +K Y    KI  +      IN+   E ++ L+  ENYE AL++  K  IN+   +  D  +C +++++L+K+   +D+ + +Y+ L
Sbjct:  934 GVPLNPQTVYSRLMLARAYKLNEQYFECIKCYNYVRKIINVPSMKALINN---ELLDVLVKTENYEQALDLISKTVINETKLTQGDLIMCKKILQVLIKMNLIEDERIWRYSVL 1044          
BLAST of SIAH-type domain-containing protein vs. Planmine SMEST
Match: SMESG000053995.1 (SMESG000053995.1)

HSP 1 Score: 301.597 bits (771), Expect = 4.661e-86
Identity = 230/737 (31.21%), Postives = 353/737 (47.90%), Query Frame = 1
Query:  298 IKRHSAKVAILESIKINCGILQPNFDSNVFEYFATVGLKVLNIDFILQIPDQKCITKINNEETKSSYSLTLGHSIFNLNVTSPDGSHNQTYKITIIRKLIPYFVFISDPQFRFSYEDPISLSPSFHPVKTNSMYSWDILSK---CEVEQL---------INLKRNDFQVKTEID-QIHEM--SISNLDGQFLNPNLTLSEPVKINNPGXXXXXXXXXXXXTISYSFYPFNDNINTTPEWQQILCISNCSDSDKTLFKKCEEAVKIYLQCRPQHPIFDVNQTINHEHPSKKLFNAISLAATAIIKQKSESKYHFMLAQLLEENYTNEDIFNLILHKIGASELDNKCSMKCTAGQDFKAVNSAKLDEILAICKLHGYVKNPTDTEQLMALDKEYHSLISQNQTGKADAIQNLYEWKSKQYSQEAAMSSQALNEETLFGQIFNXXXXXXXXXXXXXXXNFHVGRLLIIQGKYKEAIERLHTALNGKNNHLPSKLCLGLAMSFVPELTKDKITESIYLIYDSLAPGLRRIFDNSYETNTEDILKDKVFADEDVFFDIRNPLISKAVLQLGCLLMKKSQSKISVKPFLVIHWALHLATLGWSQVGNGNNLLQFEFVIIECHKQLLLLIHEEIENASDAIYVNRCLWLMNFVRSSSIPLNRXXXXXXXXXSQVPLFFEPGNPHYLTCYGEILSYKADQMMANDETFISTIELSIKILTFALDLKRNKKADEAVKFIKDQIWHK 2463
            + R S+KVA LE + ++ G L P F S  + Y   V   V +I    Q+PD KC   +N EE    Y L LG + F + V SPD +H + Y I + RK IP ++ ISD   R  +EDPISLSP + P++      W+++S     +++QL         +  K    +   E+D ++ ++  +I    G F N N  LS    I N            +   S     F +     P W++  C +     ++ L +  +E +  Y    P  P+ +        +P  KL   I      +      S  HF LA+LLEE +  +D  N+   K G   L+N+     T+G   K       D I +IC   G+ ++P+  +QL AL  E+  LI+     +AD I N+YEWK K+ S+E  ++    +     GQ   KY  AL LD  S + NF VGR+LI +GKY EAI RL  AL+  + H PSK  LGLA S + +LT  K  +++ L+ D +   L     N+   +       K+F  ++ FF + NPLI +    L  +L+++  +   +KP  V H AL  AT+GW+ V  G  + QFE VII CH +LL ++++E+      + V RC WL  F+ S+ +PL+  LL++ E++ Q  ++ EP    Y+   G +L  KA+        F   I  +I+ L  A+D+         V +  D  W K
