STAS domain-containing protein

Overview
NameSTAS domain-containing protein
Smed IDSMED30031995
Length (bp)1373
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of STAS domain-containing protein (SMED30031995) t-SNE clustered cells

Violin plots show distribution of expression levels for STAS domain-containing protein (SMED30031995) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of STAS domain-containing protein (SMED30031995) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for STAS domain-containing protein (SMED30031995) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031995

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
tailSMED30031995SMESG000064566.1 dd_Smed_v6_10602_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30031995SMESG000064566.1 dd_Smed_v4_10602_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30031995SMESG000064566.1 dd_Smed_v4_10602_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30031995SMESG000064566.1 dd_Smed_v4_10602_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of STAS domain-containing protein vs. Ensembl Human
Match: SLC26A5 (solute carrier family 26 member 5 [Source:HGNC Symbol;Acc:HGNC:9359])

HSP 1 Score: 183.726 bits (465), Expect = 2.041e-50
Identity = 119/345 (34.49%), Postives = 187/345 (54.20%), Query Frame = 3
Query:  363 REFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGDCHEIPGIKIFRYEGSIYYACKDHFKKSLYTKISYDP--IMVKLRXXXXXXXXXXXNQSL---------EEMENTDL--------------IAKRAVFQEELDSLLNP--NIHHIIIDCSTWGYIDIVGVKILHQVIEEYKNVNISVLLANPKTDV-----RRMFYRIETSQLIHDENIFVSVHDAVINS 1301
            +E IA GL N   S F  +  + S+SRS VQE  GGKTQ+   ++ ++IL V+L  G LF+ LP  +L++++IV LK M M+F +L   W  S  + ++W+ TF+ ++FL + YGLI  V +++++++ RTQSP+  +LG++  TD+Y ++  Y +  EIPGIKIF+    IYYA  D +  +L  K   +P  IM   R    +   +  N ++          E++  D               I  ++ F EE+   + P  N+H +I+D +   +ID VGVK L  +++EY +V I V LA     V     R  F+  E   L   E +F S+HDAV+ S
Sbjct:  336 QELIALGLCNSIGSLFQTFSISCSLSRSLVQEGTGGKTQLAGCLASLMILLVILATGFLFESLPQAVLSAIVIVNLKGMFMQFSDLPFFWRTSKIELTIWLTTFVSSLFLGLDYGLITAVIIALLTVIYRTQSPSYKVLGKLPETDVYIDIDAYEEVKEIPGIKIFQINAPIYYANSDLYSNALKRKTGVNPAVIMGARRKAMRKYAKEVGNANMANATVVKADAEVDGEDATKPEEEDGEVKYPPIVIKSTFPEEMQRFMPPGDNVHTVILDFTQVNFIDSVGVKTLAGIVKEYGDVGIYVYLAGCSAQVVNDLTRNRFF--ENPALW--ELLFHSIHDAVLGS 676          

HSP 2 Score: 84.3445 bits (207), Expect = 1.190e-16
Identity = 49/122 (40.16%), Postives = 70/122 (57.38%), Query Frame = 1
Query:    1 YLSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYGIFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVVVAGTVSSQYLDLHNKYNVSVVGTIIQG 366
            YL++PL+ GFT  +A+ VF++ LKY FGV   +Y GIFSV  + +AV + + N N+ +  +  +   LL   K   N    +K+  PIP+E   VV GT  S   +L   YNV VVGT+  G
Sbjct:  167 YLTEPLVRGFTTAAAVHVFTSMLKYLFGVKTKRYSGIFSVVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKE-FNERFKEKLPAPIPLEFFAVVMGTGISAGFNLKESYNVDVVGTLPLG 287          
BLAST of STAS domain-containing protein vs. Ensembl Human
Match: SLC26A5 (solute carrier family 26 member 5 [Source:HGNC Symbol;Acc:HGNC:9359])

HSP 1 Score: 183.726 bits (465), Expect = 2.579e-50
Identity = 119/345 (34.49%), Postives = 187/345 (54.20%), Query Frame = 3
Query:  363 REFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGDCHEIPGIKIFRYEGSIYYACKDHFKKSLYTKISYDP--IMVKLRXXXXXXXXXXXNQSL---------EEMENTDL--------------IAKRAVFQEELDSLLNP--NIHHIIIDCSTWGYIDIVGVKILHQVIEEYKNVNISVLLANPKTDV-----RRMFYRIETSQLIHDENIFVSVHDAVINS 1301
            +E IA GL N   S F  +  + S+SRS VQE  GGKTQ+   ++ ++IL V+L  G LF+ LP  +L++++IV LK M M+F +L   W  S  + ++W+ TF+ ++FL + YGLI  V +++++++ RTQSP+  +LG++  TD+Y ++  Y +  EIPGIKIF+    IYYA  D +  +L  K   +P  IM   R    +   +  N ++          E++  D               I  ++ F EE+   + P  N+H +I+D +   +ID VGVK L  +++EY +V I V LA     V     R  F+  E   L   E +F S+HDAV+ S
Sbjct:  373 QELIALGLCNSIGSLFQTFSISCSLSRSLVQEGTGGKTQLAGCLASLMILLVILATGFLFESLPQAVLSAIVIVNLKGMFMQFSDLPFFWRTSKIELTIWLTTFVSSLFLGLDYGLITAVIIALLTVIYRTQSPSYKVLGKLPETDVYIDIDAYEEVKEIPGIKIFQINAPIYYANSDLYSNALKRKTGVNPAVIMGARRKAMRKYAKEVGNANMANATVVKADAEVDGEDATKPEEEDGEVKYPPIVIKSTFPEEMQRFMPPGDNVHTVILDFTQVNFIDSVGVKTLAGIVKEYGDVGIYVYLAGCSAQVVNDLTRNRFF--ENPALW--ELLFHSIHDAVLGS 713          

HSP 2 Score: 84.3445 bits (207), Expect = 1.266e-16
Identity = 49/122 (40.16%), Postives = 70/122 (57.38%), Query Frame = 1
Query:    1 YLSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYGIFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVVVAGTVSSQYLDLHNKYNVSVVGTIIQG 366
            YL++PL+ GFT  +A+ VF++ LKY FGV   +Y GIFSV  + +AV + + N N+ +  +  +   LL   K   N    +K+  PIP+E   VV GT  S   +L   YNV VVGT+  G
Sbjct:  204 YLTEPLVRGFTTAAAVHVFTSMLKYLFGVKTKRYSGIFSVVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKE-FNERFKEKLPAPIPLEFFAVVMGTGISAGFNLKESYNVDVVGTLPLG 324          
BLAST of STAS domain-containing protein vs. Ensembl Human
Match: SLC26A5 (solute carrier family 26 member 5 [Source:HGNC Symbol;Acc:HGNC:9359])

HSP 1 Score: 182.956 bits (463), Expect = 5.203e-50
Identity = 119/347 (34.29%), Postives = 187/347 (53.89%), Query Frame = 3
Query:  363 REFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGDCHEIPGIKIFRYEGSIYYACKDHFKKSLYTKISYDP--IMVKLRXXXXXXXXXXXNQSL-----------EEMENTDL--------------IAKRAVFQEELDSLLNP--NIHHIIIDCSTWGYIDIVGVKILHQVIEEYKNVNISVLLANPKTDV-----RRMFYRIETSQLIHDENIFVSVHDAVINS 1301
            +E IA GL N   S F  +  + S+SRS VQE  GGKTQ+   ++ ++IL V+L  G LF+ LP  +L++++IV LK M M+F +L   W  S  + ++W+ TF+ ++FL + YGLI  V +++++++ RTQSP+  +LG++  TD+Y ++  Y +  EIPGIKIF+    IYYA  D +  +L  K   +P  IM   R    +   +  N ++            E++  D               I  ++ F EE+   + P  N+H +I+D +   +ID VGVK L  +++EY +V I V LA     V     R  F+  E   L   E +F S+HDAV+ S
Sbjct:  373 QELIALGLCNSIGSLFQTFSISCSLSRSLVQEGTGGKTQLAGCLASLMILLVILATGFLFESLPQAVLSAIVIVNLKGMFMQFSDLPFFWRTSKIELTIWLTTFVSSLFLGLDYGLITAVIIALLTVIYRTQSPSYKVLGKLPETDVYIDIDAYEEVKEIPGIKIFQINAPIYYANSDLYSNALKRKTGVNPAVIMGARRKAMRKYAKEVGNANMANATVVKATQDAEVDGEDATKPEEEDGEVKYPPIVIKSTFPEEMQRFMPPGDNVHTVILDFTQVNFIDSVGVKTLAGIVKEYGDVGIYVYLAGCSAQVVNDLTRNRFF--ENPALW--ELLFHSIHDAVLGS 715          

HSP 2 Score: 84.3445 bits (207), Expect = 1.213e-16
Identity = 49/122 (40.16%), Postives = 70/122 (57.38%), Query Frame = 1
Query:    1 YLSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYGIFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVVVAGTVSSQYLDLHNKYNVSVVGTIIQG 366
            YL++PL+ GFT  +A+ VF++ LKY FGV   +Y GIFSV  + +AV + + N N+ +  +  +   LL   K   N    +K+  PIP+E   VV GT  S   +L   YNV VVGT+  G
Sbjct:  204 YLTEPLVRGFTTAAAVHVFTSMLKYLFGVKTKRYSGIFSVVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKE-FNERFKEKLPAPIPLEFFAVVMGTGISAGFNLKESYNVDVVGTLPLG 324          
BLAST of STAS domain-containing protein vs. Ensembl Human
Match: SLC26A5 (solute carrier family 26 member 5 [Source:HGNC Symbol;Acc:HGNC:9359])

HSP 1 Score: 182.956 bits (463), Expect = 5.203e-50
Identity = 119/347 (34.29%), Postives = 187/347 (53.89%), Query Frame = 3
Query:  363 REFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGDCHEIPGIKIFRYEGSIYYACKDHFKKSLYTKISYDP--IMVKLRXXXXXXXXXXXNQSL-----------EEMENTDL--------------IAKRAVFQEELDSLLNP--NIHHIIIDCSTWGYIDIVGVKILHQVIEEYKNVNISVLLANPKTDV-----RRMFYRIETSQLIHDENIFVSVHDAVINS 1301
            +E IA GL N   S F  +  + S+SRS VQE  GGKTQ+   ++ ++IL V+L  G LF+ LP  +L++++IV LK M M+F +L   W  S  + ++W+ TF+ ++FL + YGLI  V +++++++ RTQSP+  +LG++  TD+Y ++  Y +  EIPGIKIF+    IYYA  D +  +L  K   +P  IM   R    +   +  N ++            E++  D               I  ++ F EE+   + P  N+H +I+D +   +ID VGVK L  +++EY +V I V LA     V     R  F+  E   L   E +F S+HDAV+ S
Sbjct:  373 QELIALGLCNSIGSLFQTFSISCSLSRSLVQEGTGGKTQLAGCLASLMILLVILATGFLFESLPQAVLSAIVIVNLKGMFMQFSDLPFFWRTSKIELTIWLTTFVSSLFLGLDYGLITAVIIALLTVIYRTQSPSYKVLGKLPETDVYIDIDAYEEVKEIPGIKIFQINAPIYYANSDLYSNALKRKTGVNPAVIMGARRKAMRKYAKEVGNANMANATVVKATQDAEVDGEDATKPEEEDGEVKYPPIVIKSTFPEEMQRFMPPGDNVHTVILDFTQVNFIDSVGVKTLAGIVKEYGDVGIYVYLAGCSAQVVNDLTRNRFF--ENPALW--ELLFHSIHDAVLGS 715          

HSP 2 Score: 84.3445 bits (207), Expect = 1.213e-16
Identity = 49/122 (40.16%), Postives = 70/122 (57.38%), Query Frame = 1
Query:    1 YLSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYGIFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVVVAGTVSSQYLDLHNKYNVSVVGTIIQG 366
            YL++PL+ GFT  +A+ VF++ LKY FGV   +Y GIFSV  + +AV + + N N+ +  +  +   LL   K   N    +K+  PIP+E   VV GT  S   +L   YNV VVGT+  G
Sbjct:  204 YLTEPLVRGFTTAAAVHVFTSMLKYLFGVKTKRYSGIFSVVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKE-FNERFKEKLPAPIPLEFFAVVMGTGISAGFNLKESYNVDVVGTLPLG 324          
BLAST of STAS domain-containing protein vs. Ensembl Human
Match: SLC26A5 (solute carrier family 26 member 5 [Source:HGNC Symbol;Acc:HGNC:9359])

HSP 1 Score: 178.333 bits (451), Expect = 1.241e-48
Identity = 107/313 (34.19%), Postives = 173/313 (55.27%), Query Frame = 3
Query:  363 REFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGDCHEIPGIKIFRYEGSIYYACKDHFKKSLYTKISYDP--IMVKLRXXXXXXXXXXXNQSL---------EEMENTDL--------------IAKRAVFQEELDSLLNP--NIHHIIIDCSTWGYIDIVGVKILHQVIEEYKNVNISVLLANPKTDVRR 1220
            +E IA GL N   S F  +  + S+SRS VQE  GGKTQ+   ++ ++IL V+L  G LF+ LP  +L++++IV LK M M+F +L   W  S  + ++W+ TF+ ++FL + YGLI  V +++++++ RTQSP+  +LG++  TD+Y ++  Y +  EIPGIKIF+    IYYA  D +  +L  K   +P  IM   R    +   +  N ++          E++  D               I  ++ F EE+   + P  N+H +I+D +   +ID VGVK L  +++EY +V I V LA     ++R
Sbjct:  373 QELIALGLCNSIGSLFQTFSISCSLSRSLVQEGTGGKTQLAGCLASLMILLVILATGFLFESLPQAVLSAIVIVNLKGMFMQFSDLPFFWRTSKIELTIWLTTFVSSLFLGLDYGLITAVIIALLTVIYRTQSPSYKVLGKLPETDVYIDIDAYEEVKEIPGIKIFQINAPIYYANSDLYSNALKRKTGVNPAVIMGARRKAMRKYAKEVGNANMANATVVKADAEVDGEDATKPEEEDGEVKYPPIVIKSTFPEEMQRFMPPGDNVHTVILDFTQVNFIDSVGVKTLAGIVKEYGDVGIYVYLAGCSAFIQR 685          

HSP 2 Score: 84.3445 bits (207), Expect = 1.092e-16
Identity = 49/122 (40.16%), Postives = 70/122 (57.38%), Query Frame = 1
Query:    1 YLSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYGIFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVVVAGTVSSQYLDLHNKYNVSVVGTIIQG 366
            YL++PL+ GFT  +A+ VF++ LKY FGV   +Y GIFSV  + +AV + + N N+ +  +  +   LL   K   N    +K+  PIP+E   VV GT  S   +L   YNV VVGT+  G
Sbjct:  204 YLTEPLVRGFTTAAAVHVFTSMLKYLFGVKTKRYSGIFSVVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKE-FNERFKEKLPAPIPLEFFAVVMGTGISAGFNLKESYNVDVVGTLPLG 324          
BLAST of STAS domain-containing protein vs. Ensembl Celegans
Match: sulp-6 (SULfate Permease family [Source:UniProtKB/TrEMBL;Acc:O45016])

HSP 1 Score: 167.162 bits (422), Expect = 1.305e-44
Identity = 108/345 (31.30%), Postives = 188/345 (54.49%), Query Frame = 3
Query:  363 REFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXG-PLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGDCHEIPGIKIFRYEGSIYYACKDHFKKSLYTKISYDPIMVKLRXXXXXXXXXXXNQSLEE----------MENTDLIAKRAVFQEELDSLLNPN-------IHHIIIDCSTWGYIDIVGVKILHQVIEEYKNVNISVLLANPKTDVRRMFYRIETSQLIHD---ENIFVSVHDAVINSLYDHKIQIECL 1334
            +E+ A GLM+  SSFF C+    S+ R+ +Q   G K+Q+++L++ I+++  +        Q LP  +LAS+++VA+K + ++      L   S  D+ ++  TF+  I L+V +GL+ GV   ++++VLR+Q  +S +LG+I+GT+ Y+ + +Y   ++IPGIKIFR++  IY+   + F + ++     +P++V+  ++   KK     +  EE              ++   +A   +E  +   PN       + HIIIDCST  Y+D++G   L  V  +YK + ISVL AN    VR+ F   ETSQ   +     +FVSV DAV  +  + + + E +
Sbjct:  399 QEWFALGLMHTTSSFFGCFAGGSSLGRTMMQVKCGTKSQLSTLITSIVLIIFVCGGAVGCIQHLPKPVLASIVVVAMKDLFIQIFTCFALRKLSFVDYLIFAATFISVIVLNVNFGLLIGVVFELLTVVLRSQWADSSLLGRITGTNHYRRLGLYETANDIPGIKIFRFDSPIYFGNSEMFVRKIHQACGLNPLIVRGELETENKKKDARKEKEEEDAEIPKETEKETKLEVTTHQAKVLDEKHAEPEPNPADQYERLTHIIIDCSTIIYVDLMGQGALKDVYNDYKTIGISVLFANTNEHVRQNF---ETSQFFEEVPRGRMFVSVSDAVDQAELEQRHKTETV 740          

HSP 2 Score: 53.9138 bits (128), Expect = 1.686e-7
Identity = 36/126 (28.57%), Postives = 71/126 (56.35%), Query Frame = 1
Query:    1 YLSDPLISGFTVGSAIIVFSTQLKYCFGVT-IAKYYGIFSVWNTLIAVC--KQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVVVAGTVSSQY-LDLHNKYNVSVVGTIIQG 366
            +LSD L+ G   G+A+ V ++QLK    ++ +      F   N +  +C  KQ+P+ +  + +++ I ++LL ++  VI+P L KK+    P+EL++VV+ T++  Y  +   ++ +  VG +  G
Sbjct:  227 WLSDQLVQGLISGAAVHVLTSQLKSMTRISNVPPTSEPFQ--NVVFYMCFFKQMPDVDYASIIISVICVVLLLISTLVIDPWLCKKVPVKFPMELVLVVSMTLTVHYTRNTAYEFQIPTVGQVTSG 350          
BLAST of STAS domain-containing protein vs. Ensembl Celegans
Match: sulp-6 (SULfate Permease family [Source:UniProtKB/TrEMBL;Acc:O45016])

HSP 1 Score: 167.162 bits (422), Expect = 1.305e-44
Identity = 108/345 (31.30%), Postives = 188/345 (54.49%), Query Frame = 3
Query:  363 REFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXG-PLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGDCHEIPGIKIFRYEGSIYYACKDHFKKSLYTKISYDPIMVKLRXXXXXXXXXXXNQSLEE----------MENTDLIAKRAVFQEELDSLLNPN-------IHHIIIDCSTWGYIDIVGVKILHQVIEEYKNVNISVLLANPKTDVRRMFYRIETSQLIHD---ENIFVSVHDAVINSLYDHKIQIECL 1334
            +E+ A GLM+  SSFF C+    S+ R+ +Q   G K+Q+++L++ I+++  +        Q LP  +LAS+++VA+K + ++      L   S  D+ ++  TF+  I L+V +GL+ GV   ++++VLR+Q  +S +LG+I+GT+ Y+ + +Y   ++IPGIKIFR++  IY+   + F + ++     +P++V+  ++   KK     +  EE              ++   +A   +E  +   PN       + HIIIDCST  Y+D++G   L  V  +YK + ISVL AN    VR+ F   ETSQ   +     +FVSV DAV  +  + + + E +
Sbjct:  399 QEWFALGLMHTTSSFFGCFAGGSSLGRTMMQVKCGTKSQLSTLITSIVLIIFVCGGAVGCIQHLPKPVLASIVVVAMKDLFIQIFTCFALRKLSFVDYLIFAATFISVIVLNVNFGLLIGVVFELLTVVLRSQWADSSLLGRITGTNHYRRLGLYETANDIPGIKIFRFDSPIYFGNSEMFVRKIHQACGLNPLIVRGELETENKKKDARKEKEEEDAEIPKETEKETKLEVTTHQAKVLDEKHAEPEPNPADQYERLTHIIIDCSTIIYVDLMGQGALKDVYNDYKTIGISVLFANTNEHVRQNF---ETSQFFEEVPRGRMFVSVSDAVDQAELEQRHKTETV 740          

HSP 2 Score: 53.9138 bits (128), Expect = 1.686e-7
Identity = 36/126 (28.57%), Postives = 71/126 (56.35%), Query Frame = 1
Query:    1 YLSDPLISGFTVGSAIIVFSTQLKYCFGVT-IAKYYGIFSVWNTLIAVC--KQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVVVAGTVSSQY-LDLHNKYNVSVVGTIIQG 366
            +LSD L+ G   G+A+ V ++QLK    ++ +      F   N +  +C  KQ+P+ +  + +++ I ++LL ++  VI+P L KK+    P+EL++VV+ T++  Y  +   ++ +  VG +  G
Sbjct:  227 WLSDQLVQGLISGAAVHVLTSQLKSMTRISNVPPTSEPFQ--NVVFYMCFFKQMPDVDYASIIISVICVVLLLISTLVIDPWLCKKVPVKFPMELVLVVSMTLTVHYTRNTAYEFQIPTVGQVTSG 350          
BLAST of STAS domain-containing protein vs. Ensembl Celegans
Match: sulp-4 (Anion transporter SULP-4; SULfate Permease family [Source:UniProtKB/TrEMBL;Acc:G5EEA7])

