UPF0602 protein C4orf47 homolog

Overview
NameUPF0602 protein C4orf47 homolog
Smed IDSMED30031988
Length (bp)1123
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of UPF0602 protein C4orf47 homolog (SMED30031988) t-SNE clustered cells

Violin plots show distribution of expression levels for UPF0602 protein C4orf47 homolog (SMED30031988) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of UPF0602 protein C4orf47 homolog (SMED30031988) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for UPF0602 protein C4orf47 homolog (SMED30031988) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031988

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30031988SMESG000078789.1 SmedASXL_010089SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30031988SMESG000078789.1 dd_Smed_v4_8186_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30031988SMESG000078789.1 dd_Smed_v4_8186_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30031988SMESG000078789.1 dd_Smed_v4_8186_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30031988SMESG000078789.1 dd_Smed_v6_8186_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30031988SMESG000078789.1 dd_Smed_v4_8186_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of UPF0602 protein C4orf47 homolog vs. Ensembl Human
Match: C4orf47 (chromosome 4 open reading frame 47 [Source:HGNC Symbol;Acc:HGNC:34346])

HSP 1 Score: 245.358 bits (625), Expect = 1.466e-78
Identity = 135/301 (44.85%), Postives = 179/301 (59.47%), Query Frame = 2
Query:   41 KTDMERVGLFKELGYHTIGDPYKSSALQQFNQSASKGKQVLPGGEKSKSASNVGYFQ-EFTRIFDGESYSDPIKLIRKRRNESSKKKLGKNWVPVNGIKESCGSGTYYGTFSGAIPHFEAISKEQRAKGIQGKNFYTNPAKKGVGYGFVGVTLNKYPEYQSEKYDRSKDITKQENEEHKSKLHSRGVFRLGMHLRDYFDMNPYSGPSEKYRVTSVNSKSQNFKTFKPSSPSKLDGGMKAGCFGSFPEYSSETYKAKIPKRPVNVVNSSGRTFIPPIGPKSRPVNSVLQQNIIRTITPANYR 940
            KTDMER+GLF E+ Y T+GD Y S   + FN++ASK KQ+LPGG K  S    GYF   F RIF+GE Y +  ++ R+   E++KK LGK ++P NG K+ CG G+YYGT  G +P F A SK +      GKN YTNP KKG GYG+  +T+ K   + ++ YD +K   K+ NEEH  +L     F+L +H RDYFD NPY        +     K     TFKPSSP K  GGMKAG F  +P +S++ Y AK+     N+     + F PP GPKSRPV S++  N+ R +   NY+
Sbjct:    7 KTDMERIGLFSEMEYITVGDKYVSQFNRPFNEAASKNKQMLPGGSKEMSDLQAGYFDPHFVRIFEGEGYINLNQVRRRDMVEAAKKNLGKAFLPSNGEKKPCGLGSYYGTIGGPVPFFSAQSKPREKYKAPGKNLYTNPGKKGTGYGYANITIGKQFSHSADFYDAAKLKYKKANEEHH-RLLKGAPFKLNLHPRDYFDANPYFSEESLPPIKKEEKKKTISNTFKPSSPGKKPGGMKAGTFDPYPSHSADPYVAKL----ANISGKDDKIFHPPSGPKSRPVESIMTLNVRRALNSKNYK 302          
BLAST of UPF0602 protein C4orf47 homolog vs. Ensembl Human
Match: C4orf47 (chromosome 4 open reading frame 47 [Source:HGNC Symbol;Acc:HGNC:34346])