Sbjct:   10 VTRLSSKVAFLEDLNVHPGKLMPAFKSQSYHYTCQVPANVSSIKLFFQVPDSKCTVNVNQEEPMPVYELNLGCTSFKIKVISPDENHFKKYLIDVYRKEIPRYILISDRIKRIRFEDPISLSPLYCPMRIREYNIWNMISTPTCMKIKQLDRIGHGKSVLEHKSYSMKFDREVDKRLSDLLGTIPLTYGGFSNEN-RLSHLGNILNKCKEPSPFKPWKIHKRSV----FPEKFELNPLWEEQYCSNTPEAEERDLKEVLDETMVEYFFYLPSSPVTNSFIFSMETNPIIKLQIMIERHVKELKIHSHSSDLHFTLAKLLEEKFMIQDTLNI---KSGLFPLENEDE---TSGFPLK-----HHDRINSICLKWGFKEHPSIGQQLQALKDEHRVLIANENFNEADEILNIYEWKYKEISEEGKLAMLISDTNNPLGQAAYKYGTALYLDLNSYVKNFQVGRMLIFEGKYGEAIIRLEHALSINSVHQPSKFLLGLAQSHLRKLTDQKFEKTLELLLDGMEIALSHFSGNATMASESRKGMKKLFGSDENFFRLENPLICRGFFALAEMLVRRELNAF-IKPVHVFHTALLAATMGWANVSPGYVMSQFEHVIINCHDELLRILNDELREIPTEVSVRRCEWLNAFISSTCLPLSERLLEIQEKVCQQLVYHEPCCEFYILNLGMVLMKKAELYPPKSSQFTEYIVNAIRTLRIAVDMNNQPIMGPPVPYFNDAAWFK 729          

HSP 2 Score: 55.0694 bits (131), Expect = 3.663e-7
Identity = 36/114 (31.58%), Postives = 64/114 (56.14%), Query Frame = 1
Query: 2785 GTSLNPYRI--ELALARACRINKQFAESVKYY----KISGIEKHLNNINDMMQEYVETLISAENYETALEVYYKLNINDKNPSFDDGYICGEVVRLLMKLEKYQDKMLVKYASL 3108
            G  LNP  +   L LARA ++N+Q+ E +K Y    KI  +      IN+   E ++ L+  ENYE AL++  K  IN+   +  D  +C +++++L+K+   +D+ + +Y+ L
Sbjct:  883 GVPLNPQTVYSRLMLARAYKLNEQYFECIKCYNYVRKIINVPSMKALINN---ELLDVLVKTENYEQALDLISKTVINETKLTQGDLIMCKKILQVLIKMNLIEDERIWRYSVL 993          
BLAST of SIAH-type domain-containing protein vs. Planmine SMEST
Match: SMESG000053995.1 (SMESG000053995.1)

HSP 1 Score: 282.337 bits (721), Expect = 1.791e-79
Identity = 209/654 (31.96%), Postives = 318/654 (48.62%), Query Frame = 1
Query:  298 IKRHSAKVAILESIKINCGILQPNFDSNVFEYFATVGLKVLNIDFILQIPDQKCITKINNEETKSSYSLTLGHSIFNLNVTSPDGSHNQTYKITIIRKLIPYFVFISDPQFRFSYEDPISLSPSFHPVKTNSMYSWDILSK---CEVEQL---------INLKRNDFQVKTEID-QIHEM--SISNLDGQFLNPNLTLSEPVKINNPGXXXXXXXXXXXXTISYSFYPFNDNINTTPEWQQILCISNCSDSDKTLFKKCEEAVKIYLQCRPQHPIFDVNQTINHEHPSKKLFNAISLAATAIIKQKSESKYHFMLAQLLEENYTNEDIFNLILHKIGASELDNKCSMKCTAGQDFKAVNSAKLDEILAICKLHGYVKNPTDTEQLMALDKEYHSLISQNQTGKADAIQNLYEWKSKQYSQEAAMSSQALNEETLFGQIFNXXXXXXXXXXXXXXXNFHVGRLLIIQGKYKEAIERLHTALNGKNNHLPSKLCLGLAMSFVPELTKDKITESIYLIYDSLAPGLRRIFDNSYETNTEDILKDKVFADEDVFFDIRNPLISKAVLQLGCLLMKKSQSKISVKPFLVIHWALHLATLGWSQVGNGNNLLQFEFVIIECHKQLLLLIHEEIENASDAIYVNRCLWLMNFVRSSSIPLN 2214
            + R S+KVA LE + ++ G L P F S  + Y   V   V +I    Q+PD KC   +N EE    Y L LG + F + V SPD +H + Y I + RK IP ++ ISD   R  +EDPISLSP + P++      W+++S     +++QL         +  K    +   E+D ++ ++  +I    G F N N  LS    I N            +   S     F +     P W++  C +     ++ L +  +E +  Y    P  P+ +        +P  KL   I      +      S  HF LA+LLEE +  +D  N+   K G   L+N+     T+G   K       D I +IC   G+ ++P+  +QL AL  E+  LI+     +AD I N+YEWK K+ S+E  ++    +     GQ   KY  AL LD  S + NF VGR+LI +GKY EAI RL  AL+  + H PSK  LGLA S + +LT  K  +++ L+ D +   L     N+   +       K+F  ++ FF + NPLI +    L  +L+++  +   +KP  V H AL  AT+GW+ V  G  + QFE VII CH +LL ++++E+      + V RC WL  F+ S+ +PL+