HSP 1 Score: 142.51 bits (358), Expect = 2.371e-36
Identity = 90/289 (31.14%), Postives = 153/289 (52.94%), Query Frame = 3
Query:  432 SVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGDCHEIPGIKIFRYEGSIYYACKDHFKKSL---YTKISYDPIMVKLRXXXXXXXXXXXNQSLEEMENTDLIAKRAVFQEELDSLLNPNIHHIIIDCSTWGYIDIVGVKILHQVIEEYKNVNISVLLANPKTDVRRMFYRIETSQLIHDENIFVSVHDA 1289
            S+SR+ V   AG  TQ++   S +++  V++F+G L + LP   L+++I VAL+ M  KF +L +LW  S  DF++W+V+ + TI LDV  GLI  V  ++ + +LR Q P  H+L  + GT  +++   YG+     GI IFR++  + +   + FKKS+   YT+         LR ++      K++ S E ++       ++        +L+    H +IDCS + +ID++GV  L ++  + +   I V  AN K  VR MF +      +  EN + ++ DA
Sbjct:  430 SLSRTLVAVGAGCTTQLSIFFSSLIVFSVVIFLGTLLETLPMAALSAIICVALQGMFRKFADLIDLWKVSKIDFTIWVVSCVSTILLDVSTGLIISVCFALFTTILREQYPKWHLLASVKGTQDFRDAERYGETVYFKGICIFRFDAPLLFHNVECFKKSIEKAYTEWQKSHEFYVLREERETILNTKLDGSDESIDGKMFQTAQSTLNTHSPDILS---RHFVIDCSGFTFIDLMGVSALKEIFSDMRKRGILVYFANAKAPVREMFEKCHFFNFVSKENFYPTMRDA 715          

HSP 2 Score: 59.6918 bits (143), Expect = 2.792e-9
Identity = 42/125 (33.60%), Postives = 68/125 (54.40%), Query Frame = 1
Query:    1 YLSDPLISGFTVGSAIIVFSTQLKYCFGVT-IAKYYGIFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKI--HFPIPIELLVVVAGTVSSQYLDLHNKYNVSVVGTIIQG 366
            YLSD +I+GFTVGS++ V  +QLK   G+  + ++ G F ++  L  +   +   N  +  ++ +SII+L   K  INP + +K   + PIP EL++V+  TV      +  +  V VV  I  G
Sbjct:  234 YLSDQVIAGFTVGSSVHVLVSQLKTLLGIRGLPRHSGPFYLFRHLYDLVMSITRANPVSCGISIVSIIVLHFGKEFINPFIKRKTKSNIPIPWELVIVILSTVFVAVTGVDTEAKVQVVNKIPVG 358          
BLAST of STAS domain-containing protein vs. Ensembl Celegans
Match: sulp-2 (Anion transporter SULP-2; SULfate Permease family [Source:UniProtKB/TrEMBL;Acc:G5EDS5])

HSP 1 Score: 141.354 bits (355), Expect = 4.491e-36
Identity = 99/331 (29.91%), Postives = 169/331 (51.06%), Query Frame = 3
Query:  363 REFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGDCHEIPGIKIFRYEGSIYYACKDHFKKSLYTKISYDPIMVKLRXXXXXXXXXXXNQSLEEMENTDLIAKRAVFQEELDSLLNPNIHHIIIDCSTWGYIDIVGVKILHQVIEEYKNVNISVLLANPKTDVRRMFYRIETSQLIHDENI-----FVSVHDAVINS---LYDHKIQIEC 1331
            +E +A G +NI SSFF  +P++ S SR+ V E +G KTQ++ + S   +  V+  IGP    LP+CIL++++IV L+SML K   L  LW  S  DF +W++T + T+  D+  G+ AG+  +I +I +++Q P   +LGQI   D ++ +  Y    E    +I R++  + +A  + F  ++    S      K R           + S +  E+ +  A                   II+DC TW Y D +G+  + Q+ EE + + I +L AN K+ +RR +     + LI + NI     + S+ DA+ ++   + +HK+  +C
Sbjct:  349 QELLALGFINIGSSFFSVFPTSASFSRTLVNERSGAKTQLSGITSACFMALVITTIGPYLASLPSCILSAIVIVVLESMLRKCTVLPGLWRCSKHDFWIWIITAVVTLSSDIAQGVAAGIFTAIFTIAIQSQQPTIKLLGQIRPND-FRPMNHYSLAKET-SFRIIRFDAPLIFANVEKFLDNVRDSTS---ATTKKR-----------SASCDSQEDIEWSA-------------------IILDCHTWIYTDSMGIAAVKQINEELRQIRILLLFANLKSSLRRQY---GNAGLIGEGNIGRNQMYPSIQDALDSAHELIKNHKMFFDC 641          
BLAST of STAS domain-containing protein vs. Ensembl Celegans
Match: sulp-3 (Sulfate permease family protein 3 [Source:UniProtKB/Swiss-Prot;Acc:Q94225])

HSP 1 Score: 141.739 bits (356), Expect = 4.685e-36
Identity = 90/313 (28.75%), Postives = 160/313 (51.12%), Query Frame = 3
Query:  357 YTREFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGDCHEIPG-IKIFRYEGSIYYACKDHFKKSLYTKISYDPIMVKLRXXXXXXXXXXXNQSLEEMENTDLIAKRAVFQEELDSLLNPNIHHIIIDCSTWGYIDIVGVKILHQVIEEYKNVNISVLLANPKTDVRRMFYRIETSQLIHDENIFVSVHDAV 1292
            + +E  A G + + SSFF  +P     +RS V  A GG TQ+T L S + +L V+L IGP  + LP CIL+++II A K ML KF ELK LW     DF++W+++F  T+  D+  GL+  +  ++++ ++RTQ P  H L +   T+ YK      D   I G + IFR +  + +   D F  S++  +       + + +      +  +    ++ ++ L + R  ++ +  S    N   ++IDC  + Y+D +G+  L  V  + +   I       K+D++++F   +  +++ +  +F  V DAV
Sbjct:  392 HGQELYALGFVGVLSSFFPVFPVTSGFARSVVGAAVGGSTQLTCLFSSLALLSVILCIGPALEYLPQCILSAMIIFAQKGMLEKFGELKSLWPVFKIDFTIWLMSFFLTVCYDMGEGLLMAIGFAVLTTIIRTQRPKWHFLSRDDDTENYKETKKR-DLERIQGNVCIFRMDAPLIFTSSDRFTMSVWQCVKK---WERCKSESFVTIEQMNSDRSADIFDSKLKSARRRWKRDQKS---ENRCKLVIDCDGFPYVDYLGLSTLKSVYVDLQAAGIQCFFVVQKSDLKKLFRATDFYEVVDESKVFNKVGDAV 697          

HSP 2 Score: 67.3958 bits (163), Expect = 1.152e-11
Identity = 36/118 (30.51%), Postives = 64/118 (54.24%), Query Frame = 1
Query:    4 LSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYGIFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVVVAGTVSSQYLDLHNKYNVSVVGTI 357
             S+ ++SGF VG  I VF  Q+    G+ + +  G   ++  +  + + L N +IPT  ++  S + L   K  + P L    ++P+P EL++VV G  ++ Y +L  +++V VVG I
Sbjct:  225 FSEQVMSGFVVGGGIHVFFAQIGNMLGIELPRRSGPGYLYYRIWDLVENLDNVHIPTVCISLSSFLFLVFGKEYLAPWLNSAFNYPVPFELVLVVVGITATNYAELSLRHDVKVVGNI 342          
BLAST of STAS domain-containing protein vs. Ensembl Fly
Match: Prestin (gene:FBgn0036770 transcript:FBtr0075153)

HSP 1 Score: 125.561 bits (314), Expect = 1.058e-49
Identity = 97/314 (30.89%), Postives = 164/314 (52.23%), Query Frame = 3
Query:  363 REFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQIS-GTDLYKNVAVYGDCHEIPGIKIFRYEGSIYYACKDHFKKSLYTKISYDPI-MVKLRXXXXXXXXXXXNQSLEEMENTDLIAKRAVFQEELDSLLNPNIHHIIIDCSTWGYIDIVGVKILHQVIEEYKNVNISVLLANPKTDVRRMFYRIETSQLIHDE--NIFVSVHDAV 1292
            +E  A G+ N+    F C P A S+SRS +Q+  GG +QI SLVS  L++  L++IGP F  LP C+LA VIIVALK M M+  ELK+       +   W+ TFL  + +D+  GL+ G+ +S++++ ++   P S +LG +     +Y ++  + +  ++P ++IFRY GS+ +A    F+++LY  +  D I + K+         K    S   +      A     +E   +        +++D S  G+ID+ G + L  + +E K     +LLA+P   V R++  +  S  + +    IF ++HD V
Sbjct:  428 QELFAMGIGNMVGGCFSCIPMACSLSRSVIQDQTGGVSQIASLVSASLVVVTLMWIGPFFSSLPRCVLAGVIIVALKPMFMQAKELKKFSKQGKLEMFTWISTFLCVVIIDIDIGLLIGICISLLALYIKGLKPYSCLLGYMPEAPGIYMDLNQHRNAMQVPEVRIFRYSGSLNFATSLFFRRALYEAVGLDKIPLTKVSSSNSNSPSKGSKSSYSPVSQNGGKAINGKLEETSGAF-----KVLVLDFSMLGHIDVAGCRTLTDLSKELKVRGARLLLASP---VDRVYDTLVHSMALSEGPFEIFPTLHDCV 733          

HSP 2 Score: 91.6633 bits (226), Expect = 1.058e-49
Identity = 49/131 (37.40%), Postives = 77/131 (58.78%), Query Frame = 1
Query:    4 LSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYGIFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVVVAGTVSSQYLDLHNKYNVSVVGTIIQG----NLSRLD 384
            LS+PL++GFT  +A  V + QLK   G+++ ++ G F +  T+I V K +P TN+  F      I  + +   ++ P L KK  FP+P EL++V+ GT+ S++ +L+  YNV+ VG I  G     L RLD
Sbjct:  259 LSEPLVNGFTTAAACHVVTAQLKDVLGISVPRHKGAFKIIYTVIDVIKGVPQTNLVNFGFCMAVIAFMMICNEILKPRLSKKCRFPLPAELIMVIGGTLISKWFNLYVDYNVNPVGKIPSGLPEPVLPRLD 389          
BLAST of STAS domain-containing protein vs. Ensembl Fly
Match: CG6125 (gene:FBgn0038337 transcript:FBtr0083106)

HSP 1 Score: 79.337 bits (194), Expect = 2.174e-15
Identity = 53/178 (29.78%), Postives = 97/178 (54.49%), Query Frame = 3
Query:  360 TREFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGDCHEIPGIKIFRYEGSIYYACK 893
            ++E +  GL NI  SFF   P+ G+ +RSAV +A+G +T +  + + +++L  L  + P FQ +P   L++V+I A+  M+     +KELW  +  DF  W+ +F+  +   V+ GL+ G+ LS++ I+LR  +P   +  +   +  Y ++    D +   G+   R E  +  AC+
Sbjct:  382 SQEMLTLGLCNIAGSFFSAMPTCGAFTRSAVSQASGVRTPMAGIYTGLIVLSALSILTPYFQYIPKASLSAVLIAAVIFMI-DLAPVKELWQTNKKDFFSWVGSFIICLVAGVELGLLFGIVLSMVFILLRLGNPKFEVTLKQHESTYYVHIVPQSDVYYT-GVDALRSE--LRGACR 555          
BLAST of STAS domain-containing protein vs. Ensembl Fly
Match: CG6125 (gene:FBgn0038337 transcript:FBtr0346109)

HSP 1 Score: 78.9518 bits (193), Expect = 2.246e-15
Identity = 53/178 (29.78%), Postives = 97/178 (54.49%), Query Frame = 3
Query:  360 TREFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGDCHEIPGIKIFRYEGSIYYACK 893
            ++E +  GL NI  SFF   P+ G+ +RSAV +A+G +T +  + + +++L  L  + P FQ +P   L++V+I A+  M+     +KELW  +  DF  W+ +F+  +   V+ GL+ G+ LS++ I+LR  +P   +  +   +  Y ++    D +   G+   R E  +  AC+
Sbjct:  353 SQEMLTLGLCNIAGSFFSAMPTCGAFTRSAVSQASGVRTPMAGIYTGLIVLSALSILTPYFQYIPKASLSAVLIAAVIFMI-DLAPVKELWQTNKKDFFSWVGSFIICLVAGVELGLLFGIVLSMVFILLRLGNPKFEVTLKQHESTYYVHIVPQSDVYYT-GVDALRSE--LRGACR 526          
BLAST of STAS domain-containing protein vs. Ensembl Fly
Match: CG6125 (gene:FBgn0038337 transcript:FBtr0083105)

HSP 1 Score: 78.9518 bits (193), Expect = 2.246e-15
Identity = 53/178 (29.78%), Postives = 97/178 (54.49%), Query Frame = 3
Query:  360 TREFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGDCHEIPGIKIFRYEGSIYYACK 893
            ++E +  GL NI  SFF   P+ G+ +RSAV +A+G +T +  + + +++L  L  + P FQ +P   L++V+I A+  M+     +KELW  +  DF  W+ +F+  +   V+ GL+ G+ LS++ I+LR  +P   +  +   +  Y ++    D +   G+   R E  +  AC+
Sbjct:  353 SQEMLTLGLCNIAGSFFSAMPTCGAFTRSAVSQASGVRTPMAGIYTGLIVLSALSILTPYFQYIPKASLSAVLIAAVIFMI-DLAPVKELWQTNKKDFFSWVGSFIICLVAGVELGLLFGIVLSMVFILLRLGNPKFEVTLKQHESTYYVHIVPQSDVYYT-GVDALRSE--LRGACR 526          
BLAST of STAS domain-containing protein vs. Ensembl Fly
Match: CG6928 (gene:FBgn0036240 transcript:FBtr0076049)

HSP 1 Score: 66.6254 bits (161), Expect = 2.215e-11
Identity = 46/135 (34.07%), Postives = 74/135 (54.81%), Query Frame = 3
Query:  360 TREFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSP 764
            TRE +A  + NI  +F    P  GS SRSAV  A+G +T +    + +L+L  L  + P FQ +P   L++VII A+  M+ +F  +K LW  S  +     +TF+ ++ + V+ GL+ GV+  +  +V R   P
Sbjct:  324 TRELVALSMSNICGAFCSSMPVTGSFSRSAVNHASGVRTPLGGCYTSVLVLLALGLLAPYFQYIPKAALSAVIISAVIFMI-EFEVIKPLWRCSRRELLPGAITFVMSLAVGVEIGLLLGVSTDVAFLVYRAARP 457          
BLAST of STAS domain-containing protein vs. Ensembl Zebrafish
Match: slc26a10 (solute carrier family 26 member 10 [Source:ZFIN;Acc:ZDB-GENE-030131-9845])

HSP 1 Score: 186.037 bits (471), Expect = 1.190e-51
Identity = 97/311 (31.19%), Postives = 182/311 (58.52%), Query Frame = 3
Query:  363 REFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGDCHEIPGIKIFRYEGSIYYACKDHFKKSLYTKISYDPIMVKLRXXXXXXXXXXXNQSLEEMENTDLIAKRAVFQEELDSLLNPNIHHIIIDCSTWGYIDIVGVKILHQVIEEYKNVNISVLLANPKTDVRRMFYRIETSQLIHDENIFVSVHDAVI 1295
            +E +A G+ N  SS F C+P++ +++ + + E+AGG TQ+  L + +++L VLL IGPLF  LP  +LA + + +L+ M ++F +L ELW  S  DF VW+VT+L  + L+V  GL  G+  S++++V RTQ  +  +LG+ + T++Y+++  +  C+E+PG+KI  Y G IYY  +  FK  +   +   P  ++ R + ++   K+  +++  +E        + F  + D   +  +  ++IDCS+  ++DI G ++  Q+  E + + + + LAN    V ++         ++ ++IFV++HDAV+
Sbjct:  349 QELLAHGISNTVSSLFTCFPNSATLATTNILESAGGHTQLAGLFTSLVVLIVLLLIGPLFYFLPKAVLACINVTSLRQMFLQFQDLPELWRISKIDFMVWLVTWLSVVVLNVDLGLAIGMVFSMMTVVCRTQRASCSVLGRAANTEIYRSINNHNKCYEVPGVKILTYNGPIYYGNRSFFKADMAQLLGLTPERIRSREKALKAIEKREREAISTVEQG---VADSSFSSKNDLFTSGEVQAVLIDCSSVIFVDIAGARLFIQMCMECQKIGVRIYLANCNESVLKILTSSGLMNYMNPQHIFVTIHDAVV 656          

HSP 2 Score: 63.929 bits (154), Expect = 2.424e-10
Identity = 31/95 (32.63%), Postives = 58/95 (61.05%), Query Frame = 1
Query:    1 YLSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYGIFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVV 285
            YLS+P++  FT  +A  V  +QL+   G+ + +Y G FS++ TL +V + +P+TN+   V++ + + +L   K V N    +++  PIP+E++ V
Sbjct:  192 YLSEPIVKAFTSAAAFHVTVSQLQSMLGLRLPRYAGAFSLFKTLASVMENVPHTNLAELVISLLCLAVLVPVKEV-NSRFRERLRTPIPVEIITV 285          
BLAST of STAS domain-containing protein vs. Ensembl Zebrafish
Match: slc26a10 (solute carrier family 26 member 10 [Source:ZFIN;Acc:ZDB-GENE-030131-9845])

HSP 1 Score: 186.037 bits (471), Expect = 1.190e-51
Identity = 97/311 (31.19%), Postives = 182/311 (58.52%), Query Frame = 3
Query:  363 REFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGDCHEIPGIKIFRYEGSIYYACKDHFKKSLYTKISYDPIMVKLRXXXXXXXXXXXNQSLEEMENTDLIAKRAVFQEELDSLLNPNIHHIIIDCSTWGYIDIVGVKILHQVIEEYKNVNISVLLANPKTDVRRMFYRIETSQLIHDENIFVSVHDAVI 1295
            +E +A G+ N  SS F C+P++ +++ + + E+AGG TQ+  L + +++L VLL IGPLF  LP  +LA + + +L+ M ++F +L ELW  S  DF VW+VT+L  + L+V  GL  G+  S++++V RTQ  +  +LG+ + T++Y+++  +  C+E+PG+KI  Y G IYY  +  FK  +   +   P  ++ R + ++   K+  +++  +E        + F  + D   +  +  ++IDCS+  ++DI G ++  Q+  E + + + + LAN    V ++         ++ ++IFV++HDAV+
Sbjct:  349 QELLAHGISNTVSSLFTCFPNSATLATTNILESAGGHTQLAGLFTSLVVLIVLLLIGPLFYFLPKAVLACINVTSLRQMFLQFQDLPELWRISKIDFMVWLVTWLSVVVLNVDLGLAIGMVFSMMTVVCRTQRASCSVLGRAANTEIYRSINNHNKCYEVPGVKILTYNGPIYYGNRSFFKADMAQLLGLTPERIRSREKALKAIEKREREAISTVEQG---VADSSFSSKNDLFTSGEVQAVLIDCSSVIFVDIAGARLFIQMCMECQKIGVRIYLANCNESVLKILTSSGLMNYMNPQHIFVTIHDAVV 656          

HSP 2 Score: 63.929 bits (154), Expect = 2.424e-10
Identity = 31/95 (32.63%), Postives = 58/95 (61.05%), Query Frame = 1
Query:    1 YLSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYGIFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVV 285
            YLS+P++  FT  +A  V  +QL+   G+ + +Y G FS++ TL +V + +P+TN+   V++ + + +L   K V N    +++  PIP+E++ V
Sbjct:  192 YLSEPIVKAFTSAAAFHVTVSQLQSMLGLRLPRYAGAFSLFKTLASVMENVPHTNLAELVISLLCLAVLVPVKEV-NSRFRERLRTPIPVEIITV 285          
BLAST of STAS domain-containing protein vs. Ensembl Zebrafish
Match: slc26a10 (solute carrier family 26 member 10 [Source:ZFIN;Acc:ZDB-GENE-030131-9845])

HSP 1 Score: 185.652 bits (470), Expect = 1.906e-51
Identity = 98/315 (31.11%), Postives = 185/315 (58.73%), Query Frame = 3
Query:  363 REFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGDCHEIPGIKIFRYEGSIYYACKDHFKKSLYTKISYDPIMVKLRXXXXXXXXXXXNQSLEEME----NTDLIAKRAVFQEELDSLLNPNIHHIIIDCSTWGYIDIVGVKILHQVIEEYKNVNISVLLANPKTDVRRMFYRIETSQLIHDENIFVSVHDAVI 1295
            +E +A G+ N  SS F C+P++ +++ + + E+AGG TQ+  L + +++L VLL IGPLF  LP  +LA + + +L+ M ++F +L ELW  S  DF VW+VT+L  + L+V  GL  G+  S++++V RTQ  +  +LG+ + T++Y+++  +  C+E+PG+KI  Y G IYY  +  FK  +   +   P  ++ R + ++   K+  +++  +E    ++   +K  +F  E+       +  ++IDCS+  ++DI G ++  Q+  E + + + + LAN    V ++         ++ ++IFV++HDAV+
Sbjct:  361 QELLAHGISNTVSSLFTCFPNSATLATTNILESAGGHTQLAGLFTSLVVLIVLLLIGPLFYFLPKAVLACINVTSLRQMFLQFQDLPELWRISKIDFMVWLVTWLSVVVLNVDLGLAIGMVFSMMTVVCRTQRASCSVLGRAANTEIYRSINNHNKCYEVPGVKILTYNGPIYYGNRSFFKADMAQLLGLTPERIRSREKALKAIEKREREAISTVEQGVADSSFSSKNDLFTSEMA---EGEVQAVLIDCSSVIFVDIAGARLFIQMCMECQKIGVRIYLANCNESVLKILTSSGLMNYMNPQHIFVTIHDAVV 672          