HSP 1 Score: 154.836 bits (390), Expect = 3.386e-45
Identity = 81/168 (48.21%), Postives = 108/168 (64.29%), Query Frame = 2
Query:   41 KTDMERVGLFKELGYHTIGDPYKSSALQQFNQSASKGKQVLPGGEKSKSASNVGYFQ-EFTRIFDGESYSDPIKLIRKRRNESSKKKLGKNWVPVNGIKESCGSGTYYGTFSGAIPHFEAISKEQRAKGIQGKNFYTNPAKKGVGYGFVGVTLNKYPEYQSEKYDRSK 541
            KTDMER+GLF E+ Y T+GD Y S   + FN++ASK KQ+LPGG K  S    GYF   F RIF+GE Y +  ++ R+   E++KK LGK ++P NG K+ CG G+YYGT  G +P F A SK +      GKN YTNP KKG GYG+  +T+ K   + ++ YD +K
Sbjct:    7 KTDMERIGLFSEMEYITVGDKYVSQFNRPFNEAASKNKQMLPGGSKEMSDLQAGYFDPHFVRIFEGEGYINLNQVRRRDMVEAAKKNLGKAFLPSNGEKKPCGLGSYYGTIGGPVPFFSAQSKPREKYKAPGKNLYTNPGKKGTGYGYANITIGKQFSHSADFYDAAK 174          
BLAST of UPF0602 protein C4orf47 homolog vs. Ensembl Human
Match: C4orf47 (chromosome 4 open reading frame 47 [Source:HGNC Symbol;Acc:HGNC:34346])

HSP 1 Score: 150.599 bits (379), Expect = 1.021e-43
Identity = 78/155 (50.32%), Postives = 101/155 (65.16%), Query Frame = 2
Query:   41 KTDMERVGLFKELGYHTIGDPYKSSALQQFNQSASKGKQVLPGGEKSKSASNVGYFQ-EFTRIFDGESYSDPIKLIRKRRNESSKKKLGKNWVPVNGIKESCGSGTYYGTFSGAIPHFEAISKEQRAKGIQGKNFYTNPAKKGVGYGFVGVTLNK 502
            KTDMER+GLF E+ Y T+GD Y S   + FN++ASK KQ+LPGG K  S    GYF   F RIF+GE Y +  ++ R+   E++KK LGK ++P NG K+ CG G+YYGT  G +P F A SK +      GKN YTNP KKG GYG+  +T+ K
Sbjct:    7 KTDMERIGLFSEMEYITVGDKYVSQFNRPFNEAASKNKQMLPGGSKEMSDLQAGYFDPHFVRIFEGEGYINLNQVRRRDMVEAAKKNLGKAFLPSNGEKKPCGLGSYYGTIGGPVPFFSAQSKPREKYKAPGKNLYTNPGKKGTGYGYANITIGK 161          
BLAST of UPF0602 protein C4orf47 homolog vs. Ensembl Zebrafish
Match: C14H4orf47 (zgc:153146 [Source:NCBI gene;Acc:751702])

HSP 1 Score: 259.61 bits (662), Expect = 2.352e-84
Identity = 142/309 (45.95%), Postives = 190/309 (61.49%), Query Frame = 2
Query:   41 KTDMERVGLFKELGYHTIGDPYKSSALQQFNQSASKGKQVLPGGEKSKSASNVGYFQ-EFTRIFDGESYSDPIKLIRKRRNESSKKKLGKNWVPVNGIKESCGSGTYYGTFSGAIPHFEAISKEQRAKGIQGKNFYTNPAKKGVGYGFVGVTLNKYPEYQSEKYDRSKDITKQENEEHKSKLHSRGVFRLGMHLRDYFDMNPYSGPSEKYRVTSVNSKSQNFKTFKPSSPSKLDGGMKAGCFGSFPEYSSETYKAKIPKRPVNVVNSSGRTFIPPIGPKSRPVNSVLQQNIIRTITPANYRQIQSVMNY 964
            K+DMER+G+FKE+GY +IGD Y S   + FN SA K KQ+L GG KSK     GYF  +F RIF+ E+++DP+++ R+ R   +KK +GK ++P NG K +CG GTYYGTF G I    A+   ++     GKNFYTNP KKG GYG+  +TL+K   Y S+ YDR+K++ K+E   HKS L   G FRL +H  +YFD NPY           +  K      FKPSSPSK  GGMKAG F S+P YS+E Y  K  K    V N+  + F P  GPKS P+ S++  N+ + +   NY +I SVM++
Sbjct:    6 KSDMERIGVFKEMGYTSIGDKYTSFIYRPFNDSAYKNKQMLLGGTKSKCGLQTGYFDTQFKRIFEREAFTDPVRIDRQYRILQAKKNIGKAFLPSNGEKTTCGMGTYYGTFGGPIQAMSALQIPRKQNKSAGKNFYTNPPKKGSGYGYPDITLSKMVSYSSDPYDRAKEMLKREITAHKSMLKG-GAFRLNLHPNEYFDGNPYKFDKPLPPPKKIEEKKHFAVPFKPSSPSKKAGGMKAGAFDSYPTYSAEPYGTK--KNKSVVANNEVKIFHPSPGPKSTPIKSIISLNVNKAVNSTNYNRIPSVMSF 311          
BLAST of UPF0602 protein C4orf47 homolog vs. Ensembl Zebrafish
Match: C14H4orf47 (zgc:153146 [Source:NCBI gene;Acc:751702])