Sbjct:   10 VTRLSSKVAFLEDLNVHPGKLMPAFKSQSYHYTCQVPANVSSIKLFFQVPDSKCTVNVNQEEPMPVYELNLGCTSFKIKVISPDENHFKKYLIDVYRKEIPRYILISDRIKRIRFEDPISLSPLYCPMRIREYNIWNMISTPTCMKIKQLDRIGHGKSVLEHKSYSMKFDREVDKRLSDLLGTIPLTYGGFSNEN-RLSHLGNILNKCKEPSPFKPWKIHKRSV----FPEKFELNPLWEEQYCSNTPEAEERDLKEVLDETMVEYFFYLPSSPVTNSFIFSMETNPIIKLQIMIERHVKELKIHSHSSDLHFTLAKLLEEKFMIQDTLNI---KSGLFPLENEDE---TSGFPLK-----HHDRINSICLKWGFKEHPSIGQQLQALKDEHRVLIANENFNEADEILNIYEWKYKEISEEGKLAMLISDTNNPLGQAAYKYGTALYLDLNSYVKNFQVGRMLIFEGKYGEAIIRLEHALSINSVHQPSKFLLGLAQSHLRKLTDQKFEKTLELLLDGMEIALSHFSGNATMASESRKGMKKLFGSDENFFRLENPLICRGFFALAEMLVRRELNAF-IKPVHVFHTALLAATMGWANVSPGYVMSQFEHVIINCHDELLRILNDELREIPTEVSVRRCEWLNAFISSTCLPLS 646          

HSP 2 Score: 55.0694 bits (131), Expect = 3.603e-7
Identity = 36/114 (31.58%), Postives = 64/114 (56.14%), Query Frame = 1
Query: 2785 GTSLNPYRI--ELALARACRINKQFAESVKYY----KISGIEKHLNNINDMMQEYVETLISAENYETALEVYYKLNINDKNPSFDDGYICGEVVRLLMKLEKYQDKMLVKYASL 3108
            G  LNP  +   L LARA ++N+Q+ E +K Y    KI  +      IN+   E ++ L+  ENYE AL++  K  IN+   +  D  +C +++++L+K+   +D+ + +Y+ L
Sbjct:  852 GVPLNPQTVYSRLMLARAYKLNEQYFECIKCYNYVRKIINVPSMKALINN---ELLDVLVKTENYEQALDLISKTVINETKLTQGDLIMCKKILQVLIKMNLIEDERIWRYSVL 962          
The following BLAST results are available for this feature:
BLAST of SIAH-type domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SIAH-type domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SIAH-type domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SIAH-type domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SIAH-type domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SIAH-type domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SIAH-type domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SIAH-type domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9KBA73.341e-9729.50Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A2C9KBA91.275e-9529.60Uncharacterized protein OS=Biomphalaria glabrata O... [more]