HSP 2 Score: 76.6406 bits (187), Expect = 1.909e-14
Identity = 39/122 (31.97%), Postives = 72/122 (59.02%), Query Frame = 1
Query:    1 YLSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYGIFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVVVAGTVSSQYLDLHNKYNVSVVGTIIQG 366
            YLS+P++  FT  +A  V  +QL+   G+ + +Y G FS++ TL +V + +P+TN+   V++ + + +L   K V N    +++  PIP+E++ V+  T  +    L +KY++ +VG I  G
Sbjct:  192 YLSEPIVKAFTSAAAFHVTVSQLQSMLGLRLPRYAGAFSLFKTLASVMENVPHTNLAELVISLLCLAVLVPVKEV-NSRFRERLRTPIPVEIITVIIATGITYAFSLDSKYDIQIVGHIPAG 312          
BLAST of STAS domain-containing protein vs. Ensembl Zebrafish
Match: slc26a3.1 (solute carrier family 26 member 3 [Source:ZFIN;Acc:ZDB-GENE-041210-180])

HSP 1 Score: 166.007 bits (419), Expect = 3.373e-44
Identity = 109/350 (31.14%), Postives = 187/350 (53.43%), Query Frame = 3
Query:  363 REFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGDCHEIPGIKIFRYEGSIYYACKDHFKKSLYTKISYDPIMV--KLRXXXXXXXXXXXNQSLEEMENTDLIAKRAVFQEE--LDSLLNP-------------------------NIHHIIIDCSTWGYIDIVGVKILHQVIEEYKNVNISVLLANPKTDVRRMFYRIETSQLIHDE---NIF-VSVHDAVINSLYDH 1313
            +E IAFG+ N+F + F  + ++ ++SR+A+QE+ GGKTQI  ++S +++L V++ +G L +PLP  +L +++IV LK MLM+F EL  LW     DF  WMVTF+ ++FL +  GL  G+   + ++V RTQ P   +L  ISGTDLY++   Y   +E  G+KIF+    I++A  D F+  L  ++ ++P+ V  K      + +    N  LE  +   ++ + +V   E  ++ L  P                         NIH +I+D     +ID+  +K L   ++E+  + + V + +   DV  M  +++      DE   +IF  ++HDA+++ L  H
Sbjct:  375 QELIAFGVSNMFGASFRSFAASTALSRTAIQESTGGKTQIAGILSAMMVLIVIVGVGFLLEPLPRSVLGALVIVNLKGMLMQFSELPFLWRNDRPDFVTWMVTFMASLFLGLDLGLAVGIGAELFTVVYRTQFPRCSVLANISGTDLYRDRKDYTSIYEPDGVKIFKIPSPIFFANIDFFRDKLVQEVGFNPMRVLKKRNKALRKIRKMLCNGELEVSDRGPVLRQPSVDTSEGSMEDLDQPIDFSDLPIQVNWNSQLPANISVPPVNIHSLILDFCAVSFIDVSALKGLKATLKEFIRIEVDVYIVS--CDVYIM-EKLQHCTFFDDEIKTSIFYPTLHDAMLHILETH 721          

HSP 2 Score: 65.855 bits (159), Expect = 5.763e-11
Identity = 37/122 (30.33%), Postives = 68/122 (55.74%), Query Frame = 1
Query:    1 YLSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYGIFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVVVAGTVSSQYLDLHNKYNVSVVGTIIQG 366
            YLS+ L+SGFT  +A+ +  +QL++  G+      G  ++  TL+ V  ++ +TN+   V T+I+I+ L +    IN     K+  PIPIE+++ V     S   +   +++V +VG ++ G
Sbjct:  206 YLSETLVSGFTTAAAVHILVSQLRFVLGLDFPGINGPLAIIYTLVEVFSRITSTNVADLV-TSIAIMALVLIVKEINDRFKSKLPVPIPIEVIMTVIACGVSYAFNFEERFDVVIVGEMVNG 326          
BLAST of STAS domain-containing protein vs. Ensembl Zebrafish
Match: slc26a4 (solute carrier family 26 member 4 [Source:ZFIN;Acc:ZDB-GENE-060503-544])

HSP 1 Score: 163.696 bits (413), Expect = 1.870e-43
Identity = 111/347 (31.99%), Postives = 191/347 (55.04%), Query Frame = 3
Query:  363 REFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGDCHEIPGIKIFRYEGSIYYACKDHFKKSLYTKISYDPIMV-KLRXXXXXXXXXX--------------------------XNQSLEEME----NTDLIAKRAV-FQEELD---SLLNPNIHHIIIDCSTWGYIDIVGVKILHQVIEEYKNVNISVLLANPKTD-VRRMFYRIETSQLIHDENIFVSVHDAVI 1295
            +E IAFG+ NIF   F  + ++ ++SR+AVQE+ GGK+Q+  L+S ++++ V+L +GP  QPL   +LA ++I  LK M ++  E+  LW  +  D  +W+ + L ++ L +  GL+AG+   + ++V+RTQ P+   LG +  TD+YKN+  Y    EIPG+KIF+    IY+A  D+FK+ L  ++ +D + V K R + ++K  K                            N+   EME     TD   K  V +  EL    S+   +IH +++D S+  ++D+V  K L  V++E+  + +SV +A    + VR+M       + ++ + +F+SVHDA++
Sbjct:  380 QELIAFGVSNIFGGCFSSFVASTALSRTAVQESTGGKSQVAGLISAVMVMIVILALGPFLQPLQKSVLAGIVIANLKGMFLQISEVPVLWRQNRTDCFIWIASCLASVVLGLDVGLLAGLVFEMGTVVVRTQFPSCATLGNVPNTDIYKNMKDYKKVDEIPGVKIFKCNSPIYFANIDYFKEKLRDEVGFDAVRVFKKRNKALKKIHKLIKKGKLQVTEAGLVPVASLGVENKGFENEPGHEMEKQASKTDSEVKIQVDWTSELPVSVSVPRVHIHSLVVDFSSVSFLDVVAAKSLKLVVKEFIRIGVSVYIAGCDGELVRKMEALSFFDEEVNRDLLFLSVHDAIL 726          

HSP 2 Score: 71.633 bits (174), Expect = 7.235e-13
Identity = 43/122 (35.25%), Postives = 65/122 (53.28%), Query Frame = 1
Query:    1 YLSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYGIFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVVVAGTVSSQYLDLHNKYNVSVVGTIIQG 366
            YLSDPL+ GFT  +A  VF +Q+K    V    + G FS   TLI V   +   N+   +   ++I ++   K  IN     KI  PIPIE++V V  +  S  +DL+++Y  S+V  + +G
Sbjct:  211 YLSDPLVGGFTTAAAFHVFISQIKTILSVPTHNHNGFFSFAYTLIDVGSNINQANMADLIAGLLTISIVMAVKE-INTKFQHKIPVPIPIEVIVTVIASAISHVMDLNSQYGASIVHNLPRG 331          
BLAST of STAS domain-containing protein vs. Ensembl Xenopus
Match: slc26a6 (solute carrier family 26 member 6 [Source:NCBI gene;Acc:780378])

HSP 1 Score: 146.747 bits (369), Expect = 3.763e-51
Identity = 79/184 (42.93%), Postives = 120/184 (65.22%), Query Frame = 3
Query:  363 REFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGDCHEIPGIKIFRYEGSIYYACKDHFKKSL 914
            +E IA GL N   SFF C+    ++SRS VQE+ GG +Q+ S VS ++IL ++L  G LFQ LP  ILA+V++V LK +  +F ++  LW  +  D  VW+VTFL TI L++  GL   VA S+++++ RTQ P+  ILG++  TD+Y++VA +    EI GIKIFR   ++Y+A  + + +S+
Sbjct:  341 QELIALGLSNSIGSFFQCFTIGTAMSRSLVQESTGGHSQVASAVSSLVILIIILRAGELFQTLPKAILAAVVVVNLKGIYKQFTDVPMLWRSNKIDLLVWVVTFLATILLNLDIGLAVSVAFSLLTVIFRTQKPHYSILGKVDNTDIYRDVAQFDQVTEIQGIKIFRSSCTLYFANANLYAESV 524          

HSP 2 Score: 75.8702 bits (185), Expect = 3.763e-51
Identity = 46/123 (37.40%), Postives = 70/123 (56.91%), Query Frame = 1
Query:    1 YLSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYGIFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVVVAGTVSSQYLDLHNKYNVSVVGTIIQGN 369
            YLS+PLI G+T  +AI V  +Q+K   GV I++     S+   ++ +C +LP TNI + ++  I+I +L V K  +N     KI  PIPIEL+ ++  T  S   +L+  Y V +VG I  G 
Sbjct:  206 YLSEPLIRGYTSAAAIHVTVSQMKSVLGVQISQRSHPLSLIYAIVNLCAKLPETNIASLLIGGIAITVLFVVK-FLNDKYSSKIRMPIPIELITLIVATGISYGANLNQVYGVDIVGEIPTGK 327          
BLAST of STAS domain-containing protein vs. Ensembl Xenopus
Match: SLC26A5 (solute carrier family 26 member 5 [Source:NCBI gene;Acc:100497573])

HSP 1 Score: 181.415 bits (459), Expect = 7.597e-50
Identity = 114/328 (34.76%), Postives = 185/328 (56.40%), Query Frame = 3
Query:  363 REFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGDCHEIPGIKIFRYEGSIYYACKDHFKKSLYTKISYDPIMVKLRXXXXXXXXXXXNQSLEEMENTDLIAKRAVFQ-------------EELDSLLNP--NIHHIIIDCSTWGYIDIVGVKILHQVIEEYKNVNISVLLANPKTDVRRMFYRIETSQLIHDENI-FVSVHDAVIN 1298
            +E IA G+ N   SFF  +    S+SRS VQE+ GG TQI  L+S +++L V++ IG LFQPLP  +LA++++V LK M  +F ++  LW  S  + S+W+V+FL ++ L + YGL+  V  +I++++ RTQSP   ILGQ+  TD+Y +V  Y +  E   IKIF+   S+Y+A  + +  +L  K   DP  + +       K K   +   EM+  +   K+AV +             +EL+  + P  ++H II+D +   ++D VGVK L  +I+EYK + ++VL++     V +    +      +  +I F S+HDAVI+
Sbjct:  331 QELIALGVCNSVGSFFQTFSVTCSMSRSLVQESTGGNTQIAGLLSSLMVLLVIVVIGYLFQPLPQTVLAAIVMVNLKGMFKQFADIPHLWRTSRLELSIWVVSFLASVSLGLDYGLLVAVTFAILTVIYRTQSPQYRILGQVPNTDIYCDVEQYEEVKEFTDIKIFQANTSLYFANSELYVSALRKKTGIDPAAILI------AKKKAQKRHAREMKKANKTEKKAVLKLVSDYVNLHNTPSDELEYFMTPIISVHWIILDFTPVNFVDSVGVKTLKSIIKEYKEIGVTVLVSGCSGLVVKDLTSLNFFDPSNKRDILFHSIHDAVIH 652          

HSP 2 Score: 70.8626 bits (172), Expect = 1.792e-12
Identity = 46/122 (37.70%), Postives = 69/122 (56.56%), Query Frame = 1
Query:    1 YLSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYGIFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVVVAGTVSSQYLDLHNKYNVSVVGTIIQG 366
            YL++PL+ GFT  +A+ VF++QLKY  GV   ++    +V  +  AV   +   N+ T +L    I+LL   K  IN    KK+  PIP+E++VV+  T  S  L+L   + V+VVG I  G
Sbjct:  162 YLTEPLVRGFTTAAAVHVFTSQLKYLLGVKTKRFREPLAVIFSFAAVLSNIMTVNVATLILGLSCILLLLGAKE-INDRFKKKLPVPIPMEIIVVIVSTGVSAGLNLEESHAVAVVGKIPTG 282          
BLAST of STAS domain-containing protein vs. Ensembl Xenopus
Match: smyd4 (SET and MYND domain containing 4 [Source:Xenbase;Acc:XB-GENE-945037])

HSP 1 Score: 174.481 bits (441), Expect = 3.410e-47
Identity = 104/315 (33.02%), Postives = 184/315 (58.41%), Query Frame = 3
Query:  363 REFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGDCHEIPGIKIFRYEGSIYYACKDHFKKSLYTKISYDPIMVKLRXXXXXXXXXXXNQSLEEMENTDLIAKRAVFQEELDSLLNPNIHHIIIDCSTWGYIDIVGVKILHQVIEEYKNVNISVLLANPKTDVRRMFYRIETSQLIHDENIFVSVHDAVINSLY 1307
            +E  A G  NI  +FF+C+ ++ +++++ V+E+ G KTQ++ +++ +++L VLL I PLF  L  C+L  + IV L+  L KF++L ++W  +  D ++W+VT   +  +  + GL+ G+A S+  +++R+Q P S +LGQ+  T++Y+++  Y + +   GIKIF +E  IYY  K HFK +LY     DP+ V    +K  KKI+K+N+    ME   +     +++E+      P +H +IIDC    +ID  G+  L +V+++Y ++ I +LLA     V+      +  +   +  +F SVH AV  +LY
Sbjct:  392 QEMYAIGFCNIIPAFFHCFTTSAALAKTLVKESTGCKTQVSGIMTSLVLLLVLLVIAPLFFSLQKCVLGVITIVNLRGALRKFLDLPKMWKVNKVDTTIWLVTMFSSALISTELGLLIGIAFSMFCVIVRSQKPVSTLLGQVDNTEVYESMNAYKNLNIPQGIKIFHFEAPIYYVNKQHFKMTLYKYSGVDPVSVATAKRKKAKKIEKLNRQDGSME---IKTTECLYKEQ-----QP-VHTLIIDCGAIQFIDTAGMNTLKEVLKDYSDIGIQLLLAQCNVTVKNSLRNGDFFKREENTVMFHSVHQAVQFALY 697          

HSP 2 Score: 80.8777 bits (198), Expect = 1.216e-15
Identity = 49/124 (39.52%), Postives = 73/124 (58.87%), Query Frame = 1
Query:    1 YLSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYGIFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVVVAGTVSSQYLDLHNKYNVSVVGTIIQGNL 372
            YLSD L+SGF  G++  + ++Q+KY  G++I +  GI S+  T I + + +  TNI   V T+I  +L+ +    +N     K+  PIPIELLVVVA T++S +  L   Y  S+ GTI  G L
Sbjct:  223 YLSDSLLSGFATGASFTILTSQVKYLLGISIPRANGIGSLIYTWIYIFQNIHLTNICDLV-TSILCLLVLIPAKELNECYKSKLKAPIPIELLVVVAATLASHFGHLKENYGSSIAGTIPTGFL 345          
BLAST of STAS domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000026575.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:3:34621613:34626696:1 gene:ENSXETG00000013549.1 transcript:ENSXETT00000026575.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 174.096 bits (440), Expect = 4.684e-47
Identity = 108/317 (34.07%), Postives = 178/317 (56.15%), Query Frame = 3
Query:  363 REFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGDCHEIPGIKIFRYEGSIYYACKDHFKKSLYTKISYDPIMVKLRXXXXXXXXXXXNQSLEE--MENTDLIAKRAVFQEELD-SLLNPNIHHIIIDCSTWGYIDIVGVKILHQVIEEYKNVNISVLLANPKTDVRRMF----YRIETSQLIHDENIFVSVHDAV 1292
            +E IA G  N  +SFF  + S  ++++S ++E+ G  TQ   ++S  ++L VLL I PLF  L NC+L  + I +L+  L KF +  ++W  S  D  VW V+ L +  +  + GL+  V  SI+ ++ RTQ P + +L +++GT++Y++   Y +   IP +KI+R++ S+YYA KD+FK +LY+K   +P +V    +K +K+ +      +   +   ++I      ++    S+   +IH +IIDC    +ID VG+ +L +V  +Y+ + I V LAN    VR M     Y    S  I D +IF SVHDAV
Sbjct:  352 QEMIAIGTCNFITSFFSGFVSCAALTKSLLRESTGANTQFNGIISSSVLLLVLLAIAPLFYSLQNCVLGVITITSLRGALRKFADTPKMWRISKIDTVVWWVSMLASSLITTEIGLLVAVCFSILCVIFRTQRPRATLLAKVTGTEIYEDQFTYKELSNIPNVKIYRFDASLYYANKDYFKTTLYSKTDINPSLVSALQKKAKKEEEAAAIETKNRFIARFNIIKTSGKIRQSASVSVPQFDIHSLIIDCGAMQFIDTVGLGVLKEVKNDYEEIGIRVFLANCNPSVRSMLSNGGYMNNASSGI-DLHIFHSVHDAV 667          

HSP 2 Score: 94.7449 bits (234), Expect = 3.710e-20
Identity = 50/122 (40.98%), Postives = 72/122 (59.02%), Query Frame = 1
Query:    1 YLSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYGIFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVVVAGTVSSQYLDLHNKYNVSVVGTIIQG 366
            YLS+PL+SGF  GS++ + ++Q+KY FG+ +   YG  S+  T I V   L NTNI   V + I+I ++   K  IN     K+  P P+EL+V++  T+ S Y D HN Y  S+ GTI  G
Sbjct:  183 YLSEPLLSGFVTGSSLTILTSQMKYLFGLKLTSRYGAGSLVLTWIDVFSNLKNTNICDLVTSIIAIAVIVPVKE-INDRFKSKMKIPCPVELIVIIVATLVSHYFDFHNNYKASICGTIPTG 303          
BLAST of STAS domain-containing protein vs. Ensembl Xenopus
Match: SLC26A5 (solute carrier family 26 member 5 [Source:NCBI gene;Acc:100497573])

HSP 1 Score: 171.4 bits (433), Expect = 5.380e-46
Identity = 114/355 (32.11%), Postives = 185/355 (52.11%), Query Frame = 3
Query:  363 REFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGDCHEIPGIKIFRYEGSIYYACKDHFKKSLYTKISYDPIMVKLRXXXXXXXXXXXNQSLEEMENTDLIAKRAVFQ----------------------------------------EELDSLLNP--NIHHIIIDCSTWGYIDIVGVKILHQVIEEYKNVNISVLLANPKTDVRRMFYRIETSQLIHDENI-FVSVHDAVIN 1298
            +E IA G+ N   SFF  +    S+SRS VQE+ GG TQI  L+S +++L V++ IG LFQPLP  +LA++++V LK M  +F ++  LW  S  + S+W+V+FL ++ L + YGL+  V  +I++++ RTQSP   ILGQ+  TD+Y +V  Y +  E   IKIF+   S+Y+A  + +  +L  K   DP  + +       K K   +   EM+  +   K+AV +                                        +EL+  + P  ++H II+D +   ++D VGVK L  +I+EYK + ++VL++     V +    +      +  +I F S+HDAVI+
Sbjct:  380 QELIALGVCNSVGSFFQTFSVTCSMSRSLVQESTGGNTQIAGLLSSLMVLLVIVVIGYLFQPLPQTVLAAIVMVNLKGMFKQFADIPHLWRTSRLELSIWVVSFLASVSLGLDYGLLVAVTFAILTVIYRTQSPQYRILGQVPNTDIYCDVEQYEEVKEFTDIKIFQANTSLYFANSELYVSALRKKTGIDPAAILI------AKKKAQKRHAREMKKANKTEKKAVLKLTNDVEMAVKHELMNDDSIIDMAANGRNGLSERNLHNTPSDELEYFMTPIISVHWIILDFTPVNFVDSVGVKTLKSIIKEYKEIGVTVLVSGCSGLVVKDLTSLNFFDPSNKRDILFHSIHDAVIH 728          

HSP 2 Score: 70.8626 bits (172), Expect = 1.955e-12
Identity = 46/122 (37.70%), Postives = 69/122 (56.56%), Query Frame = 1
Query:    1 YLSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYGIFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVVVAGTVSSQYLDLHNKYNVSVVGTIIQG 366
            YL++PL+ GFT  +A+ VF++QLKY  GV   ++    +V  +  AV   +   N+ T +L    I+LL   K  IN    KK+  PIP+E++VV+  T  S  L+L   + V+VVG I  G
Sbjct:  211 YLTEPLVRGFTTAAAVHVFTSQLKYLLGVKTKRFREPLAVIFSFAAVLSNIMTVNVATLILGLSCILLLLGAKE-INDRFKKKLPVPIPMEIIVVIVSTGVSAGLNLEESHAVAVVGKIPTG 331          
BLAST of STAS domain-containing protein vs. Ensembl Mouse
Match: Slc26a5 (solute carrier family 26, member 5 [Source:MGI Symbol;Acc:MGI:1933154])

HSP 1 Score: 182.185 bits (461), Expect = 4.780e-50
Identity = 118/343 (34.40%), Postives = 184/343 (53.64%), Query Frame = 3
Query:  363 REFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGDCHEIPGIKIFRYEGSIYYACKDHFKKSLYTKISYDP--IMVKLRXXXXXXXXXXXNQSL-------------------EEMENTDL----IAKRAVFQEELDSLL--NPNIHHIIIDCSTWGYIDIVGVKILHQVIEEYKNVNISVLLANPKTDVRRMFYR---IETSQLIHDENIFVSVHDAVINS 1301
            +E IA G+ N   S F  +  + S+SRS VQE  GGKTQ+   ++ ++IL V+L  G LF+ LP  +L++++IV LK M M+F +L   W  S  + ++W+ TF+ ++FL + YGLI  V +++++++ RTQSP+  +LGQ+  TD+Y ++  Y +  EIPGIKIF+    IYYA  D +  +L  K   +P  IM   R    +   +  N ++                    E E+ ++    I  +  F EEL   L    N+H +I+D +   ++D VGVK L  +++EY +V I V LA     V     R    E   L   E +F S+HDAV+ S
Sbjct:  336 QELIALGICNSIGSLFQTFSISCSLSRSLVQEGTGGKTQLAGCLASLMILLVILATGFLFESLPQAVLSAIVIVNLKGMFMQFSDLPFFWRTSKIELTIWLTTFVSSLFLGLDYGLITAVIIALLTVIYRTQSPSYKVLGQLPDTDVYIDIDAYEEVKEIPGIKIFQINAPIYYANSDLYSSALKRKTGVNPALIMGARRKAMRKYAKEVGNANVANATVVKVDAEVDGENATKPEEEDDEVKFPPIVIKTTFPEELQRFLPQGENVHTVILDFTQVNFVDSVGVKTLAGIVKEYGDVGIYVYLAGCSPQVVNDLTRNNFFENPAL--KELLFHSIHDAVLGS 676          