HSP 1 Score: 259.61 bits (662), Expect = 2.352e-84
Identity = 142/309 (45.95%), Postives = 190/309 (61.49%), Query Frame = 2
Query:   41 KTDMERVGLFKELGYHTIGDPYKSSALQQFNQSASKGKQVLPGGEKSKSASNVGYFQ-EFTRIFDGESYSDPIKLIRKRRNESSKKKLGKNWVPVNGIKESCGSGTYYGTFSGAIPHFEAISKEQRAKGIQGKNFYTNPAKKGVGYGFVGVTLNKYPEYQSEKYDRSKDITKQENEEHKSKLHSRGVFRLGMHLRDYFDMNPYSGPSEKYRVTSVNSKSQNFKTFKPSSPSKLDGGMKAGCFGSFPEYSSETYKAKIPKRPVNVVNSSGRTFIPPIGPKSRPVNSVLQQNIIRTITPANYRQIQSVMNY 964
            K+DMER+G+FKE+GY +IGD Y S   + FN SA K KQ+L GG KSK     GYF  +F RIF+ E+++DP+++ R+ R   +KK +GK ++P NG K +CG GTYYGTF G I    A+   ++     GKNFYTNP KKG GYG+  +TL+K   Y S+ YDR+K++ K+E   HKS L   G FRL +H  +YFD NPY           +  K      FKPSSPSK  GGMKAG F S+P YS+E Y  K  K    V N+  + F P  GPKS P+ S++  N+ + +   NY +I SVM++
Sbjct:    6 KSDMERIGVFKEMGYTSIGDKYTSFIYRPFNDSAYKNKQMLLGGTKSKCGLQTGYFDTQFKRIFEREAFTDPVRIDRQYRILQAKKNIGKAFLPSNGEKTTCGMGTYYGTFGGPIQAMSALQIPRKQNKSAGKNFYTNPPKKGSGYGYPDITLSKMVSYSSDPYDRAKEMLKREITAHKSMLKG-GAFRLNLHPNEYFDGNPYKFDKPLPPPKKIEEKKHFAVPFKPSSPSKKAGGMKAGAFDSYPTYSAEPYGTK--KNKSVVANNEVKIFHPSPGPKSTPIKSIISLNVNKAVNSTNYNRIPSVMSF 311          
BLAST of UPF0602 protein C4orf47 homolog vs. Ensembl Zebrafish
Match: zgc:153146 (zgc:153146 [Source:NCBI gene;Acc:751702])