V3Z9U87.570e-8430.88Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A433T7763.210e-8232.49Uncharacterized protein (Fragment) OS=Elysia chlor... [more]
K1PGC13.326e-8031.82Uncharacterized protein OS=Crassostrea gigas OX=29... [more]
back to top
BLAST of SIAH-type domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SIAH-type domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SIAH-type domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SIAH-type domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO254032.182e-2547.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
back to top
BLAST of SIAH-type domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SIAH-type domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000042443.10.000e+099.72SMESG000042443.1[more]
SMESG000042443.10.000e+099.54SMESG000042443.1[more]
SMESG000053995.15.108e-9130.15SMESG000053995.1[more]
SMESG000053995.14.661e-8631.21SMESG000053995.1[more]
SMESG000053995.11.791e-7931.96SMESG000053995.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032005 ID=SMED30032005|Name=SIAH-type domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3338bp
AAATAAATTACCATAGAAACAATGGATAATTGTTATTTAGAAAAATTACT
CGCTAAACCGGGAAAATTATTTCCAAAATATAATAAAAATACTTTTAGTT
ATAACATTATTTTAGGTGTTTCTGACAGTAAAACTACATTAGATTTCTAT
ACAGAAGAAAGTGGAGCTTCTTACCAAATTTTTACTGAAGGAGGGGATGG
AACAAAAACAATTAATGTTGAAGAAGGGAAATGTAAAACCGTGAAAATTG
AAGTAACAGCTGAAGATGGGAAAACAACTAAATGTTATATTATTGAAATT
AAAAGACATTCAGCCAAAGTAGCTATTCTAGAATCAATTAAAATAAATTG
TGGTATACTTCAACCAAATTTTGATAGCAATGTGTTTGAATACTTTGCCA
CCGTTGGCTTAAAAGTGCTTAACATAGATTTTATTTTACAAATTCCCGAT
CAAAAGTGTATAACAAAGATTAATAATGAAGAAACAAAGTCTTCTTATTC
TTTAACATTAGGCCATTCAATATTCAATTTAAATGTTACATCGCCAGATG
GTTCACACAATCAAACTTACAAAATTACAATAATCAGAAAATTAATTCCA
TACTTCGTCTTCATTTCCGATCCACAATTTCGTTTTTCATATGAGGATCC
AATATCTTTATCCCCATCATTTCACCCAGTTAAGACCAATAGCATGTATT
CGTGGGATATTCTGTCGAAATGTGAAGTTGAACAATTGATAAATTTAAAA
CGCAACGACTTTCAAGTAAAAACGGAAATTGATCAGATTCATGAAATGTC
AATTTCTAATCTTGATGGGCAATTTCTTAATCCGAATTTAACTTTATCCG
AACCTGTGAAAATTAATAATCCCGGATCACTATTATTAAATTCGTCTGAC
GCAAATTTATCCACAATTTCCTATTCATTCTATCCATTTAATGACAATAT
TAATACGACACCAGAATGGCAGCAAATCCTATGCATTTCTAATTGTAGTG
ACAGTGACAAAACATTATTCAAGAAATGCGAAGAAGCTGTGAAAATATAT
TTGCAATGCAGACCTCAACACCCAATTTTCGATGTTAATCAAACTATTAA
TCACGAACATCCTTCTAAAAAGCTGTTTAATGCAATAAGTTTGGCAGCTA
CGGCGATCATTAAGCAGAAATCTGAAAGCAAATATCATTTCATGCTGGCT