HSP 2 Score: 85.5001 bits (210), Expect = 2.780e-17
Identity = 49/122 (40.16%), Postives = 71/122 (58.20%), Query Frame = 1
Query:    1 YLSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYGIFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVVVAGTVSSQYLDLHNKYNVSVVGTIIQG 366
            YL++PL+ GFT  +A+ VF++ LKY FGV   +Y GIFSV  + +AV + + N N+ +  +  +   LL   K   N    +K+  PIP+E   VV GT  S   +LH  Y+V VVGT+  G
Sbjct:  167 YLTEPLVRGFTTAAAVHVFTSMLKYLFGVKTKRYSGIFSVVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKE-FNERFKEKLPAPIPLEFFAVVMGTGISAGFNLHESYSVDVVGTLPLG 287          
BLAST of STAS domain-containing protein vs. Ensembl Mouse
Match: Slc26a5 (solute carrier family 26, member 5 [Source:MGI Symbol;Acc:MGI:1933154])

HSP 1 Score: 182.185 bits (461), Expect = 6.746e-50
Identity = 118/343 (34.40%), Postives = 184/343 (53.64%), Query Frame = 3
Query:  363 REFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGDCHEIPGIKIFRYEGSIYYACKDHFKKSLYTKISYDP--IMVKLRXXXXXXXXXXXNQSL-------------------EEMENTDL----IAKRAVFQEELDSLL--NPNIHHIIIDCSTWGYIDIVGVKILHQVIEEYKNVNISVLLANPKTDVRRMFYR---IETSQLIHDENIFVSVHDAVINS 1301
            +E IA G+ N   S F  +  + S+SRS VQE  GGKTQ+   ++ ++IL V+L  G LF+ LP  +L++++IV LK M M+F +L   W  S  + ++W+ TF+ ++FL + YGLI  V +++++++ RTQSP+  +LGQ+  TD+Y ++  Y +  EIPGIKIF+    IYYA  D +  +L  K   +P  IM   R    +   +  N ++                    E E+ ++    I  +  F EEL   L    N+H +I+D +   ++D VGVK L  +++EY +V I V LA     V     R    E   L   E +F S+HDAV+ S
Sbjct:  373 QELIALGICNSIGSLFQTFSISCSLSRSLVQEGTGGKTQLAGCLASLMILLVILATGFLFESLPQAVLSAIVIVNLKGMFMQFSDLPFFWRTSKIELTIWLTTFVSSLFLGLDYGLITAVIIALLTVIYRTQSPSYKVLGQLPDTDVYIDIDAYEEVKEIPGIKIFQINAPIYYANSDLYSSALKRKTGVNPALIMGARRKAMRKYAKEVGNANVANATVVKVDAEVDGENATKPEEEDDEVKFPPIVIKTTFPEELQRFLPQGENVHTVILDFTQVNFVDSVGVKTLAGIVKEYGDVGIYVYLAGCSPQVVNDLTRNNFFENPAL--KELLFHSIHDAVLGS 713          

HSP 2 Score: 85.5001 bits (210), Expect = 2.959e-17
Identity = 49/122 (40.16%), Postives = 71/122 (58.20%), Query Frame = 1
Query:    1 YLSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYGIFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVVVAGTVSSQYLDLHNKYNVSVVGTIIQG 366
            YL++PL+ GFT  +A+ VF++ LKY FGV   +Y GIFSV  + +AV + + N N+ +  +  +   LL   K   N    +K+  PIP+E   VV GT  S   +LH  Y+V VVGT+  G
Sbjct:  204 YLTEPLVRGFTTAAAVHVFTSMLKYLFGVKTKRYSGIFSVVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKE-FNERFKEKLPAPIPLEFFAVVMGTGISAGFNLHESYSVDVVGTLPLG 324          
BLAST of STAS domain-containing protein vs. Ensembl Mouse
Match: Slc26a2 (solute carrier family 26 (sulfate transporter), member 2 [Source:MGI Symbol;Acc:MGI:892977])

HSP 1 Score: 162.925 bits (411), Expect = 2.868e-44
Identity = 103/310 (33.23%), Postives = 172/310 (55.48%), Query Frame = 3
Query:  363 REFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGDCHEIPGIKIFRYEGSIYYACKDHFKKSLYTKISYDPIMVKLRXXXXXXXXXXXNQSLEEMENTDLIAKRAVFQEELDSLLNPNIHHIIIDCSTWGYIDIVGVKILHQVIEEYKNVNISVLLANPKTDVRRMFYRIETSQLIHDENIFVSVHDAV 1292
            +E  A G  NI  SFF+C  ++ +++++ V+E+ G +TQ++++V+ +++L VLL I PLF  L  C+L  + IV L+  L+KF +L ++W  S  D  +W VT L +  L  + GL+ GV  S+  ++LRTQ P + +LG    ++ +++++ Y +     GIK+FR+   +YY  K+ FK +LY K + +P++VK   +K  K+     +  EEM            Q   D L    +H I+IDCS   ++D  G+  L +V  +Y+ V I VLLA     VR    R E  +   +  +F S+ +AV
Sbjct:  181 QEMYAIGFCNIIPSFFHCITTSAALAKTLVKESTGCQTQLSAIVTALVLLLVLLVIAPLFYSLQKCVLGVITIVNLRGALLKFRDLPKMWRLSRMDTVIWFVTMLSSALLSTEIGLLVGVCFSMFCVILRTQKPKNSLLGLEEESETFESISTYKNLRSKSGIKVFRFIAPLYYINKECFKSALYKK-ALNPVLVKAAWKKAAKR-----KLKEEMVTFRGDPDEVSMQLSHDPL---EVHTIVIDCSAIQFLDTAGIHTLKEVRRDYEAVGIQVLLAQCNPSVRDSLARGEYCKKEEETLLFYSLSEAV 481          

HSP 2 Score: 86.2705 bits (212), Expect = 1.301e-17
Identity = 44/122 (36.07%), Postives = 75/122 (61.48%), Query Frame = 1
Query:    1 YLSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYGIFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVVVAGTVSSQYLDLHNKYNVSVVGTIIQG 366
            YLSD L+SGF  G++  + ++Q KY  G+++ + +G+ SV  T I + + + NTNI   + + + +++L  +K  +N     K+  PIP+EL+VVVA T++S +  L+  YN S+ G I  G
Sbjct:   12 YLSDALLSGFVTGASFTILTSQAKYLLGLSLPRSHGVGSVITTWIHIFRNIRNTNICDLITSLLCLLVLVPSKE-LNEHFKDKLKAPIPVELIVVVAATLASHFGKLNGNYNSSIAGHIPTG 132          
BLAST of STAS domain-containing protein vs. Ensembl Mouse
Match: Slc26a2 (solute carrier family 26 (sulfate transporter), member 2 [Source:MGI Symbol;Acc:MGI:892977])

HSP 1 Score: 162.925 bits (411), Expect = 4.552e-43
Identity = 102/310 (32.90%), Postives = 169/310 (54.52%), Query Frame = 3
Query:  363 REFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGDCHEIPGIKIFRYEGSIYYACKDHFKKSLYTKISYDPIMVKLRXXXXXXXXXXXNQSLEEMENTDLIAKRAVFQEELDSLLNPNIHHIIIDCSTWGYIDIVGVKILHQVIEEYKNVNISVLLANPKTDVRRMFYRIETSQLIHDENIFVSVHDAV 1292
            +E  A G  NI  SFF+C  ++ +++++ V+E+ G +TQ++++V+ +++L VLL I PLF  L  C+L  + IV L+  L+KF +L ++W  S  D  +W VT L +  L  + GL+ GV  S+  ++LRTQ P + +LG    ++ +++++ Y +     GIK+FR+   +YY  K+ FK +LY K + +P++VK        K     +  EEM            Q   D L    +H I+IDCS   ++D  G+  L +V  +Y+ V I VLLA     VR    R E  +   +  +F S+ +AV
Sbjct:  416 QEMYAIGFCNIIPSFFHCITTSAALAKTLVKESTGCQTQLSAIVTALVLLLVLLVIAPLFYSLQKCVLGVITIVNLRGALLKFRDLPKMWRLSRMDTVIWFVTMLSSALLSTEIGLLVGVCFSMFCVILRTQKPKNSLLGLEEESETFESISTYKNLRSKSGIKVFRFIAPLYYINKECFKSALYKK-ALNPVLVKA-----AWKKAAKRKLKEEMVTFRGDPDEVSMQLSHDPL---EVHTIVIDCSAIQFLDTAGIHTLKEVRRDYEAVGIQVLLAQCNPSVRDSLARGEYCKKEEETLLFYSLSEAV 716          

HSP 2 Score: 86.2705 bits (212), Expect = 1.725e-17
Identity = 44/122 (36.07%), Postives = 75/122 (61.48%), Query Frame = 1
Query:    1 YLSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYGIFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVVVAGTVSSQYLDLHNKYNVSVVGTIIQG 366
            YLSD L+SGF  G++  + ++Q KY  G+++ + +G+ SV  T I + + + NTNI   + + + +++L  +K  +N     K+  PIP+EL+VVVA T++S +  L+  YN S+ G I  G
Sbjct:  247 YLSDALLSGFVTGASFTILTSQAKYLLGLSLPRSHGVGSVITTWIHIFRNIRNTNICDLITSLLCLLVLVPSKE-LNEHFKDKLKAPIPVELIVVVAATLASHFGKLNGNYNSSIAGHIPTG 367          
BLAST of STAS domain-containing protein vs. Ensembl Mouse
Match: Slc26a3 (solute carrier family 26, member 3 [Source:MGI Symbol;Acc:MGI:107181])

HSP 1 Score: 159.073 bits (401), Expect = 9.123e-42
Identity = 107/349 (30.66%), Postives = 180/349 (51.58%), Query Frame = 3
Query:  363 REFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGDCHEIPGIKIFRYEGSIYYACKDHFKKSLYTKISYDPI-MVKLRXXXXXXXXXXXNQSLEEMENTDLIAKRAVFQ-----------EELDSLLN--------------------PNI--HHIIIDCSTWGYIDIVGVKILHQVIEEYKNVNISVLLANPKTDVRRMFYRIE-TSQLIHDENIFVSVHDAVINSL 1304
            +E IA G+ NIF+  F  +  + ++SRS VQE+ GGKTQ+  L+S +++L V++ IG L QPL   +LA++ +  LK MLM+F E+  LW    +D  +W++TF+F I L +  GL A VA  +++IV RTQ P    L  +  +++YKN   Y + +E  G+KIFR    IY+A    FK+ L   + + P+ +++ R + ++K  K   + L +M     I     F+           EELD  +N                    P I  H +I+D S   ++D+  ++ L  +++E+  + + V +     D      R E     + D   F+++HDA+++ L
Sbjct:  366 QELIALGVSNIFTGAFKGFAGSTALSRSGVQESTGGKTQVAGLLSAVIVLIVIVAIGFLLQPLQKSVLAALALGNLKGMLMQFAEIGRLWKKDKYDCLIWIMTFIFAIVLGLGLGLAASVAFQLLTIVFRTQFPKCSTLANVGRSNIYKNKKNYAEVYEPEGVKIFRCPSPIYFANIGFFKQKLIDAVGFSPLRILRKRNKALKKIRKLQKRGLIQMTPKGFICTSDGFKDSDEELDNNQIEELDQPINTTDLPFDIDWNGDLPLNITIPKISLHSLILDFSAVSFLDVSSMRGLRTILQEFIRIKVDVYIVGTDDDFIDKLARCEFFDDEVTDSIFFLTIHDAILHIL 714          

HSP 2 Score: 67.3958 bits (163), Expect = 1.777e-11
Identity = 45/122 (36.89%), Postives = 69/122 (56.56%), Query Frame = 1
Query:    1 YLSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYGIFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVVVAGTVSSQYLDLHNKYNVSVVGTIIQG 366
            YLS+ LISGFT  +AI V  +QLK+   + +  Y   FS++  L +V  Q+  TNI   V + I ++++ V K  IN     K+  PIPIEL++ V  T  S   +  +++ V+VVG +  G
Sbjct:  197 YLSESLISGFTTAAAIHVLVSQLKFMLQLPVPAYSDPFSIFKVLESVFTQIQKTNIADLVTSVIILVVVFVFKE-INQRYRSKLPVPIPIELIMTVIATGVSYGCNFEDRFGVAVVGNMSLG 317          
BLAST of STAS domain-containing protein vs. UniProt/SwissProt
Match: sp|P58743|S26A5_HUMAN (Prestin OS=Homo sapiens OX=9606 GN=SLC26A5 PE=1 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 1.238e-49
Identity = 119/345 (34.49%), Postives = 187/345 (54.20%), Query Frame = 3
Query:  363 REFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGDCHEIPGIKIFRYEGSIYYACKDHFKKSLYTKISYDP--IMVKLRXXXXXXXXXXXNQSL---------EEMENTDL--------------IAKRAVFQEELDSLLNP--NIHHIIIDCSTWGYIDIVGVKILHQVIEEYKNVNISVLLANPKTDV-----RRMFYRIETSQLIHDENIFVSVHDAVINS 1301
            +E IA GL N   S F  +  + S+SRS VQE  GGKTQ+   ++ ++IL V+L  G LF+ LP  +L++++IV LK M M+F +L   W  S  + ++W+ TF+ ++FL + YGLI  V +++++++ RTQSP+  +LG++  TD+Y ++  Y +  EIPGIKIF+    IYYA  D +  +L  K   +P  IM   R    +   +  N ++          E++  D               I  ++ F EE+   + P  N+H +I+D +   +ID VGVK L  +++EY +V I V LA     V     R  F+  E   L   E +F S+HDAV+ S
Sbjct:  373 QELIALGLCNSIGSLFQTFSISCSLSRSLVQEGTGGKTQLAGCLASLMILLVILATGFLFESLPQAVLSAIVIVNLKGMFMQFSDLPFFWRTSKIELTIWLTTFVSSLFLGLDYGLITAVIIALLTVIYRTQSPSYKVLGKLPETDVYIDIDAYEEVKEIPGIKIFQINAPIYYANSDLYSNALKRKTGVNPAVIMGARRKAMRKYAKEVGNANMANATVVKADAEVDGEDATKPEEEDGEVKYPPIVIKSTFPEEMQRFMPPGDNVHTVILDFTQVNFIDSVGVKTLAGIVKEYGDVGIYVYLAGCSAQVVNDLTRNRFF--ENPALW--ELLFHSIHDAVLGS 713          

HSP 2 Score: 84.3445 bits (207), Expect = 6.082e-16
Identity = 49/122 (40.16%), Postives = 70/122 (57.38%), Query Frame = 1
Query:    1 YLSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYGIFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVVVAGTVSSQYLDLHNKYNVSVVGTIIQG 366
            YL++PL+ GFT  +A+ VF++ LKY FGV   +Y GIFSV  + +AV + + N N+ +  +  +   LL   K   N    +K+  PIP+E   VV GT  S   +L   YNV VVGT+  G
Sbjct:  204 YLTEPLVRGFTTAAAVHVFTSMLKYLFGVKTKRYSGIFSVVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKE-FNERFKEKLPAPIPLEFFAVVMGTGISAGFNLKESYNVDVVGTLPLG 324          
BLAST of STAS domain-containing protein vs. UniProt/SwissProt
Match: sp|Q99NH7|S26A5_MOUSE (Prestin OS=Mus musculus OX=10090 GN=Slc26a5 PE=2 SV=3)

HSP 1 Score: 182.185 bits (461), Expect = 4.719e-49
Identity = 118/343 (34.40%), Postives = 184/343 (53.64%), Query Frame = 3
Query:  363 REFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGDCHEIPGIKIFRYEGSIYYACKDHFKKSLYTKISYDP--IMVKLRXXXXXXXXXXXNQSL-------------------EEMENTDL----IAKRAVFQEELDSLL--NPNIHHIIIDCSTWGYIDIVGVKILHQVIEEYKNVNISVLLANPKTDVRRMFYR---IETSQLIHDENIFVSVHDAVINS 1301
            +E IA G+ N   S F  +  + S+SRS VQE  GGKTQ+   ++ ++IL V+L  G LF+ LP  +L++++IV LK M M+F +L   W  S  + ++W+ TF+ ++FL + YGLI  V +++++++ RTQSP+  +LGQ+  TD+Y ++  Y +  EIPGIKIF+    IYYA  D +  +L  K   +P  IM   R    +   +  N ++                    E E+ ++    I  +  F EEL   L    N+H +I+D +   ++D VGVK L  +++EY +V I V LA     V     R    E   L   E +F S+HDAV+ S
Sbjct:  373 QELIALGICNSIGSLFQTFSISCSLSRSLVQEGTGGKTQLAGCLASLMILLVILATGFLFESLPQAVLSAIVIVNLKGMFMQFSDLPFFWRTSKIELTIWLTTFVSSLFLGLDYGLITAVIIALLTVIYRTQSPSYKVLGQLPDTDVYIDIDAYEEVKEIPGIKIFQINAPIYYANSDLYSSALKRKTGVNPALIMGARRKAMRKYAKEVGNANVANATVVKVDAEVDGENATKPEEEDDEVKFPPIVIKTTFPEELQRFLPQGENVHTVILDFTQVNFVDSVGVKTLAGIVKEYGDVGIYVYLAGCSPQVVNDLTRNNFFENPAL--KELLFHSIHDAVLGS 713          

HSP 2 Score: 85.5001 bits (210), Expect = 2.070e-16
Identity = 49/122 (40.16%), Postives = 71/122 (58.20%), Query Frame = 1
Query:    1 YLSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYGIFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVVVAGTVSSQYLDLHNKYNVSVVGTIIQG 366
            YL++PL+ GFT  +A+ VF++ LKY FGV   +Y GIFSV  + +AV + + N N+ +  +  +   LL   K   N    +K+  PIP+E   VV GT  S   +LH  Y+V VVGT+  G
Sbjct:  204 YLTEPLVRGFTTAAAVHVFTSMLKYLFGVKTKRYSGIFSVVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKE-FNERFKEKLPAPIPLEFFAVVMGTGISAGFNLHESYSVDVVGTLPLG 324          
BLAST of STAS domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9JKQ2|S26A5_MERUN (Prestin OS=Meriones unguiculatus OX=10047 GN=SLC26A5 PE=1 SV=1)

HSP 1 Score: 181.8 bits (460), Expect = 6.607e-49
Identity = 120/345 (34.78%), Postives = 186/345 (53.91%), Query Frame = 3
Query:  363 REFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGDCHEIPGIKIFRYEGSIYYACKDHFKKSLYTKISYDP--IMVKLRXXXXXXXXXXXNQSL-------------------EEMENTDL----IAKRAVFQEELDSLL--NPNIHHIIIDCSTWGYIDIVGVKILHQVIEEYKNVNISVLLANPKTDV-----RRMFYRIETSQLIHDENIFVSVHDAVINS 1301
            +E IA G+ N   S F  +  + S+SRS VQE  GGKTQ+   ++ ++IL V+L  G LF+ LP  +L++++IV LK M M+F +L   W  S  + ++W+ TF+ ++FL + YGLI  V +++++++ RTQSP+  +LGQ+  TD+Y ++  Y +  EIPGIKIF+    IYYA  D +  +L  K   +P  IM   R    +   +  N ++                    E E+ ++    I  +  F EEL   +    N+H II+D +   +ID VGVK L  +++EY +V I V LA     V     R  F+  E   L   E +F S+HDAV+ S
Sbjct:  373 QELIALGICNSIGSLFQTFSISCSLSRSLVQEGTGGKTQLAGCLASLMILLVILATGFLFESLPQAVLSAIVIVNLKGMFMQFSDLPFFWRTSKIELTIWLTTFVSSLFLGLDYGLITAVIIALLTVIYRTQSPSYKVLGQLPDTDVYIDIDAYEEVKEIPGIKIFQINAPIYYANSDLYSNALKRKTGVNPALIMGARRKAMRKYAKEVGNANIANAAVVKVDGEVDGENATKPEEEDDEVKYPPIVIKTTFPEELQRFMPQTENVHTIILDFTQVNFIDSVGVKTLAVMVKEYGDVGIYVYLAGCSPQVVNDLTRNRFF--ENPAL--KELLFHSIHDAVLGS 713          