CAATTATTAGAAGAGAATTATACAAATGAAGATATTTTTAATTTAATTTT
ACACAAAATAGGAGCTAGTGAATTGGATAACAAATGTTCCATGAAATGTA
CAGCTGGGCAAGATTTCAAAGCAGTTAATTCCGCGAAACTAGATGAAATA
TTGGCCATTTGTAAACTTCATGGTTATGTAAAAAATCCAACTGATACAGA
ACAATTAATGGCACTTGACAAGGAATATCATTCTTTAATATCACAAAATC
AAACAGGAAAAGCTGATGCTATTCAAAATTTATACGAATGGAAATCGAAA
CAGTATTCTCAAGAGGCAGCAATGAGTTCTCAAGCATTAAATGAAGAAAC
CTTATTTGGCCAAATCTTCAATAAATATCTAGCAGCCCTTTCTTTGGATA
AAAAGTCATCACTGTATAATTTTCATGTGGGCAGATTATTAATTATTCAG
GGCAAATATAAAGAAGCTATTGAAAGATTGCACACAGCTCTAAATGGAAA
AAATAATCATCTTCCTTCAAAACTTTGTTTAGGACTTGCAATGTCTTTTG
TCCCTGAATTGACGAAAGATAAAATCACCGAATCCATTTACCTTATTTAC
GATTCTCTTGCACCAGGTTTGCGTAGGATTTTTGATAATTCTTACGAAAC
AAATACTGAAGATATTTTAAAAGATAAAGTGTTTGCGGACGAGGATGTGT
TTTTCGATATTAGAAATCCTTTAATCTCAAAAGCGGTTTTACAATTAGGC
TGTTTATTAATGAAAAAGTCTCAGTCTAAAATCTCAGTTAAACCTTTCCT
GGTAATACACTGGGCTTTGCATCTCGCAACTCTCGGATGGTCTCAGGTTG
GAAATGGAAATAATCTTCTTCAATTCGAATTTGTTATTATTGAATGCCAT
AAACAACTTTTATTATTAATACACGAAGAAATAGAAAATGCATCCGATGC
CATTTATGTAAATCGCTGTCTATGGTTAATGAACTTCGTCAGATCCAGTT
CGATTCCACTTAATCGAGAATTGTTAAAATTATTAGAAGAGCTTAGTCAA
GTTCCATTATTTTTTGAGCCGGGAAATCCTCATTATCTAACTTGTTATGG
CGAGATATTATCTTATAAAGCTGATCAAATGATGGCTAATGATGAAACTT
TTATTTCAACTATAGAATTGTCGATTAAAATTCTTACATTTGCTTTGGAT
TTAAAAAGAAATAAAAAGGCTGACGAGGCTGTCAAGTTTATTAAAGATCA
AATTTGGCATAAGGAAAGGCACCTTTTAATTTTTCAATTGAAACCCCAAC
AAGAAAAAGGAAAGCCTTTAGACAAAAAAGGACCAGATGTAAACAAACCA
ATTCCTGCCACAGCTACTAAAACTACAAATATCAAACAGCCACCTAACAC
TCAAAAGAAAGTAGTTTCTCAACCCCCAAAGAAAGGTCCTGTGAAACAGA
GCAATGTTCCCAGTAAAAATTTGACTGCCCCTAAAGATAAACAAATTGCA
GCAGTGGAAAGCAAAGAGGAATCTGAAAAATCTAATGATAATGTGAATAA
ATCTGTGTTAAAATACGAGAGAAATTTAGGGAATGGGACTAGTCTGAACC
CTTACAGAATAGAACTGGCTCTAGCAAGGGCATGCCGTATTAACAAGCAG
TTTGCCGAAAGCGTGAAATATTACAAAATCAGCGGAATAGAAAAACATCT
TAATAATATAAATGATATGATGCAGGAATATGTGGAAACGTTGATATCGG
CTGAGAATTATGAGACGGCCCTTGAAGTATACTATAAACTGAATATAAAT
GATAAGAATCCTTCATTTGATGATGGTTATATTTGCGGTGAAGTTGTAAG
ACTATTGATGAAACTTGAAAAATATCAAGACAAAATGCTTGTAAAATACG
CGTCATTATGGGCAAAGATATTCGGTTTTGGTATAATTGAAAAAGAAATA
AAAATTTTGGAAGACAAAAGCCAAACGGAAACATGTAAAGAGATCTACGC
AACTGTTAACGGAAAGAAAAAGGATGATCCAGATTTAAAAATGTTTTTCC
AATCTCGGTGTTGGATTTAAAATTAGAAAATAAATGATTTGCGTCATATT
AACTCTTTGACATTAATATACTGTTTGAATTTTATAAA
back to top

protein sequence of SMED30032005-orf-1