HSP 2 Score: 85.5001 bits (210), Expect = 2.474e-16
Identity = 49/122 (40.16%), Postives = 71/122 (58.20%), Query Frame = 1
Query:    1 YLSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYGIFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVVVAGTVSSQYLDLHNKYNVSVVGTIIQG 366
            YL++PL+ GFT  +A+ VF++ LKY FGV   +Y GIFSV  + +AV + + N N+ +  +  +   LL   K   N    +K+  PIP+E   VV GT  S   +LH  Y+V VVGT+  G
Sbjct:  204 YLTEPLVRGFTTAAAVHVFTSMLKYLFGVKTKRYSGIFSVVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKE-FNERFKEKLPAPIPLEFFAVVMGTGISAGFNLHESYSVDVVGTLPLG 324          
BLAST of STAS domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9EPH0|S26A5_RAT (Prestin OS=Rattus norvegicus OX=10116 GN=Slc26a5 PE=1 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 1.173e-48
Identity = 118/346 (34.10%), Postives = 184/346 (53.18%), Query Frame = 3
Query:  363 REFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGDCHEIPGIKIFRYEGSIYYACKDHFKKSLYTKISYDP--IMVKLRXXXXXXXXXXXNQSL-------------------EEMENTDL----IAKRAVFQEELDSLL--NPNIHHIIIDCSTWGYIDIVGVKILHQVIEEYKNVNISVLLANPKTDV------RRMFYRIETSQLIHDENIFVSVHDAVINS 1301
            +E IA G+ N   S F  +  + S+SRS VQE  GGKTQ+   ++ ++IL V+L  G LF+ LP  +L++++IV LK M M+F +L   W  S  + ++W+ TF+ ++FL + YGLI  V +++++++ RTQSP+  +LGQ+  TD+Y ++  Y +  EIPGIKIF+    IYYA  D +  +L  K   +P  IM   R    +   +  N ++                    E E+ ++    I  +  F EEL   L    NIH +I+D +   ++D VGVK L  +++EY +V I V LA     V       R F      +L     +F S+HDAV+ S
Sbjct:  373 QELIALGICNSIGSLFQTFSISCSLSRSLVQEGTGGKTQLAGCLASLMILLVILATGFLFESLPQAVLSAIVIVNLKGMFMQFSDLPFFWRTSKIELTIWLTTFVSSLFLGLDYGLITAVIIALLTVIYRTQSPSYTVLGQLPDTDVYIDIDAYEEVKEIPGIKIFQINAPIYYANSDLYSSALKRKTGVNPAIIMGARRKAMRKYAKEVGNANIANATVVKVDAEVDGENATKPEEEDDEVKFPPIVIKTTFPEELQRFLPQGENIHTVILDFTQVNFMDSVGVKTLAGIVKEYGDVGIYVYLAGCSAQVVNDLTSNRFFENPALKEL-----LFHSIHDAVLGS 713          

HSP 2 Score: 85.5001 bits (210), Expect = 2.263e-16
Identity = 49/122 (40.16%), Postives = 71/122 (58.20%), Query Frame = 1
Query:    1 YLSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYGIFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVVVAGTVSSQYLDLHNKYNVSVVGTIIQG 366
            YL++PL+ GFT  +A+ VF++ LKY FGV   +Y GIFSV  + +AV + + N N+ +  +  +   LL   K   N    +K+  PIP+E   VV GT  S   +LH  Y+V VVGT+  G
Sbjct:  204 YLTEPLVRGFTTAAAVHVFTSMLKYLFGVKTKRYSGIFSVVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKE-FNERFKEKLPAPIPLEFFAVVMGTGISAGFNLHESYSVDVVGTLPLG 324          
BLAST of STAS domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8CIW6|S26A6_MOUSE (Solute carrier family 26 member 6 OS=Mus musculus OX=10090 GN=Slc26a6 PE=1 SV=2)

HSP 1 Score: 171.785 bits (434), Expect = 2.555e-45
Identity = 113/371 (30.46%), Postives = 192/371 (51.75%), Query Frame = 3
Query:  363 REFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGDCHEIPGIKIFRYEGSIYYACKDHFKKSLYTK--ISYDPIMVKLR------------------------XXXXXXXXXXXNQSLEEMENTDLIAKRA-VFQ-EELDSLLN---------------------PNIHHIIIDCSTWGYIDIVGVKILHQVIEEYKNVNISVLLANPKTDVRRMFYRIETSQL----IHDENIFVSVHDAVINSLYDHK 1316
            +E +A GL N+   FF C+P + S+SRS VQE+ GG TQ+   VS + IL +++ +G LF+ LP  +LA+VIIV LK M+ +F ++  LW  +  D  +W+VTF+ TI L++  GL   +  S++ +V+R Q P+  +LGQ+  TD+Y++VA Y    E+PG+K+FR   ++Y+A  + +  SL  K  +  D ++ + +                          KI      +N +LE++++ D+    A V Q EEL  +++                     P  H +I+D ST  ++D V +K L  +  +++ + + V +A   + V     ++E        I  +++F SVHDAV  +L   K
Sbjct:  379 QELVALGLSNLIGGFFQCFPVSCSMSRSLVQESTGGNTQVAGAVSSLFILLIIVKLGELFRDLPKAVLAAVIIVNLKGMMKQFSDICSLWKANRVDLLIWLVTFVATILLNLDIGLAVSIVFSLLLVVVRMQLPHYSVLGQVPDTDIYRDVAEYSGAKEVPGVKVFRSSATLYFANAELYSDSLKEKCGVDVDRLITQKKKRIKKQEMKLKRMKKAKKSQKQDASSKISSVSVNVNTNLEDVKSNDVEGSEAKVHQGEELQDVVSSNQEDAKAPTMTSLKSLGLPQPGFHSLILDLSTLSFVDTVCIKSLKNIFRDFREIEVEVYIAACYSPV---VAQLEAGHFFDESITKQHVFASVHDAVTFALSHRK 746          

HSP 2 Score: 83.9593 bits (206), Expect = 7.035e-16
Identity = 46/122 (37.70%), Postives = 74/122 (60.66%), Query Frame = 1
Query:    1 YLSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYGIFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVVVAGTVSSQYLDLHNKYNVSVVGTIIQG 366
            YLS+PL+  +T  +++ V  +QLKY FG+ ++ + G  SV  T++ VC QLP T +P  V+TAI   +  V   ++N  L +++  PIP ELL ++  T  S  + L++++ V VVG I  G
Sbjct:  210 YLSEPLVRSYTTAASVQVLVSQLKYVFGIKLSSHSGPLSVIYTVLEVCAQLPET-VPGTVVTAIVAGVALVLVKLLNEKLHRRLPLPIPGELLTLIGATGISYGVKLNDRFKVDVVGNITTG 330          
BLAST of STAS domain-containing protein vs. TrEMBL
Match: A0A0H3YFH1 (Slc26a-8 OS=Schmidtea mediterranea OX=79327 GN=slc26a-8 PE=2 SV=1)

HSP 1 Score: 393.66 bits (1010), Expect = 2.321e-126
Identity = 209/332 (62.95%), Postives = 259/332 (78.01%), Query Frame = 3
Query:  360 TREFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGD-----------CHEIPGIKIFRYEGSIYYACKDHFKKSLYTKISYDPIMVKLRXXXXXXXXXXXNQSLEEMENTDLIAKRAVFQEELDSLLNPNIHHIIIDCSTWGYIDIVGVKILHQVIEEYKNVNISVLLANPKTDVRRMFYRIETSQLIHDENIFVSVHDAVINSLYDHKIQ 1322
             +E IA+G+MN  +SFF CYPSA S+SRSAVQE+ GGKTQ+TSLVS  L+LFVLLFIGP+F  LPNCIL+++IIVALK M M+F ELKELWLFSIWDFS W+V FL T F+DV+YGL+ G+  SI+ I+LRTQ+P SHILGQI GTDLYKNV VY +           C EI GIKIFRYEGS+YYAC D+FK SLY KISY+P ++KLRI K+++K+KK+ Q     EN+    ++   + EL+ L +P IHH+IIDCSTWGYID VGVK L+QVIEEYK++NI+VLLANPKTDVR   +R + S +I D  IFVSVHDAVINS+Y+ K++
Sbjct:  411 NQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTSLVSSFLLLFVLLFIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSDNFKSSLYNKISYNPRLIKLRILKLERKLKKLKQHNNNFENSPFFEEKTQLETELEKLKHPIIHHLIIDCSTWGYIDYVGVKTLNQVIEEYKSINITVLLANPKTDVRATIFRNDASSIIDDRIIFVSVHDAVINSVYERKME 742          

HSP 2 Score: 125.176 bits (313), Expect = 6.659e-27
Identity = 69/122 (56.56%), Postives = 92/122 (75.41%), Query Frame = 1
Query:    1 YLSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYGIFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVVVAGTVSSQYLDLHNKYNVSVVGTIIQG 366
            YLSDPLISGFTVG+++ VF++Q+KYCFG+ I K +G+F++  T   + K LP TNIPT VLT + II+L VTK  INP ++KKI  PIP+EL+VV+ GTV S+YL L+  + V +VG I QG
Sbjct:  242 YLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNIPTLVLTVVVIIVLFVTKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQG 363          
BLAST of STAS domain-containing protein vs. TrEMBL
Match: A0A0H3YKD1 (Slc26a-4 OS=Schmidtea mediterranea OX=79327 GN=slc26a-4 PE=2 SV=1)

HSP 1 Score: 345.125 bits (884), Expect = 1.946e-110
Identity = 182/183 (99.45%), Postives = 183/183 (100.00%), Query Frame = 3
Query:  360 TREFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGDCHEIPGIKIFRYEGSIYYACKDHFKK 908
            T+EFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITSLVSVILILFVLLFIGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGDCHEIPGIKIFRYEGSIYYACKDHFKK
Sbjct:  303 TQEFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITSLVSVILILFVLLFIGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGDCHEIPGIKIFRYEGSIYYACKDHFKK 485          

HSP 2 Score: 242.276 bits (617), Expect = 1.020e-70
Identity = 122/122 (100.00%), Postives = 122/122 (100.00%), Query Frame = 1
Query:    1 YLSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYGIFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVVVAGTVSSQYLDLHNKYNVSVVGTIIQG 366
            YLSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYGIFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVVVAGTVSSQYLDLHNKYNVSVVGTIIQG
Sbjct:  134 YLSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYGIFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVVVAGTVSSQYLDLHNKYNVSVVGTIIQG 255          
BLAST of STAS domain-containing protein vs. TrEMBL
Match: A0A0H3YFG7 (Slc26a-3 OS=Schmidtea mediterranea OX=79327 GN=slc26a-3 PE=2 SV=1)

HSP 1 Score: 317.39 bits (812), Expect = 9.182e-100
Identity = 165/320 (51.56%), Postives = 242/320 (75.62%), Query Frame = 3
Query:  363 REFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGDCHEIPGIKIFRYEGSIYYACKDHFKKSLYTKISYDPIMVKLRXXXXXXXXXXXNQSLE-EMENTDLIAKRAVFQEELDSLLNPNIHHIIIDCSTWGYIDIVGVKILHQVIEEYKNVNISVLLANPKTDVRRMFYRIETSQLIHDENIFVSVHDAVINSLYDHKI 1319
            +EF+A+G+MN+F+SFF C+PSA S+SRSAVQE+ GGK+Q++SL+S IL++FVLLFIG  F+ LPNCILAS+IIVALK + MK  ELK+LW FS+ DFS+W++TFL T+ LDV+YGL+ G  LSI S+VL+TQ+P S+ILGQI  TD+Y N+++Y +C EI GIKIF+YEGS+YYA  ++FKK+LY KI  +PI +  + + ++ K+  I +  E E +  D + K++  +EELD L       IIIDCS + +ID +G+K ++QVIEEY+ +NISV L + K D+R+ F++  +   I+D+ +++S+HDAV++ L   ++
Sbjct:  182 QEFLAYGMMNVFASFFSCFPSAASLSRSAVQESVGGKSQLSSLISSILLVFVLLFIGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSECKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLNPIEIFFKKRSLENKLATIQKKFEKENQMPDFMEKKSTIEEELDQLNKSTEFSIIIDCSNFQFIDAMGMKTINQVIEEYQIINISVFLTSLKYDIRKKFHQFNSPCHINDKMVYLSIHDAVVSILRQRRV 501          

HSP 2 Score: 133.65 bits (335), Expect = 2.131e-30
Identity = 64/122 (52.46%), Postives = 85/122 (69.67%), Query Frame = 1
Query:    1 YLSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYGIFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVVVAGTVSSQYLDLHNKYNVSVVGTIIQG 366
            YLSDP+ISGFTVGS++ VF++Q+KYCFGV I  +YGIF+V NT+  V K +  TNIPT  +  I I LL  TK  INP +M +   P+P+EL VVV G ++S+Y  LH  + V +VG I +G
Sbjct:   12 YLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKG 133          
BLAST of STAS domain-containing protein vs. TrEMBL
Match: A0A1I8HM76 (STAS domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 261.536 bits (667), Expect = 9.458e-77
Identity = 145/335 (43.28%), Postives = 215/335 (64.18%), Query Frame = 3
Query:  360 TREFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGDCHEIPGIKIFRYEGSIYYACKDHFKKSLYTKISYDP--IMVKLR---------XXXXXXXXXXXNQSLEEM-ENTDLIAKRAVFQEELDSLLNPNIHHIIIDCSTWGYIDIVGVKILHQVIEEYKNVNISVLLANPKTDVRRMFYRIETSQLIHDENIFVSVHDAVINSLYDHKIQIE 1328
            ++E IA+G+ N   +FF+C+P+  S+SRSAVQ++ GGKTQ+ +LVS  L+L VLLF+G  F+ +PNC L+++I+VA+K ML +  E   LW  S +DF  W+VT L  + L V YGLI G+A S+ SI++RTQSP S ILG+I+GTDLYKNV  Y D  E+ G+KIFR+EGS+Y+AC ++F++SLY K   +P  I+ + R                   + ++   M E+    A +AV    LD    P + H+I+D STWGYID VGV+ L Q I+EY+++ ++V +ANPK  +R    R +  +    + I+VSVHDAV+ + +D +  + 
Sbjct:  297 SQELIAYGICNTVGAFFHCWPAGSSLSRSAVQDSMGGKTQVAALVSSTLLLLVLLFVGKYFETVPNCCLSAIILVAIKGMLEQVKEAPILWRLSPYDFWTWIVTCLGVVLLSVDYGLIMGLAFSVFSIIVRTQSPTSSILGRITGTDLYKNVHAYDDIEEVAGLKIFRFEGSLYFACAENFRESLYRKTGVNPRRIVQQRRRLGEKYARVTATSDASTATVKRTFTRMSESEKAEAAKAV---GLDWPRVP-VQHVILDASTWGYIDYVGVRALSQAIQEYRDIGVAVYIANPKCGIRACLERSDFYEKNRYDIIYVSVHDAVLAAQFDQRAALR 627          

HSP 2 Score: 100.908 bits (250), Expect = 5.531e-19
Identity = 54/122 (44.26%), Postives = 77/122 (63.11%), Query Frame = 1
Query:    1 YLSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYGIFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVVVAGTVSSQYLDLHNKYNVSVVGTIIQG 366
            YLSDPLISGFT+G A+ VFS+Q+KY  G+++    G+ S+      +   +  TN  T  + A+++++L VTK  +NP + KKI  P+P EL++V  GTV S   DL   YNV +VGTI  G
Sbjct:  127 YLSDPLISGFTMGVAVHVFSSQIKYVLGISVPGRNGLASLPLHYYDLACNIGQTNFVTLGIAAVAVVILYVTKEFVNPRVRKKIKAPLPTELIIVTLGTVISYAFDLKKNYNVKIVGTIPTG 248          
BLAST of STAS domain-containing protein vs. TrEMBL
Match: A0A1I8HTX0 (STAS domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 261.922 bits (668), Expect = 4.017e-75
Identity = 145/335 (43.28%), Postives = 215/335 (64.18%), Query Frame = 3
Query:  360 TREFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGDCHEIPGIKIFRYEGSIYYACKDHFKKSLYTKISYDP--IMVKLR---------XXXXXXXXXXXNQSLEEM-ENTDLIAKRAVFQEELDSLLNPNIHHIIIDCSTWGYIDIVGVKILHQVIEEYKNVNISVLLANPKTDVRRMFYRIETSQLIHDENIFVSVHDAVINSLYDHKIQIE 1328
            ++E IA+G+ N   +FF+C+P+  S+SRSAVQ++ GGKTQ+ +LVS  L+L VLLF+G  F+ +PNC L+++I+VA+K ML +  E   LW  S +DF  W+VT L  + L V YGLI G+A S+ SI++RTQSP S ILG+I+GTDLYKNV  Y D  E+ G+KIFR+EGS+Y+AC ++F++SLY K   +P  I+ + R                   + ++   M E+    A +AV    LD    P + H+I+D STWGYID VGV+ L Q I+EY+++ ++V +ANPK  +R    R +  +    + I+VSVHDAV+ + +D +  + 
Sbjct:  514 SQELIAYGICNTVGAFFHCWPAGSSLSRSAVQDSMGGKTQVAALVSSTLLLLVLLFVGKYFETVPNCCLSAIILVAIKGMLEQVKEAPILWRLSPYDFWTWIVTCLGVVLLSVDYGLIMGLAFSVFSIIVRTQSPTSSILGRITGTDLYKNVHAYDDIEEVAGLKIFRFEGSLYFACAENFRESLYRKTGVNPRRIVQQRRRLGEKYARVTATSDASTATVKRTFTRMSESEKAEAAKAV---GLDWPRVP-VQHVILDASTWGYIDYVGVRALSQAIQEYRDIGVAVYIANPKCGIRACLERSDFYEKNRYDIIYVSVHDAVLAAQFDQRAALR 844          

HSP 2 Score: 101.679 bits (252), Expect = 4.347e-19
Identity = 54/122 (44.26%), Postives = 77/122 (63.11%), Query Frame = 1
Query:    1 YLSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYGIFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVVVAGTVSSQYLDLHNKYNVSVVGTIIQG 366
            YLSDPLISGFT+G A+ VFS+Q+KY  G+++    G+ S+      +   +  TN  T  + A+++++L VTK  +NP + KKI  P+P EL++V  GTV S   DL   YNV +VGTI  G
Sbjct:  344 YLSDPLISGFTMGVAVHVFSSQIKYVLGISVPGRNGLASLPLHYYDLACNIGQTNFVTLGIAAVAVVILYVTKEFVNPRVRKKIKAPLPTELIIVTLGTVISYAFDLKKNYNVKIVGTIPTG 465          
BLAST of STAS domain-containing protein vs. Ensembl Cavefish
Match: slc26a10 (solute carrier family 26 member 10 [Source:NCBI gene;Acc:103043095])

HSP 1 Score: 186.808 bits (473), Expect = 6.601e-52
Identity = 102/315 (32.38%), Postives = 183/315 (58.10%), Query Frame = 3
Query:  363 REFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGDCHEIPGIKIFRYEGSIYYACKDHFKKSLYTKISYDPIMVKLRXXXXXXXXXXXNQSLEEME----NTDLIAKRAVFQEELDSLLNPNIHHIIIDCSTWGYIDIVGVKILHQVIEEYKNVNISVLLANPKTDVRRMFYRIETSQLIHDENIFVSVHDAVI 1295
            +E +A G+ N  SS F C+PS+ +++ + + E+AGG TQ++ L + +++L VLL IGPLF  LP  +LA + + +L+ M ++F +L +LW  S  DF VW+VT+L  + L+V  GL  GV  S+++++ RTQ     +LG+ S T++Y+ +  +  C+EIPG+KI  Y G IYY  +  FK  +   +   P  ++ R +  +   K+  +++  +E    NT   ++   F+ E+       +  +++DCS   ++D+ G K+  Q+  E + + + + LAN   +V ++         ++ ++IFV+VHDAVI
Sbjct:  361 QELLAHGISNTVSSLFTCFPSSATLATTNILESAGGYTQLSGLFTSLVVLVVLLLIGPLFYFLPKAVLACINVTSLRQMFLQFQDLPDLWRVSRIDFMVWLVTWLSVVVLNVDLGLAIGVVFSMMTVICRTQRAGCSVLGRASNTEIYRPINNHNKCYEIPGVKILTYNGPIYYGNRSFFKADVNQLLGLTPERIRSREKARKALEKREREAINTVERGVANTSFSSENEFFKSEMS---ENEVQAVLMDCSGVVFVDVAGAKLFIQMCIECQKMGVRIYLANCNENVLKILTSSGLMNYMNPQHIFVTVHDAVI 672          

HSP 2 Score: 72.7886 bits (177), Expect = 3.222e-13
Identity = 40/122 (32.79%), Postives = 70/122 (57.38%), Query Frame = 1
Query:    1 YLSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYGIFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVVVAGTVSSQYLDLHNKYNVSVVGTIIQG 366
            YLS+P+I  FT  +A  V  +QL+   G+ + ++ G FS++ TL +V + LP+TN+   +++ + + +L   K V N    + +  PIP+E+L V+  T  +    L + Y+V +VG I  G
Sbjct:  192 YLSEPIIKAFTSAAAFHVTISQLQSMLGLRLPRHTGTFSLFKTLASVLENLPHTNLAELLISLVCLAVLIPIKEV-NTRFRQHLRTPIPVEILTVIIATGVAYAFSLDSTYDVQIVGHIPAG 312          
BLAST of STAS domain-containing protein vs. Ensembl Cavefish
Match: slc26a2 (solute carrier family 26 member 2 [Source:NCBI gene;Acc:103047169])

HSP 1 Score: 181.8 bits (460), Expect = 4.518e-50
Identity = 108/315 (34.29%), Postives = 181/315 (57.46%), Query Frame = 3
Query:  363 REFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGDCHEIPGIKIFRYEGSIYYACKDHFKKSLYTKISYDPIMVKLRXXXXXXXXXXXNQSLEEMENTDLIAKRAVFQEELDSLLNPNIHHIIIDCSTWGYIDIVGVKILHQVIEEYKNVNISVLLANPKTDV-----RRMFYRIETSQLIHDENIFVSVHDAV 1292
            +E  A G  NIF SFF C+ ++ +++++ V+E+ G +TQ++ L++ +++L VLL I PLF  L  C+LA +I+V L+  L KF ++ ++W  +  D ++W+VT   +  ++ + GL+ GV +S  S++ RTQ   +  LGQ    ++++++A Y   H  PG+ +FRYE  IYYA +  FKKSLY  +  DP+  K R  + + + +   ++LE+    D  A   +F  +      P  H +IIDCS   ++D  GV  L +V ++YK + + +LLA   T V     R  +Y  +T      ENIF ++ DAV
Sbjct:  377 QEMYAIGFCNIFPSFFRCFTTSAALTKTLVKESTGCQTQVSGLITALVLLLVLLVIAPLFYSLQKCVLAVIIVVNLRGALRKFRDVPQMWRTNRVDATIWLVTMATSALVNTELGLLVGVLVSAFSVLGRTQRAQAFKLGQAGDYEIFEDLASYKGLHTHPGVAVFRYEAPIYYANQTLFKKSLYRNVGLDPVKEKAR--RKKLEKQNKQKTLEDGVKQDHEASTNMFLSQ-----GPAFHTLIIDCSAVLFLDTAGVGALKEVHKDYKELGVRLLLAQCNTSVIDSLRRAGYYDHKTGS---PENIFHTISDAV 681          

HSP 2 Score: 76.6406 bits (187), Expect = 1.674e-14
Identity = 42/122 (34.43%), Postives = 67/122 (54.92%), Query Frame = 1
Query:    1 YLSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYGIFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVVVAGTVSSQYLDLHNKYNVSVVGTIIQG 366
            +LSD L+SGF  G+++ + ++QLKY  G+ + +  G  S+  T I++   L  TNI   + + I +++L  TK  +N     K+  PIP EL VV+  T++S +     KY   V G I  G
Sbjct:  208 FLSDSLLSGFATGASLTILTSQLKYLLGLKLPRAQGWGSLIKTWISLLTNLGQTNICDLITSLICLLVLIPTKE-LNDRFKSKLKAPIPFELFVVIIATLASHFGQFQEKYGSGVAGAIPTG 328          
BLAST of STAS domain-containing protein vs. Ensembl Cavefish
Match: slc26a5 (solute carrier family 26 member 5 [Source:NCBI gene;Acc:103036170])

HSP 1 Score: 167.548 bits (423), Expect = 8.333e-45
Identity = 117/354 (33.05%), Postives = 182/354 (51.41%), Query Frame = 3
Query:  363 REFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGDCHEIPGIKIFRYEGSIYYACKDHFKKSLYTKISYDPIMVKLRXXXXXXXXXXXNQSLEEMENTDLIAKR----------AVFQEELDS---------------------------LLNP--NIHHIIIDCSTWGYIDIVGVKILHQVIEEYKNVNISVLLANPK----TDVRRMFYRIETSQLIHDENIFVSVHDAVI 1295
            +E IA GL N  SSFF  +    S+SRS VQE+ GGKTQI  L+  +L+L V++ IG +F+PLP  +LA+VI+V L  M  +  ++  LW  S  + +VW+V F+ ++ L + +GL+  V  +I++++ RTQ P S ILGQI  T LY ++  Y +  E  G+KIF    SIY+A  D +   L  K   DP  +    +  QK  K   +  + ++++    KR           V  E LD                             L P   +H II+D +   ++D VG+K +  VI+EY  V++ V+LA       +D+R+M +    S  +  + IF ++HDAV+
Sbjct:  382 QEMIALGLCNFASSFFQTFVITSSMSRSLVQESTGGKTQIAGLLGSLLVLLVIVAIGFMFEPLPQTVLAAVIMVNLLGMFKQVRDIPALWRTSKIELAVWLVAFVASVLLGLDFGLLVAVGFAILTVIYRTQRPKSVILGQIPNTGLYYDIDEYEEASECSGVKIFHSNSSIYFANSDQYVNHLKDKTGIDPTRLLAERKSQQKHAKTKKEEKKNLKDSSSPQKRNAVAKLDMELGVAHEVLDESEKQVELHGNGQLPEAQSEICDSEKVLFLQPLCPVHSIILDFTPVNFMDSVGIKAIKAVIKEYAAVDVRVVLAGCNRTLLSDLRKMQF---FSGPVTTDIIFPTIHDAVL 732          

HSP 2 Score: 88.1965 bits (217), Expect = 3.184e-18
Identity = 51/122 (41.80%), Postives = 74/122 (60.66%), Query Frame = 1
Query:    1 YLSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYGIFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVVVAGTVSSQYLDLHNKYNVSVVGTIIQG 366
            YL++PL+ GFT  +AI VF +QLKY FGV   ++ G  SV  +LIAV K + +TN+ T ++  + I+ L   K+V N    KK+  PIP E++VV+  T  S  + L   Y V +VG+I  G
Sbjct:  213 YLAEPLVRGFTTAAAIHVFVSQLKYLFGVKTKRFSGPLSVLYSLIAVFKDITSTNVTTLIVGLVCIVFLYSVKDV-NERFKKKLPIPIPGEIIVVIVSTGVSYGMALFENYQVDIVGSIPVG 333          
BLAST of STAS domain-containing protein vs. Ensembl Cavefish
Match: slc26a1 (sulfate anion transporter 1-like [Source:NCBI gene;Acc:103035611])

HSP 1 Score: 162.925 bits (411), Expect = 2.345e-43
Identity = 102/284 (35.92%), Postives = 175/284 (61.62%), Query Frame = 3
Query:  363 REFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGDCHEIPGIKIFRYEGSIYYACKDHFKKSLYTKISYDPIMVKLRXXXXXXXXXXXNQSLEEMENTDLIAKRAVFQEELDSLLNPNIHHIIIDCSTWGYIDIVGVKILHQVIEEYKNVNISVLLANPKTDV 1214
            +E +A G  NI  SFF+C+ ++ +++++ V+++ G +TQ++S+VS +++L VLLF+ P F  L  C+LA +IIV+L+  L KF ++  LW  S  D +VW+VT      + V+ GL+ GV +S+I +V++TQ P + +LGQI  T+ Y+++  Y     +P IKIFR++  +YYA K+ F KSLY  +  +P + K R +K++KK K+        +N +      +   ELD       H II+DCS+  +ID  G+     ++++YK +++S++LA   T+V
Sbjct:  390 QEMLAIGFCNIIPSFFHCFTTSAALAKTMVKDSTGCQTQVSSVVSALVVLLVLLFLAPFFYSLQKCVLACIIIVSLRGALRKFRDVPTLWRLSKIDAAVWIVTMFSAALISVEIGLVIGVVVSMICVVVQTQFPKASLLGQIENTNHYEDMDDYSHLVSVPKIKIFRFQAPLYYANKEFFLKSLYKAVGLEPFLEKTRRKKMEKKAKERAAKKTMGDNDNGDVSIGLIAPELD------FHTIILDCSSMSFIDTTGITTFKGLLKDYKEISVSIILACCNTNV 667          

HSP 2 Score: 70.8626 bits (172), Expect = 1.198e-12
Identity = 40/122 (32.79%), Postives = 66/122 (54.10%), Query Frame = 1
Query:    1 YLSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYGIFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVVVAGTVSSQYLDLHNKYNVSVVGTIIQG 366
            YLS P++ GF  G++  + + Q KY  G+ I ++ G  +V  T I + K +  TN    + +AI I +L   K + +     ++  P+P EL+VV   TV S + DL+ +Y+ S+ G I  G
Sbjct:  221 YLSAPMLDGFATGASCTILTVQAKYLLGLKIPRHQGYGTVVVTWINIFKNIHKTNFCDMITSAICIAVLVAGKELQDR-YKNRLKMPLPTELVVVGLATVVSHFADLNGQYSSSISGAIPTG 341          
BLAST of STAS domain-containing protein vs. Ensembl Cavefish
Match: slc26a1 (sulfate anion transporter 1-like [Source:NCBI gene;Acc:103035611])

HSP 1 Score: 162.925 bits (411), Expect = 2.345e-43
Identity = 102/284 (35.92%), Postives = 175/284 (61.62%), Query Frame = 3
Query:  363 REFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGDCHEIPGIKIFRYEGSIYYACKDHFKKSLYTKISYDPIMVKLRXXXXXXXXXXXNQSLEEMENTDLIAKRAVFQEELDSLLNPNIHHIIIDCSTWGYIDIVGVKILHQVIEEYKNVNISVLLANPKTDV 1214
            +E +A G  NI  SFF+C+ ++ +++++ V+++ G +TQ++S+VS +++L VLLF+ P F  L  C+LA +IIV+L+  L KF ++  LW  S  D +VW+VT      + V+ GL+ GV +S+I +V++TQ P + +LGQI  T+ Y+++  Y     +P IKIFR++  +YYA K+ F KSLY  +  +P + K R +K++KK K+        +N +      +   ELD       H II+DCS+  +ID  G+     ++++YK +++S++LA   T+V
Sbjct:  390 QEMLAIGFCNIIPSFFHCFTTSAALAKTMVKDSTGCQTQVSSVVSALVVLLVLLFLAPFFYSLQKCVLACIIIVSLRGALRKFRDVPTLWRLSKIDAAVWIVTMFSAALISVEIGLVIGVVVSMICVVVQTQFPKASLLGQIENTNHYEDMDDYSHLVSVPKIKIFRFQAPLYYANKEFFLKSLYKAVGLEPFLEKTRRKKMEKKAKERAAKKTMGDNDNGDVSIGLIAPELD------FHTIILDCSSMSFIDTTGITTFKGLLKDYKEISVSIILACCNTNV 667          

HSP 2 Score: 70.8626 bits (172), Expect = 1.198e-12
Identity = 40/122 (32.79%), Postives = 66/122 (54.10%), Query Frame = 1
Query:    1 YLSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYGIFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVVVAGTVSSQYLDLHNKYNVSVVGTIIQG 366
            YLS P++ GF  G++  + + Q KY  G+ I ++ G  +V  T I + K +  TN    + +AI I +L   K + +     ++  P+P EL+VV   TV S + DL+ +Y+ S+ G I  G
Sbjct:  221 YLSAPMLDGFATGASCTILTVQAKYLLGLKIPRHQGYGTVVVTWINIFKNIHKTNFCDMITSAICIAVLVAGKELQDR-YKNRLKMPLPTELVVVGLATVVSHFADLNGQYSSSISGAIPTG 341          
BLAST of STAS domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003427.1 (pep scaffold:Pmarinus_7.0:GL476526:256569:262630:-1 gene:ENSPMAG00000003117.1 transcript:ENSPMAT00000003427.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 175.252 bits (443), Expect = 2.606e-48
Identity = 99/313 (31.63%), Postives = 185/313 (59.11%), Query Frame = 3
Query:  363 REFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGT-DLYKNVAVYGDCHEIPGIKIFRYEGSIYYACKDHFKKSLYTKISYDPIMVKLRXXXXXXXXXXXNQSLEEMENTDLIAKRAVFQEELDSLLNP-NIHHIIIDCSTWGYIDIVGVKILHQVIEEYKNVNISVLLANPKTDVRRMFYRIETSQLIHDENIFVSVHDAVI 1295
            +E IA G  NI  +FFY + ++ +++++ V+EA G +TQ++++V+  ++L VLL I PLF  L  C+L  + IV L+    KF+++  +W  S  D S+W VT L +  +  + GL+ GV +S++  ++RTQ P + + G +  T + Y ++  Y +  E+PG+++F ++  +YYA K++FK  L+ K   +P + ++  QK +++  +  + L   +N +++ K+A+   E + LL   + H I+IDCS   ++D VGV  +  ++++Y+++ I V+LA     V    +R +    I D   F  +HDAV+
Sbjct:  388 QEMIAIGFCNIVPAFFYSFTTSAALAKTLVKEATGCQTQMSAVVTAGVLLLVLLLIAPLFYSLQKCVLGVITIVNLRGAFRKFLDIPRMWQESRVDTSIWFVTMLASALISTEIGLLVGVCVSLLVFIVRTQRPRAALYGCVHDTNNFYADLEAYSNVAEVPGVRVFHFDAPLYYANKEYFKSQLFLKTRVNPAL-EVAAQKKRQEKLQKRKKLSGSDNGEIVNKQAML--EFNKLLPTFDFHTIVIDCSAMQFMDSVGVGAVKSIMKDYQSIGIRVILACCNPTVMDSLHRGKCISTIEDNLTFCLIHDAVL 697          

HSP 2 Score: 80.1073 bits (196), Expect = 2.417e-16
Identity = 45/124 (36.29%), Postives = 72/124 (58.06%), Query Frame = 1
Query:    1 YLSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYGIFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVVVAGTVSSQYLDLHNKYNVSVVGTIIQGNL 372
            YLS+P++SGF  GS++ V ++Q+KY  G+ I +  G  ++  T   +  Q+ NTN+   V+T+I  IL+ V    +N     ++  P PIEL+VVVA T++S +      Y+ S+ G I  G L
Sbjct:  219 YLSEPMLSGFVTGSSLTVLTSQMKYLLGIHIPRASGAGALLKTWYHIFSQISNTNVCD-VVTSIICILVLVPAKELNEHFKARLKAPFPIELVVVVAATLASHFGGFKENYSSSIAGHIPTGFL 341          
BLAST of STAS domain-containing protein vs. Ensembl Sea Lamprey
Match: si:ch211-117c9.2 (si:ch211-117c9.2 [Source:ZFIN;Acc:ZDB-GENE-110408-11])

HSP 1 Score: 166.392 bits (420), Expect = 6.916e-46
Identity = 110/342 (32.16%), Postives = 182/342 (53.22%), Query Frame = 3
Query:  351 DYYTREFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXGPLFQPLP---NCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGDCHEIPGIKIFRYEGSIYYACKDHFKKSLYTKISYDP-----IMVKLRXXXXXXXXXXXNQSLEEMENTDLIAKRAVF-------------------QEELDSLLNPNIHHIIIDCSTWGYIDIVGVKILHQVIEEYKNVNISVLLANPKTDVRRMFYRIE-TSQLIHDENIFVSVHDAV 1292
            D   +E +A GL NIF S F+ +  + ++SRS VQ+A GG+TQ+  LVS +L+L V+L I  LF+PLP      LA+V++V LK M  +F ++ +LW     D ++WMVTF  ++ L +  GL   V+ +++S+V+RTQ+P   ILG+I  TD+Y ++  Y +  E+ GI+IF+   S+Y+A  D + ++L +K   DP     +  K    + + + K+  ++  E ++  L    AV                    + E   L +P    +++D     ++D  GVK+L ++ +E+K V + V LA  +  V     R    S       +F+SV DAV
Sbjct:  195 DSNQQELVAIGLSNIFGSIFHSFTISCAMSRSLVQDATGGQTQVAGLVSALLVLIVILAISSLFRPLPRSGQAALAAVVLVNLKGMFKQFADVPQLWRTCRIDLAMWMVTFWASVLLGLDLGLAVAVSFALLSVVIRTQTPKYSILGKIPNTDIYLDLKEYAEAKEVSGIRIFQTNASLYFANADMYTEALISKTGLDPRSLIAVRKKFLAHQQRLERKRRREAGTEAKSATLNLGEAVTRGGEAVDGAEAGHVVLPLEESEEQGLTSPAYRFLVLDFGAVTFVDTPGVKMLKRIFQEHKEVGVQVCLAGCRAVVVTQLERTGFLSGPSSKAQLFLSVPDAV 536          

HSP 2 Score: 87.4261 bits (215), Expect = 8.627e-19
Identity = 46/122 (37.70%), Postives = 74/122 (60.66%), Query Frame = 1
Query:    1 YLSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYGIFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVVVAGTVSSQYLDLHNKYNVSVVGTIIQG 366
            YLS+P++ GFT   +I V  TQLKY FGV++++Y G  +   T I  C  L +TN+ + +L  I  + LA +K  +      ++  PIP+EL++VV  T++S  L+L+ K+ V ++G I  G
Sbjct:   29 YLSEPMVRGFTTACSIHVCVTQLKYMFGVSVSRYSGPLASEQTTIEFCSHLGHTNLVSLLLCVICTVGLAGSKE-LGDRYRNRLPAPIPLELILVVLATLASSGLELNEKHAVDIIGDIPTG 149          
BLAST of STAS domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003699.1 (pep scaffold:Pmarinus_7.0:GL480994:8326:18126:1 gene:ENSPMAG00000003383.1 transcript:ENSPMAT00000003699.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 86.2705 bits (212), Expect = 1.157e-19
Identity = 50/125 (40.00%), Postives = 75/125 (60.00%), Query Frame = 1
Query:    1 YLSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYG---IFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVVVAGTVSSQYLDLHNKYNVSVVGTIIQG 366
            YLSDPL+S FT  +AI V  +Q+K   G+ + ++ G   IF V+ T++ + ++LPNTNI   V + + + +L   +  IN     K+  PIP+ELL++V  TV S Y  L  K+ V+VVG I  G
Sbjct:   15 YLSDPLVSAFTNAAAIHVLVSQIKNMLGLQVPRFSGPASIFMVFQTMVDIFQKLPNTNIAELVTSLVCLTVLIPVRE-INQRYKSKLKAPIPVELLLIVLATVISFYARLEEKFGVTVVGNIPAG 138          

HSP 2 Score: 54.6842 bits (130), Expect = 6.637e-9
Identity = 21/40 (52.50%), Postives = 30/40 (75.00%), Query Frame = 3
Query:  363 REFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQI 482
            +E  A G+ N+F SFF C+PSA S+SR+++QE  GG TQ+
Sbjct:  187 QELFAHGVCNLFGSFFQCFPSAASISRTSIQEGTGGNTQV 226          
BLAST of STAS domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006617.1 (pep scaffold:Pmarinus_7.0:GL482475:5949:18084:-1 gene:ENSPMAG00000005984.1 transcript:ENSPMAT00000006617.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.4546 bits (132), Expect = 2.002e-9
Identity = 39/124 (31.45%), Postives = 75/124 (60.48%), Query Frame = 1
Query:    1 YLSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYG-IFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPI-LMKKIHFPIPIELLVVVAGTVSSQYLDLHNKYNVSVVGTIIQG 366
            YLS+PL+ GF+  +++ V  +QLK+  G+ + + +  +    +T   VC+ +   N+ T +++ +S+  + + K V++ +  ++++  P+P ELL+VV GTV S+ L L   ++V VVG I  G
Sbjct:   20 YLSEPLVRGFSTAASVTVLVSQLKHLLGLALPRRHDQVLGTLHTARDVCRGVLQVNVVTALVSLLSLCSMLLLKRVVHSVPRLRRV--PVPAELLLVVLGTVLSEQLQLSPDHSVDVVGLIPSG 141          
BLAST of STAS domain-containing protein vs. Ensembl Yeast
Match: YPR003C_mRNA (Putative sulfate permease; physically interacts with Hsp82p; green fluorescent protein (GFP)-fusion protein localizes to the ER; YPR003C is not an essential gene [Source:SGD;Acc:S000006207])

HSP 1 Score: 67.0106 bits (162), Expect = 2.364e-12
Identity = 71/306 (23.20%), Postives = 123/306 (40.20%), Query Frame = 3
Query:  363 REFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFS---VWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVY-----------GDCHEIPGIKIFRYEGSIYYACKDHFKKSLYTKISYDPIMVKLRXXXXXXXXXXXNQSLEEMENTDLIAKRAVFQEELDSLLNPNIHHIIIDCSTWGYIDIVGVKILHQVIEEYKNVNISVLLANPKTD--VRRMFYR 1232
            RE +A G MNI  S F   P+ G   RS +   +G ++ ++ +   ++ L  +  +      +PNC+L SVI   +   L++ V     +      FS   V+ VTF  TIF  ++ G+  G   SII+I+  +      IL +++GT  + N+  Y               EI G  I R    + +   +  K+ L                            +E   ++ +   R   + + DS     I ++I D      ID    ++L ++I  YK  N+ + L N   +  VRR  ++
Sbjct:  409 RELVALGFMNIVISLFGALPAFGGYGRSKINALSGAQSVMSGVFMGVITLITMNLLLQFVHYIPNCVL-SVITTIIGISLLEEVPGDIKFHLRCGGFSELFVFAVTFCTTIFYSIEAGICIGCVYSIINIIKHSAKSRIQILARVAGTSNFTNLDDYMMNMKRNSLDVEGTEEIEGCMIVRIPEPLTFTNSEDLKQRL--------------------------DRIERYGSSKIHPGRKSLRSK-DS-----IKYVIFDLGGMTSIDSSAAQVLEEIITSYKRRNVFIYLVNVSINDKVRRRLFK 681          
BLAST of STAS domain-containing protein vs. Ensembl Yeast
Match: SUL2 (High affinity sulfate permease; sulfate uptake is mediated by specific sulfate transporters Sul1p and Sul2p, which control the concentration of endogenous activated sulfate intermediates [Source:SGD;Acc:S000004082])

HSP 1 Score: 65.855 bits (159), Expect = 5.732e-12
Identity = 42/142 (29.58%), Postives = 73/142 (51.41%), Query Frame = 3
Query:  363 REFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQI 788
            +E IA G+ N+  +FF  YP+ GS SRSA++     +T ++ L S   +L  L  +   F  +P   L++VII A+  +L  +      W  +  DF  ++VT L T+F  ++ G+   +  S   ++L+   P    LG++
Sbjct:  442 QELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCAMLILKVAFPAGKFLGRV 583          
BLAST of STAS domain-containing protein vs. Ensembl Yeast
Match: SUL1 (High affinity sulfate permease of the SulP anion transporter family; sulfate uptake is mediated by specific sulfate transporters Sul1p and Sul2p, which control the concentration of endogenous activated sulfate intermediates [Source:SGD;Acc:S000000498])

HSP 1 Score: 59.6918 bits (143), Expect = 5.928e-10
Identity = 38/142 (26.76%), Postives = 71/142 (50.00%), Query Frame = 3
Query:  363 REFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQI 788
            +E IA G+ N+  +FF+ YP+ GS SRSA++     +T  + + +   +L  L  +   F  +P   L++VII A+  +L  +      W  +  D   ++VT   T+F  ++ G+   +  S   ++L+   P    LG++
Sbjct:  426 QELIAIGVTNLIGTFFHSYPATGSFSRSALKAKCNVRTPFSGVFTGGCVLLALYCLTDAFFFIPKATLSAVIIHAVSDLLTSYKTTWTFWKTNPLDCISFIVTVFITVFSSIENGIYFAMCWSCAMLLLKQAFPAGKFLGRV 567          
BLAST of STAS domain-containing protein vs. Ensembl Nematostella
Match: EDO49691 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG03])