>SMED30032005-orf-1 ID=SMED30032005-orf-1|Name=SMED30032005-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1083bp
MDNCYLEKLLAKPGKLFPKYNKNTFSYNIILGVSDSKTTLDFYTEESGAS
YQIFTEGGDGTKTINVEEGKCKTVKIEVTAEDGKTTKCYIIEIKRHSAKV
AILESIKINCGILQPNFDSNVFEYFATVGLKVLNIDFILQIPDQKCITKI
NNEETKSSYSLTLGHSIFNLNVTSPDGSHNQTYKITIIRKLIPYFVFISD
PQFRFSYEDPISLSPSFHPVKTNSMYSWDILSKCEVEQLINLKRNDFQVK
TEIDQIHEMSISNLDGQFLNPNLTLSEPVKINNPGSLLLNSSDANLSTIS
YSFYPFNDNINTTPEWQQILCISNCSDSDKTLFKKCEEAVKIYLQCRPQH
PIFDVNQTINHEHPSKKLFNAISLAATAIIKQKSESKYHFMLAQLLEENY
TNEDIFNLILHKIGASELDNKCSMKCTAGQDFKAVNSAKLDEILAICKLH
GYVKNPTDTEQLMALDKEYHSLISQNQTGKADAIQNLYEWKSKQYSQEAA
MSSQALNEETLFGQIFNKYLAALSLDKKSSLYNFHVGRLLIIQGKYKEAI
ERLHTALNGKNNHLPSKLCLGLAMSFVPELTKDKITESIYLIYDSLAPGL
RRIFDNSYETNTEDILKDKVFADEDVFFDIRNPLISKAVLQLGCLLMKKS
QSKISVKPFLVIHWALHLATLGWSQVGNGNNLLQFEFVIIECHKQLLLLI
HEEIENASDAIYVNRCLWLMNFVRSSSIPLNRELLKLLEELSQVPLFFEP
GNPHYLTCYGEILSYKADQMMANDETFISTIELSIKILTFALDLKRNKKA
DEAVKFIKDQIWHKERHLLIFQLKPQQEKGKPLDKKGPDVNKPIPATATK
TTNIKQPPNTQKKVVSQPPKKGPVKQSNVPSKNLTAPKDKQIAAVESKEE
SEKSNDNVNKSVLKYERNLGNGTSLNPYRIELALARACRINKQFAESVKY
YKISGIEKHLNNINDMMQEYVETLISAENYETALEVYYKLNINDKNPSFD
DGYICGEVVRLLMKLEKYQDKMLVKYASLWAKIFGFGIIEKEIKILEDKS
QTETCKEIYATVNGKKKDDPDLKMFFQSRCWI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0046872metal ion binding
GO:0005515protein binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR025883Cadherin-like_b_sandwich
IPR011990TPR-like_helical_dom_sf
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 898..918
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 826..908
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 845..885
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 892..908
NoneNo IPR availablePANTHERPTHR15315RING FINGER PROTEIN 41, 151coord: 838..1071
NoneNo IPR availablePANTHERPTHR15315RING FINGER PROTEIN 41, 151coord: 314..815
NoneNo IPR availablePANTHERPTHR15315RING FINGER PROTEIN 41, 151coord: 1..221
NoneNo IPR availablePANTHERPTHR15315:SF39coord: 1..221
coord: 314..815
NoneNo IPR availablePANTHERPTHR15315:SF39coord: 838..1071
IPR025883Cadherin-like beta sandwich domainPFAMPF12733Cadherin-likecoord: 105..189
e-value: 3.8E-6
score: 27.3
coord: 18..95
e-value: 1.1E-7
score: 32.3
IPR011990Tetratricopeptide-like helical domain superfamilySUPERFAMILYSSF48452TPR-likecoord: 367..575