HSP 1 Score: 135.191 bits (339), Expect = 4.386e-34
Identity = 102/320 (31.87%), Postives = 167/320 (52.19%), Query Frame = 3
Query:  363 REFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGDCHEIPGIKIFRYEGSIYYACKDHFKKSLYTKISYDPIMVKLRXXXXXXXXXXXNQSLE---EMENTDLIAKRAVFQEELDSLLNPNIHHIIIDCSTWGYIDIVGVKILHQVIEEYKNVNISVLLANPKTDVRRMFYRIETSQLIHDENIFVSVHDAVINSLYDH 1313
            +E +A+G+ N+  SFF C+P   +++R+ VQE     TQ+ S+  + LIL VLLF+ PLF  LP  ILA+V+I  L  +L +F  L++LW     D   W VT    I L V  GL  GV  +I  +++R   P   ILG I  T+LY++         IP +KI R+E S+++A     K+ + + +  +P+    R         +   ++E   E E+ D   KR   ++     +N NI  +I+D S + +ID VG+  +  +I E  +  + V LA     +R+          ++++++FVS+HDAV+ +L  H
Sbjct:  394 QELLAYGMCNVGGSFFSCFPICNALARTVVQENLA-STQLCSIPVICLILLVLLFMAPLFYYLPKAILAAVVIANLGGLLKQFARLRQLWCICRTDAVTWFVTCFGVILLGVDLGLGLGVITTIFVVIIRQSRPRVSILGHIKDTELYRDTQECPQAAGIPNVKILRFESSLFFANAGFIKERIMSFM--NPLTPTKRECIPGITTDEAEVTMELNAEKESLD-TTKRTNREQG----VNANIKAVIVDASAFTFIDSVGITAIKTIITEGDSRGVHVCLAACSYHLRKQLEAGGLEPSLNNDHLFVSIHDAVLFTLQAH 705          

HSP 2 Score: 81.6481 bits (200), Expect = 1.796e-16
Identity = 48/122 (39.34%), Postives = 72/122 (59.02%), Query Frame = 1
Query:    1 YLSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYGIFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVVVAGTVSSQYLDLHNKYNVSVVGTIIQG 366
            YLSDPLISGFT GSA++V  +QLK+ FG  + +  G F+       + K + ++N P  ++T +  +++ VT   IN    K++  PIP ELLVV  GT  S    L +++ V V+G I +G
Sbjct:  225 YLSDPLISGFTTGSAVLVVLSQLKHIFGQVVPQNTGAFASIKVAAHMLKFIASSN-PGAIITGVLCLVILVTLKFINEKYKKRLPIPIPAELLVVALGTAISYGASLSDEFGVKVLGEIPKG 345          
BLAST of STAS domain-containing protein vs. Ensembl Nematostella
Match: EDO48275 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJJ6])

HSP 1 Score: 66.2402 bits (160), Expect = 1.103e-11
Identity = 41/125 (32.80%), Postives = 72/125 (57.60%), Query Frame = 3
Query:  360 TREFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSI 734
            ++E IA GL N+ SSF   YP  GS SR+AV   +G  T    + +  +++  L  + P F+ +P   LA++II ++ +M ++F  +  +W     D    +VTF F  F +++YG++AG+ +S+
Sbjct:  348 SQELIALGLANVLSSFVSSYPVTGSFSRTAVNAQSGVATPAGGIFTGAIVILALGVLTPFFKYIPKASLAALIISSVLTM-VEFQIVPRIWRVKKIDLIPLLVTF-FGCFYEIEYGILAGMGVSL 470          
BLAST of STAS domain-containing protein vs. Ensembl Medaka
Match: slc26a10 (solute carrier family 26 member 10 [Source:NCBI gene;Acc:101171246])

HSP 1 Score: 189.889 bits (481), Expect = 4.101e-53
Identity = 106/319 (33.23%), Postives = 188/319 (58.93%), Query Frame = 3
Query:  363 REFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGDCHEIPGIKIFRYEGSIYYACKDHFKKSLYTKISYDPIMVKLRXXXXXXXXXXXNQSLEEMENTDLI--AKRAVFQEELDSLLN-------PNIHHIIIDCSTWGYIDIVGVKILHQVIEEYKNVNISVLLANPKTDVRRMFYRIETSQLIHDENIFVSVHDAV 1292
            +E +A G+ N  S+FF C+PS+ +++ + + E+AGG TQ+  L + +++L VLL IGPLF  LP  +LA + + +L+ ML++F +L ELW  S  DF VW+VT+L  + L+V  GL  GV  S+++I+ RTQ     +LG+ S T++Y+ +  +  C+E+PG+KI  Y G IYY  +  F++ +   +   P  ++ R        +K  ++LE+ E+  +I   +R +      S+ +        ++  ++IDCS+  +ID+ G ++  Q+  + +N+ +SV LAN   +V ++         ++ ++IFV+VHDAV
Sbjct:  361 QELLAHGISNAVSAFFTCFPSSATLATTNILESAGGHTQLCGLFTSLVVLVVLLLIGPLFYFLPKAVLACINVTSLRQMLLQFQDLPELWRISKLDFMVWIVTWLSVVVLNVDLGLAIGVVFSMMTIICRTQRVACSVLGRASNTEIYRPLENHNKCYEVPGVKILTYNGPIYYGNRSFFREQMSKLLGLTPEKIRRR--------EKAKKALEKQESETVICTVERGIANTSFSSVSDFFKSASESDLEAVLIDCSSVIFIDVAGARLFTQMCTQCQNIGVSVYLANCNENVLKIMTSSGLMSHMNPQHIFVTVHDAV 671          

HSP 2 Score: 70.4774 bits (171), Expect = 1.383e-12
Identity = 39/122 (31.97%), Postives = 68/122 (55.74%), Query Frame = 1
Query:    1 YLSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYGIFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVVVAGTVSSQYLDLHNKYNVSVVGTIIQG 366
            YLS+P++  F   +A  V  +QL+   G+ + ++ G FS + TL++V + LP+TN    +++ +S+ +L   K  IN     ++  PIP+E+L V+  T       L + YN+ +VG I  G
Sbjct:  192 YLSEPIVKAFISAAAFHVTISQLQSMLGLRLPRHTGNFSFFKTLVSVMENLPHTNTAELIISLVSLAVLVPVKE-INVRFRHRLRTPIPVEILTVIIATCVVYASSLDSIYNIEIVGDIPAG 312          
BLAST of STAS domain-containing protein vs. Ensembl Medaka
Match: slc26a1 (sulfate anion transporter 1 [Source:NCBI gene;Acc:101158870])

HSP 1 Score: 171.4 bits (433), Expect = 2.690e-46
Identity = 107/326 (32.82%), Postives = 182/326 (55.83%), Query Frame = 3
Query:  363 REFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGDCHEIPGIKIFRYEGSIYYACKDHFKKSLYTKISYDPIM-VKLRXXXXXXXXXXXNQSLEEMENTDLIAKRAVFQEELDSLLNPNIHHIIIDCSTWGYIDIVGVKILHQVIEEYKNVNISVLLANPKTDVRRMFYRIETSQLIHDEN---IFVSVHDAVINSLYDHKIQIE 1328
            +E +A GL N+  SFF+ + ++ +++++ V+++ G +TQ++SL+S +++L VLLF  P F  L  C+LA +IIV+L+  L KF E+   W  S  D  VW++T   T  + V+ GL+ G+  S++ I+ +TQ+P   +LG++S TDLY+++  Y      P + IFR++  +YYA K+ F KSLY  +  +P + +  R +  + K K   Q+    +N D+        +ELD       H I++DCS   +ID  G   L  +++EYK++ +SVLLA     V     + +       E    +F +VH AV ++  +H    E
Sbjct:  381 QEMVAIGLCNVIPSFFHSFTTSAALAKTMVKDSTGCQTQVSSLISALVVLLVLLFFAPFFHALQKCVLACIIIVSLRGALRKFKEVPAKWRASKNDAIVWLITMFATALISVELGLLVGIIFSMVCIIFKTQNPKFSLLGRVSDTDLYEDLEEYTGLTPPPQVHIFRFQAPLYYANKESFLKSLYKAVGVEPFLELTKRRKAEKAKGKSSKQAKANKKNGDVFI--GPIHKELD------FHTIVLDCSAIPFIDSSGTATLKVLVKEYKDIGVSVLLACCNASVIDALRKAQVFGKNDREMSSLLFYTVHAAVFHAGQEHAEAAE 698          

HSP 2 Score: 69.3218 bits (168), Expect = 3.715e-12
Identity = 38/122 (31.15%), Postives = 66/122 (54.10%), Query Frame = 1
Query:    1 YLSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYGIFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVVVAGTVSSQYLDLHNKYNVSVVGTIIQG 366
            YLS P++ GF  G++  + + Q KY  G+ I +++G  +V  T   +   +  TN+   + +AI I +L   K  I      ++  P+P EL+VV   T++S +  L+++Y+ SV G I  G
Sbjct:  212 YLSAPMLDGFATGASFTILTVQAKYLLGLKIPRHHGYGTVPVTWFNIFANIHKTNVCDLITSAICISILVAGKE-IQDRYKNRLKIPLPTELVVVAGATLASHFGKLNSRYSSSVSGHIPTG 332          
BLAST of STAS domain-containing protein vs. Ensembl Medaka
Match: slc26a1 (sulfate anion transporter 1 [Source:NCBI gene;Acc:101158870])

HSP 1 Score: 171.4 bits (433), Expect = 2.690e-46
Identity = 107/326 (32.82%), Postives = 182/326 (55.83%), Query Frame = 3
Query:  363 REFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGDCHEIPGIKIFRYEGSIYYACKDHFKKSLYTKISYDPIM-VKLRXXXXXXXXXXXNQSLEEMENTDLIAKRAVFQEELDSLLNPNIHHIIIDCSTWGYIDIVGVKILHQVIEEYKNVNISVLLANPKTDVRRMFYRIETSQLIHDEN---IFVSVHDAVINSLYDHKIQIE 1328
            +E +A GL N+  SFF+ + ++ +++++ V+++ G +TQ++SL+S +++L VLLF  P F  L  C+LA +IIV+L+  L KF E+   W  S  D  VW++T   T  + V+ GL+ G+  S++ I+ +TQ+P   +LG++S TDLY+++  Y      P + IFR++  +YYA K+ F KSLY  +  +P + +  R +  + K K   Q+    +N D+        +ELD       H I++DCS   +ID  G   L  +++EYK++ +SVLLA     V     + +       E    +F +VH AV ++  +H    E
Sbjct:  381 QEMVAIGLCNVIPSFFHSFTTSAALAKTMVKDSTGCQTQVSSLISALVVLLVLLFFAPFFHALQKCVLACIIIVSLRGALRKFKEVPAKWRASKNDAIVWLITMFATALISVELGLLVGIIFSMVCIIFKTQNPKFSLLGRVSDTDLYEDLEEYTGLTPPPQVHIFRFQAPLYYANKESFLKSLYKAVGVEPFLELTKRRKAEKAKGKSSKQAKANKKNGDVFI--GPIHKELD------FHTIVLDCSAIPFIDSSGTATLKVLVKEYKDIGVSVLLACCNASVIDALRKAQVFGKNDREMSSLLFYTVHAAVFHAGQEHAEAAE 698          

HSP 2 Score: 69.3218 bits (168), Expect = 3.715e-12
Identity = 38/122 (31.15%), Postives = 66/122 (54.10%), Query Frame = 1
Query:    1 YLSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYGIFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVVVAGTVSSQYLDLHNKYNVSVVGTIIQG 366
            YLS P++ GF  G++  + + Q KY  G+ I +++G  +V  T   +   +  TN+   + +AI I +L   K  I      ++  P+P EL+VV   T++S +  L+++Y+ SV G I  G
Sbjct:  212 YLSAPMLDGFATGASFTILTVQAKYLLGLKIPRHHGYGTVPVTWFNIFANIHKTNVCDLITSAICISILVAGKE-IQDRYKNRLKIPLPTELVVVAGATLASHFGKLNSRYSSSVSGHIPTG 332          
BLAST of STAS domain-containing protein vs. Ensembl Medaka
Match: si:ch211-117c9.2 (solute carrier family 26 member 6 [Source:NCBI gene;Acc:101162048])

HSP 1 Score: 164.466 bits (415), Expect = 9.284e-44
Identity = 112/359 (31.20%), Postives = 183/359 (50.97%), Query Frame = 3
Query:  363 REFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGDCHEIPGIKIFRYEGSIYYACKDHFKKSLYTKISYD----PIMVKLRXXXXXXXXXXXNQSLEEMENTDLIAKRAVF---------------------QEELDSL------LNP--------------NIHHIIIDCSTWGYIDIVGVKILHQVIEEYKNVNISVLLANPKTDVRRMFYRIETSQLIHDENIFVSVHDAVINSL 1304
            +E IA GL N   SFF CY    S+SRS VQE+ GG TQI  +VS +L+L +++ IG LF+ LP  +L++++ V LK M  +F+++  LW  +  D  VW+VTF+ T+  ++  GL   V  S+++ + +TQ P+  ILG +  TDLY +   +    EIPGIKIFR   +I +   + + ++L  +   D     +  K R ++ +   K++ +SL + +N  +    A+F                       E+DS       L P                H II+D ST G++D V VK+L  +  ++ +V++ + LA  +  V     +    + I    +FV+VHDAV++ L
Sbjct:  372 QELIAVGLSNTIGSFFQCYAVTASLSRSLVQESTGGNTQIAGVVSSLLMLIMVIRIGSLFEDLPKAVLSTIVFVNLKGMFRQFMDVPLLWKTNKVDLLVWLVTFISTVLFNLDLGLALSVGFSMLTFIFKTQLPHYSILGNVPSTDLYLDTEAFKQVKEIPGIKIFRSSATICFTNAELYLEALQQRSGLDVRKLQMEKKKRAKQEKMAKKEVKKSLNKEKNLSMHKDVAIFLTNTSSNGFGHVNSAYQYDATTSEIDSGCHGENNLTPISYEHEKDGRTCMSVTHSIILDISTTGFVDTVTVKMLKNIFGDFADVDVDIYLAGCQACVVEQLEKAAFFESIPKTRLFVTVHDAVLHIL 730          

HSP 2 Score: 95.9005 bits (237), Expect = 1.174e-20
Identity = 49/122 (40.16%), Postives = 76/122 (62.30%), Query Frame = 1
Query:    1 YLSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYGIFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVVVAGTVSSQYLDLHNKYNVSVVGTIIQG 366
            YLS+PL+ G+T G+A  V  +QLKY FGV  A++ G FS+  T++ +C+ LP T +P  V++ +++ +L V K  IN    KK+  P+PIEL+VV+  T+   +  +   Y + VVG I  G
Sbjct:  203 YLSEPLVRGYTTGAACHVCVSQLKYLFGVKPARFTGPFSLIYTIVDICRLLPQTRVPELVVSLVALAVLIVVKE-INACYSKKLPLPVPIELIVVIGATIIIHFCGVREDYLIDVVGEIPSG 323          
BLAST of STAS domain-containing protein vs. Ensembl Medaka
Match: slc26a6 (solute carrier family 26 member 6 [Source:NCBI gene;Acc:101169607])

HSP 1 Score: 161.384 bits (407), Expect = 7.677e-43
Identity = 104/316 (32.91%), Postives = 173/316 (54.75%), Query Frame = 3
Query:  363 REFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGDCHEIPGIKIFRYEGSIYYACKDHFKKSLYTKISYDPIMVKLRXXXXXXXXXXXNQSLEEMENTDLIAKRAVFQEELDSLLNPNI-HHIIIDCSTWGYIDIVGVKILHQVIEEYKNVNISVLLANPKTDVRRMFYRIETSQLIHDE----NIFVSVHDAVI 1295
            +E +A GL N     F C+  + S+SRS VQE++GGKTQ+   +S ++ILF+ L+IG LF+ LP  +LA++I V L+ ML +F+++  LW  S  D  +W+ TF+ T+ L+   GL A +A S+++++ RTQ P   ILG++  TD+YK +  Y    E+PGI IFR   ++Y+A  + ++++L  K  +D                      EE E+  +I         +D   NP++   II+D S   ++D VGVK +  +  +Y  + I V+LA  +  V      +E     +++     +F ++HDAV+
Sbjct:  368 QELVALGLSNSIGGIFQCFAISCSMSRSLVQESSGGKTQVAGALSAVVILFITLWIGTLFEDLPKAVLAAIIHVNLQGMLKQFMDIFALWKSSKIDMMIWIATFILTLLLNPDLGLAASIAFSMLTVIFRTQLPKYSILGRVEDTDIYKPLDGYSKVKELPGILIFRSSATLYFANAEMYQEALGKKEQHDN---------------------EEPEDIAVI--------HVDPEPNPSLPQAIILDLSPVNFLDTVGVKTIRNIRRDYGEIGIEVVLAACQPGVVD---NLEAGGFFNEKVTKSCLFSTIHDAVL 651          

HSP 2 Score: 98.5969 bits (244), Expect = 1.179e-21
Identity = 54/122 (44.26%), Postives = 77/122 (63.11%), Query Frame = 1
Query:    1 YLSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYGIFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVVVAGTVSSQYLDLHNKYNVSVVGTIIQG 366
            YLS+PL+ G+T  +AI V  +QLKY FG++  +Y G  S+  T+I +C  LP TNI T V+T ++I+ L + K  +N  L KKI  PIP EL+ ++  T+ S  +DL  KY + VVG I  G
Sbjct:  199 YLSEPLVRGYTTAAAIHVIVSQLKYSFGISPDRYSGPLSLIYTVIEICYLLPKTNIGTLVVTLVAILGLFLAKE-LNAYLSKKIPVPIPTELIAIIIATIVSWQVDLSGKYGIDVVGEIPSG 319          
BLAST of STAS domain-containing protein vs. Planmine SMEST
Match: SMESG000064566.1 (SMESG000064566.1)

HSP 1 Score: 607.831 bits (1566), Expect = 0.000e+0
Identity = 322/325 (99.08%), Postives = 325/325 (100.00%), Query Frame = 3
Query:  360 TREFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGDCHEIPGIKIFRYEGSIYYACKDHFKKSLYTKISYDPIMVKLRXXXXXXXXXXXNQSLEEMENTDLIAKRAVFQEELDSLLNPNIHHIIIDCSTWGYIDIVGVKILHQVIEEYKNVNISVLLANPKTDVRRMFYRIETSQLIHDENIFVSVHDAVINSLYDHKIQIECL 1334
            T+EFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITSLVSVILILFVLLFIGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGDCHEIPGIKIFRYEGSIYYACKDHFKKSLYTKISYDPIMVKLRI+KIQKKIKKINQSLEEMENTDLIAKRAVFQEELDSLLNPNIHHIIIDCSTWGYIDIVGVKILHQVIEEYKNVNISVLLANPKTDVRRMFYRIETSQLIHDENIFVSVHDAVINSLY+HKIQIECL
Sbjct:  303 TQEFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITSLVSVILILFVLLFIGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGDCHEIPGIKIFRYEGSIYYACKDHFKKSLYTKISYDPIMVKLRIEKIQKKIKKINQSLEEMENTDLIAKRAVFQEELDSLLNPNIHHIIIDCSTWGYIDIVGVKILHQVIEEYKNVNISVLLANPKTDVRRMFYRIETSQLIHDENIFVSVHDAVINSLYNHKIQIECL 627          

HSP 2 Score: 243.432 bits (620), Expect = 1.710e-73
Identity = 122/122 (100.00%), Postives = 122/122 (100.00%), Query Frame = 1
Query:    1 YLSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYGIFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVVVAGTVSSQYLDLHNKYNVSVVGTIIQG 366
            YLSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYGIFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVVVAGTVSSQYLDLHNKYNVSVVGTIIQG
Sbjct:  134 YLSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYGIFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVVVAGTVSSQYLDLHNKYNVSVVGTIIQG 255          
BLAST of STAS domain-containing protein vs. Planmine SMEST
Match: SMESG000064571.1 (SMESG000064571.1)

HSP 1 Score: 452.981 bits (1164), Expect = 1.420e-154
Identity = 243/265 (91.70%), Postives = 258/265 (97.36%), Query Frame = 3
Query:  360 TREFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGDCHEIPGIKIFRYEGSIYYACKDHFKKSLYTKISYDPIMVKLRXXXXXXXXXXXNQSLEEMENTDLIAKRAVFQEELDSLLNPNIHHIIIDCSTWGYIDIVGVKILHQV 1154
            T+EFIAFGLMNIFSSFFYCYPS  SVSRSAVQE+AGGKTQITSLVS +LILFVLLFIGPLF+ LPNC+LASVIIVALKSMLMKFVELKELWLFSIWDFSVW++TFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNS+ILGQISGTDLYKNVAVY DCHEIPGIKIFRYEGS+YYAC DHFKKSLYTKISYDPIMVKLRIQK+QKKIKKINQSLEEMENT+LI +RAVFQ+ELD+LLNP+IHHIIIDCSTWGYIDIVGVKILHQV
Sbjct:  369 TQEFIAFGLMNIFSSFFYCYPSGASVSRSAVQESAGGKTQITSLVSAVLILFVLLFIGPLFKQLPNCLLASVIIVALKSMLMKFVELKELWLFSIWDFSVWVITFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSYILGQISGTDLYKNVAVYTDCHEIPGIKIFRYEGSLYYACGDHFKKSLYTKISYDPIMVKLRIQKVQKKIKKINQSLEEMENTELIVQRAVFQKELDALLNPDIHHIIIDCSTWGYIDIVGVKILHQV 633          

HSP 2 Score: 214.927 bits (546), Expect = 7.998e-63
Identity = 103/122 (84.43%), Postives = 115/122 (94.26%), Query Frame = 1
Query:    1 YLSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYGIFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVVVAGTVSSQYLDLHNKYNVSVVGTIIQG 366
            YLSDPLISGFTVGSAIIVFSTQLKYCFGVTI KYYGIFSVWNT+IAVCK+LP+TN+PT VLTAISII+LAVTKNV+NPILMKKIHFPIP+ELL++V GTVSS +L LH+KYNVS+VG I QG
Sbjct:  200 YLSDPLISGFTVGSAIIVFSTQLKYCFGVTIQKYYGIFSVWNTIIAVCKELPHTNVPTMVLTAISIIILAVTKNVVNPILMKKIHFPIPVELLLIVTGTVSSHFLRLHDKYNVSIVGNIDQG 321          
BLAST of STAS domain-containing protein vs. Planmine SMEST
Match: SMESG000064571.1 (SMESG000064571.1)

HSP 1 Score: 413.305 bits (1061), Expect = 9.432e-140
Identity = 229/265 (86.42%), Postives = 242/265 (91.32%), Query Frame = 3
Query:  360 TREFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGDCHEIPGIKIFRYEGSIYYACKDHFKKSLYTKISYDPIMVKLRXXXXXXXXXXXNQSLEEMENTDLIAKRAVFQEELDSLLNPNIHHIIIDCSTWGYIDIVGVKILHQV 1154
            T+EFIAFGLMNIFSSFFYCYPS  SVSRSAVQE+AGGKTQITSLVS +LILFVLLFIGPLF+ LPNC+LASVIIVALKSMLMKFVELKELWLFSIWDF                YGLIAGVALSIISIVLRTQSPNS+ILGQISGTDLYKNVAVY DCHEIPGIKIFRYEGS+YYAC DHFKKSLYTKISYDPIMVKLRIQK+QKKIKKINQSLEEMENT+LI +RAVFQ+ELD+LLNP+IHHIIIDCSTWGYIDIVGVKILHQV
Sbjct:  332 TQEFIAFGLMNIFSSFFYCYPSGASVSRSAVQESAGGKTQITSLVSAVLILFVLLFIGPLFKQLPNCLLASVIIVALKSMLMKFVELKELWLFSIWDF----------------YGLIAGVALSIISIVLRTQSPNSYILGQISGTDLYKNVAVYTDCHEIPGIKIFRYEGSLYYACGDHFKKSLYTKISYDPIMVKLRIQKVQKKIKKINQSLEEMENTELIVQRAVFQKELDALLNPDIHHIIIDCSTWGYIDIVGVKILHQV 580          

HSP 2 Score: 214.157 bits (544), Expect = 5.819e-63
Identity = 103/122 (84.43%), Postives = 115/122 (94.26%), Query Frame = 1
Query:    1 YLSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYGIFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVVVAGTVSSQYLDLHNKYNVSVVGTIIQG 366
            YLSDPLISGFTVGSAIIVFSTQLKYCFGVTI KYYGIFSVWNT+IAVCK+LP+TN+PT VLTAISII+LAVTKNV+NPILMKKIHFPIP+ELL++V GTVSS +L LH+KYNVS+VG I QG
Sbjct:  163 YLSDPLISGFTVGSAIIVFSTQLKYCFGVTIQKYYGIFSVWNTIIAVCKELPHTNVPTMVLTAISIIILAVTKNVVNPILMKKIHFPIPVELLLIVTGTVSSHFLRLHDKYNVSIVGNIDQG 284          
BLAST of STAS domain-containing protein vs. Planmine SMEST
Match: SMESG000064562.1 (SMESG000064562.1)

HSP 1 Score: 404.445 bits (1038), Expect = 3.228e-134
Identity = 210/321 (65.42%), Postives = 260/321 (81.00%), Query Frame = 3
Query:  360 TREFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGDCHEIPGIKIFRYEGSIYYACKDHFKKSLYTKISYDPIMVKLRXXXXXXXXXXXNQSLEEMENTDLIAKRAVFQEELDSLLNPNIHHIIIDCSTWGYIDIVGVKILHQVIEEYKNVNISVLLANPKTDVRRMFYRIETSQLIHDENIFVSVHDAVINSLYDHKIQ 1322
             +E IA+G+MN  +SFF CYPSA S+SRSAVQE+ GGKTQ+TSLVS  L+LFVLLFIGP+F  LPNCIL+++IIVALK M M+F ELKELWLFSIWDFS W+V FL T F+DV+YGL+ G+  SI+ I+LRTQ+P SHILGQI GTDLYKNV VY +C EI GIKIFRYEGS+YYAC D+FK SLY KISY+P ++KLRI K+++K+KK+ Q     EN+    ++A  + EL+ L +P IHH+IIDCSTWGYID VGVK L+QVIEEYK++NI+VLLANPKTDVR   +R + S +I D  IFVSVHDAVINS+Y+ K++
Sbjct:  411 NQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTSLVSSFLLLFVLLFIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNECEEIDGIKIFRYEGSLYYACSDNFKSSLYNKISYNPRLIKLRILKLERKLKKLKQHNNNFENSPFFEEKAQLETELEKLKHPIIHHLIIDCSTWGYIDYVGVKTLNQVIEEYKSINITVLLANPKTDVRATIFRNDASSIIDDRIIFVSVHDAVINSVYERKME 731          

HSP 2 Score: 125.561 bits (314), Expect = 1.471e-30
Identity = 69/122 (56.56%), Postives = 92/122 (75.41%), Query Frame = 1
Query:    1 YLSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYGIFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVVVAGTVSSQYLDLHNKYNVSVVGTIIQG 366
            YLSDPLISGFTVG+++ VF++Q+KYCFG+ I K +G+F++  T   + K LP TNIPT VLT + II+L VTK  INP ++KKI  PIP+EL+VV+ GTV S+YL L+  + V +VG I QG
Sbjct:  242 YLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNIPTLVLTVVVIIVLFVTKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQG 363          
BLAST of STAS domain-containing protein vs. Planmine SMEST
Match: SMESG000064562.1 (SMESG000064562.1)

HSP 1 Score: 395.201 bits (1014), Expect = 1.650e-130
Identity = 210/332 (63.25%), Postives = 260/332 (78.31%), Query Frame = 3
Query:  360 TREFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITXXXXXXXXXXXXXXXGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGD-----------CHEIPGIKIFRYEGSIYYACKDHFKKSLYTKISYDPIMVKLRXXXXXXXXXXXNQSLEEMENTDLIAKRAVFQEELDSLLNPNIHHIIIDCSTWGYIDIVGVKILHQVIEEYKNVNISVLLANPKTDVRRMFYRIETSQLIHDENIFVSVHDAVINSLYDHKIQ 1322
             +E IA+G+MN  +SFF CYPSA S+SRSAVQE+ GGKTQ+TSLVS  L+LFVLLFIGP+F  LPNCIL+++IIVALK M M+F ELKELWLFSIWDFS W+V FL T F+DV+YGL+ G+  SI+ I+LRTQ+P SHILGQI GTDLYKNV VY +           C EI GIKIFRYEGS+YYAC D+FK SLY KISY+P ++KLRI K+++K+KK+ Q     EN+    ++A  + EL+ L +P IHH+IIDCSTWGYID VGVK L+QVIEEYK++NI+VLLANPKTDVR   +R + S +I D  IFVSVHDAVINS+Y+ K++
Sbjct:  411 NQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTSLVSSFLLLFVLLFIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSDNFKSSLYNKISYNPRLIKLRILKLERKLKKLKQHNNNFENSPFFEEKAQLETELEKLKHPIIHHLIIDCSTWGYIDYVGVKTLNQVIEEYKSINITVLLANPKTDVRATIFRNDASSIIDDRIIFVSVHDAVINSVYERKME 742          

HSP 2 Score: 125.176 bits (313), Expect = 1.768e-30
Identity = 69/122 (56.56%), Postives = 92/122 (75.41%), Query Frame = 1
Query:    1 YLSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYGIFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVVVAGTVSSQYLDLHNKYNVSVVGTIIQG 366
            YLSDPLISGFTVG+++ VF++Q+KYCFG+ I K +G+F++  T   + K LP TNIPT VLT + II+L VTK  INP ++KKI  PIP+EL+VV+ GTV S+YL L+  + V +VG I QG
Sbjct:  242 YLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNIPTLVLTVVVIIVLFVTKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQG 363          
The following BLAST results are available for this feature:
BLAST of STAS domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC26A52.041e-5034.49solute carrier family 26 member 5 [Source:HGNC Sym... [more]
SLC26A52.579e-5034.49solute carrier family 26 member 5 [Source:HGNC Sym... [more]
SLC26A55.203e-5034.29solute carrier family 26 member 5 [Source:HGNC Sym... [more]
SLC26A55.203e-5034.29solute carrier family 26 member 5 [Source:HGNC Sym... [more]
SLC26A51.241e-4834.19solute carrier family 26 member 5 [Source:HGNC Sym... [more]
back to top
BLAST of STAS domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sulp-61.305e-4431.30SULfate Permease family [Source:UniProtKB/TrEMBL;... [more]
sulp-61.305e-4431.30SULfate Permease family [Source:UniProtKB/TrEMBL;... [more]
sulp-42.371e-3631.14Anion transporter SULP-4; SULfate Permease family ... [more]
sulp-24.491e-3629.91Anion transporter SULP-2; SULfate Permease family ... [more]
sulp-34.685e-3628.75Sulfate permease family protein 3 [Source:UniProt... [more]
back to top
BLAST of STAS domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Prestin1.058e-4930.89gene:FBgn0036770 transcript:FBtr0075153[more]
CG61252.174e-1529.78gene:FBgn0038337 transcript:FBtr0083106[more]
CG61252.246e-1529.78gene:FBgn0038337 transcript:FBtr0346109[more]
CG61252.246e-1529.78gene:FBgn0038337 transcript:FBtr0083105[more]
CG69282.215e-1134.07gene:FBgn0036240 transcript:FBtr0076049[more]
back to top
BLAST of STAS domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc26a101.190e-5131.19solute carrier family 26 member 10 [Source:ZFIN;Ac... [more]
slc26a101.190e-5131.19solute carrier family 26 member 10 [Source:ZFIN;Ac... [more]
slc26a101.906e-5131.11solute carrier family 26 member 10 [Source:ZFIN;Ac... [more]
slc26a3.13.373e-4431.14solute carrier family 26 member 3 [Source:ZFIN;Acc... [more]
slc26a41.870e-4331.99solute carrier family 26 member 4 [Source:ZFIN;Acc... [more]
back to top
BLAST of STAS domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc26a63.763e-5142.93solute carrier family 26 member 6 [Source:NCBI gen... [more]
SLC26A57.597e-5034.76solute carrier family 26 member 5 [Source:NCBI gen... [more]
smyd43.410e-4733.02SET and MYND domain containing 4 [Source:Xenbase;A... [more]
ENSXETT00000026575.14.684e-4734.07pep primary_assembly:Xenopus_tropicalis_v9.1:3:346... [more]
SLC26A55.380e-4632.11solute carrier family 26 member 5 [Source:NCBI gen... [more]
back to top
BLAST of STAS domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc26a54.780e-5034.40solute carrier family 26, member 5 [Source:MGI Sym... [more]
Slc26a56.746e-5034.40solute carrier family 26, member 5 [Source:MGI Sym... [more]
Slc26a22.868e-4433.23solute carrier family 26 (sulfate transporter), me... [more]
Slc26a24.552e-4332.90solute carrier family 26 (sulfate transporter), me... [more]
Slc26a39.123e-4230.66solute carrier family 26, member 3 [Source:MGI Sym... [more]
back to top
BLAST of STAS domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P58743|S26A5_HUMAN1.238e-4934.49Prestin OS=Homo sapiens OX=9606 GN=SLC26A5 PE=1 SV... [more]
sp|Q99NH7|S26A5_MOUSE4.719e-4934.40Prestin OS=Mus musculus OX=10090 GN=Slc26a5 PE=2 S... [more]
sp|Q9JKQ2|S26A5_MERUN6.607e-4934.78Prestin OS=Meriones unguiculatus OX=10047 GN=SLC26... [more]
sp|Q9EPH0|S26A5_RAT1.173e-4834.10Prestin OS=Rattus norvegicus OX=10116 GN=Slc26a5 P... [more]
sp|Q8CIW6|S26A6_MOUSE2.555e-4530.46Solute carrier family 26 member 6 OS=Mus musculus ... [more]
back to top
BLAST of STAS domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YFH12.321e-12662.95Slc26a-8 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A0H3YKD11.946e-11099.45Slc26a-4 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A0H3YFG79.182e-10051.56Slc26a-3 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A1I8HM769.458e-7743.28STAS domain-containing protein OS=Macrostomum lign... [more]
A0A1I8HTX04.017e-7543.28STAS domain-containing protein OS=Macrostomum lign... [more]
back to top
BLAST of STAS domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc26a106.601e-5232.38solute carrier family 26 member 10 [Source:NCBI ge... [more]
slc26a24.518e-5034.29solute carrier family 26 member 2 [Source:NCBI gen... [more]
slc26a58.333e-4533.05solute carrier family 26 member 5 [Source:NCBI gen... [more]
slc26a12.345e-4335.92sulfate anion transporter 1-like [Source:NCBI gene... [more]
slc26a12.345e-4335.92sulfate anion transporter 1-like [Source:NCBI gene... [more]
back to top
BLAST of STAS domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000003427.12.606e-4831.63pep scaffold:Pmarinus_7.0:GL476526:256569:262630:-... [more]
si:ch211-117c9.26.916e-4632.16si:ch211-117c9.2 [Source:ZFIN;Acc:ZDB-GENE-110408-... [more]
ENSPMAT00000003699.11.157e-1940.00pep scaffold:Pmarinus_7.0:GL480994:8326:18126:1 ge... [more]
ENSPMAT00000006617.12.002e-931.45pep scaffold:Pmarinus_7.0:GL482475:5949:18084:-1 g... [more]
back to top
BLAST of STAS domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
YPR003C_mRNA2.364e-1223.20Putative sulfate permease; physically interacts wi... [more]
SUL25.732e-1229.58High affinity sulfate permease; sulfate uptake is ... [more]
SUL15.928e-1026.76High affinity sulfate permease of the SulP anion t... [more]
back to top
BLAST of STAS domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO496914.386e-3431.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482751.103e-1132.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of STAS domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc26a104.101e-5333.23solute carrier family 26 member 10 [Source:NCBI ge... [more]
slc26a12.690e-4632.82sulfate anion transporter 1 [Source:NCBI gene;Acc:... [more]
slc26a12.690e-4632.82sulfate anion transporter 1 [Source:NCBI gene;Acc:... [more]
si:ch211-117c9.29.284e-4431.20solute carrier family 26 member 6 [Source:NCBI gen... [more]
slc26a67.677e-4332.91solute carrier family 26 member 6 [Source:NCBI gen... [more]
back to top
BLAST of STAS domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000064566.11.710e-7399.08SMESG000064566.1[more]
SMESG000064571.11.420e-15491.70SMESG000064571.1[more]
SMESG000064571.19.432e-14086.42SMESG000064571.1[more]
SMESG000064562.13.228e-13465.42SMESG000064562.1[more]
SMESG000064562.11.650e-13063.25SMESG000064562.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031995 ID=SMED30031995|Name=STAS domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1373bp
TATTTATCGGATCCACTGATATCTGGATTTACTGTTGGATCAGCTATAAT
TGTATTTTCAACCCAACTGAAATATTGTTTCGGAGTAACTATAGCAAAAT
ATTACGGGATTTTCAGTGTGTGGAATACATTAATTGCGGTTTGTAAGCAA
TTACCTAACACAAATATTCCAACTTTTGTTTTAACTGCTATTTCCATAAT
TTTATTGGCAGTTACTAAAAATGTTATCAATCCAATTTTAATGAAGAAAA
TTCATTTTCCTATTCCAATTGAATTATTGGTGGTCGTTGCTGGAACTGTC
TCTTCTCAATATTTAGATCTTCATAATAAATACAATGTATCAGTAGTCGG
GACTATTATACAAGGGAATTTATCGCGTTTGGATTGATGAATATTTTTTC
ATCTTTCTTTTATTGTTATCCGTCGGCGGGTTCGGTTAGTCGTTCTGCTG
TCCAAGAAGCGGCTGGAGGGAAAACGCAAATCACTTCATTAGTGTCGGTG
ATTTTGATATTATTTGTCTTATTATTTATTGGTCCTCTATTTCAACCTCT
GCCCAATTGCATACTGGCCTCGGTGATAATTGTAGCTTTGAAGAGCATGT
TAATGAAATTTGTTGAATTAAAAGAATTATGGTTATTTTCAATTTGGGAT
TTTAGCGTCTGGATGGTCACATTTTTGTTTACGATTTTCCTTGATGTTCA
GTATGGACTAATTGCTGGGGTAGCTTTGTCAATTATTTCAATTGTTTTAC
GAACTCAAAGTCCCAACTCGCACATTCTTGGTCAGATTTCAGGAACGGAT
TTATATAAAAATGTGGCAGTATATGGTGATTGTCATGAAATTCCTGGAAT
AAAAATATTTCGATATGAAGGCAGCATTTACTATGCTTGTAAAGATCACT
TCAAGAAATCGCTTTATACAAAGATTTCCTACGATCCGATAATGGTCAAG
TTAAGAATCCAAAAAATACAAAAGAAAATTAAAAAAATAAATCAAAGCTT
AGAAGAAATGGAAAATACAGATTTAATAGCCAAAAGAGCAGTTTTTCAAG
AAGAATTGGATTCGCTATTGAATCCGAATATACATCACATTATAATTGAC
TGCTCCACTTGGGGATACATTGACATTGTTGGAGTTAAAATTTTACATCA
GGTAATTGAAGAATACAAAAATGTGAATATTTCTGTCTTATTAGCCAATC
CAAAAACTGATGTCCGAAGAATGTTTTATAGAATTGAAACTTCGCAACTG
ATCCATGATGAAAATATATTCGTTTCGGTTCACGATGCCGTGATTAACAG
TTTATATGATCATAAAATACAGATAGAATGTTTATAGAAACGTTTGCGAA
ACTTTTCCATTCCACTGTAGCGC
back to top

protein sequence of SMED30031995-orf-1

>SMED30031995-orf-1 ID=SMED30031995-orf-1|Name=SMED30031995-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=317bp
MNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITSLVSVILILFVLLFIGP
LFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTI
FLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGDCH
EIPGIKIFRYEGSIYYACKDHFKKSLYTKISYDPIMVKLRIQKIQKKIKK
INQSLEEMENTDLIAKRAVFQEELDSLLNPNIHHIIIDCSTWGYIDIVGV
KILHQVIEEYKNVNISVLLANPKTDVRRMFYRIETSQLIHDENIFVSVHD
AVINSLYDHKIQIECL*
back to top

protein sequence of SMED30031995-orf-2

>SMED30031995-orf-2 ID=SMED30031995-orf-2|Name=SMED30031995-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=129bp
YLSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYGIFSVWNTLIAVCKQ
LPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVVVAGTV
SSQYLDLHNKYNVSVVGTIIQGNLSRLD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000106ciliated epithelial cell
PLANA:0000421tail
Vocabulary: INTERPRO
TermDefinition
IPR001902SLC26A/SulP_fam
IPR036513STAS_dom_sf
IPR011547SLC26A/SulP_dom
IPR002645STAS_dom
Vocabulary: biological process
TermDefinition
GO:0008272sulfate transport
GO:0006810transport
GO:0006811ion transport
GO:0006821chloride transport
GO:0015701bicarbonate transport
GO:0019532oxalate transport
GO:0042391regulation of membrane potential
GO:0051453regulation of intracellular pH
GO:0055085transmembrane transport
GO:1902358sulfate transmembrane transport
GO:1902476chloride transmembrane transport
Vocabulary: molecular function
TermDefinition
GO:0015116sulfate transmembrane transporter activity
GO:0005254chloride channel activity
GO:0008271secondary active sulfate transmembrane transporter activity
GO:0015106bicarbonate transmembrane transporter activity
GO:0015108chloride transmembrane transporter activity
GO:0015297antiporter activity
GO:0015301anion:anion antiporter activity
GO:0019531oxalate transmembrane transporter activity
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0005886plasma membrane
GO:0005887integral component of plasma membrane
GO:0016020membrane
GO:0016323basolateral plasma membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 191..211
NoneNo IPR availablePANTHERPTHR11814:SF185SOLUTE CARRIER FAMILY 26, MEMBER 10coord: 2..304
NoneNo IPR availableCDDcd07042STAS_SulP_like_sulfate_transportercoord: 146..298
e-value: 1.49372E-16
score: 72.2742
NoneNo IPR availableTMHMMTMhelixcoord: 30..52
NoneNo IPR availableTMHMMTMhelixcoord: 59..76
NoneNo IPR availableTMHMMTMhelixcoord: 91..113
IPR002645STAS domainPFAMPF01740STAScoord: 148..301
e-value: 4.8E-26
score: 90.7
IPR002645STAS domainPROSITEPS50801STAScoord: 145..305
score: 20.998
IPR011547SLC26A/SulP transporter domainPFAMPF00916Sulfate_transpcoord: 1..95
e-value: 3.4E-29
score: 101.8
IPR001902SLC26A/SulP transporterPANTHERPTHR11814SULFATE TRANSPORTERcoord: 2..304
IPR036513STAS domain superfamilySUPERFAMILYSSF52091SpoIIaa-likecoord: 149..302