HSP 1 Score: 258.84 bits (660), Expect = 4.653e-84
Identity = 142/309 (45.95%), Postives = 190/309 (61.49%), Query Frame = 2
Query:   41 KTDMERVGLFKELGYHTIGDPYKSSALQQFNQSASKGKQVLPGGEKSKSASNVGYFQ-EFTRIFDGESYSDPIKLIRKRRNESSKKKLGKNWVPVNGIKESCGSGTYYGTFSGAIPHFEAISKEQRAKGIQGKNFYTNPAKKGVGYGFVGVTLNKYPEYQSEKYDRSKDITKQENEEHKSKLHSRGVFRLGMHLRDYFDMNPYSGPSEKYRVTSVNSKSQNFKTFKPSSPSKLDGGMKAGCFGSFPEYSSETYKAKIPKRPVNVVNSSGRTFIPPIGPKSRPVNSVLQQNIIRTITPANYRQIQSVMNY 964
            K+DMER+G+FKE+GY +IGD Y S   + FN SA K KQ+L GG KSK     GYF  +F RIF+ E+++DP+++ R+ R   +KK +GK ++P NG K +CG GTYYGTF G I    A+   ++     GKNFYTNP KKG GYG+  +TL+K   Y S+ YDR+K++ K+E   HKS L   G FRL +H  +YFD NPY           +  K      FKPSSPSK  GGMKAG F S+P YS+E Y  K  K    V N+  + F P  GPKS P+ S++  N+ + +   NY +I SVM++
Sbjct:    6 KSDMERIGVFKEMGYISIGDKYTSFIYRPFNDSAYKNKQMLLGGTKSKCGLQTGYFDTQFKRIFEREAFTDPVRIDRQYRILQAKKNIGKAFLPSNGEKTTCGMGTYYGTFGGPIQAMSALQIPRKQNKSAGKNFYTNPPKKGSGYGYPDITLSKMVSYSSDPYDRAKEMLKREITAHKSMLKG-GAFRLNLHPNEYFDGNPYKFDKPLPPPKKIEEKKHFAVPFKPSSPSKKAGGMKAGAFDSYPTYSAEPYGTK--KTKSVVANNEVKIFHPSPGPKSTPIKSIISLNVNKAVNSTNYNRIPSVMSF 311          
BLAST of UPF0602 protein C4orf47 homolog vs. Ensembl Zebrafish
Match: C14H4orf47 (zgc:153146 [Source:NCBI gene;Acc:751702])

HSP 1 Score: 60.4622 bits (145), Expect = 1.717e-11
Identity = 32/75 (42.67%), Postives = 45/75 (60.00%), Query Frame = 2
Query:  740 GGMKAGCFGSFPEYSSETYKAKIPKRPVNVVNSSGRTFIPPIGPKSRPVNSVLQQNIIRTITPANYRQIQSVMNY 964
            GGMKAG F S+P YS+E Y  K  K    V N+  + F P  GPKS P+ S++  N+ + +   NY +I SVM++
Sbjct:    2 GGMKAGAFDSYPTYSAEPYGTK--KNKSVVANNEVKIFHPSPGPKSTPIKSIISLNVNKAVNSTNYNRIPSVMSF 74          
BLAST of UPF0602 protein C4orf47 homolog vs. Ensembl Xenopus
Match: C4orf47 (chromosome 4 open reading frame 47 [Source:NCBI gene;Acc:100379819])

HSP 1 Score: 249.98 bits (637), Expect = 2.117e-80
Identity = 140/305 (45.90%), Postives = 194/305 (63.61%), Query Frame = 2
Query:   41 KTDMERVGLFKELGYHTIGDPYKSSALQQFNQSASKGKQVLPGGEKSKSASNVGYFQ-EFTRIFDGESYSDPIKLIRKRRNESSKKKLGKNWVPVNGIKESCGSGTYYGTFSGAIPHFEAISKEQRAKGIQGKNFYTNPAKKGVGYGFVGVTLNKYPEYQSEKYDRSKDITKQENEEHKSKLHSRGVFRLGMHLRDYFDMNPY--SGPSEKYRVTSVNSKSQNFKTFKPSSPSKLDGGMKAGCFGSFPEYSSETYKAKIPKRPVNVVNSSGRTFIPPIGPKSRPVNSVLQQNIIRTITPANYRQI 946
            +TDMER+GLF E+GY +IGD Y     + FN+SASK +Q+LPGG KS +    GYF  +F R+F+GESYSD +K  R+ R + SKK LGK ++P +G K+  G G++YGT  G +  F A  K ++A    GKNFYTNP K+G GYG+  VT+ K   Y SE YD + ++ K+E E HKSKL   G F+L +H +D+F+ NPY    P    +V S   K +  K FKPSSP K  GGMKAG F ++P +S++ Y  K  K P+       + F PP GPK+ PV+S+L  N+I+++T  NY+ +
Sbjct:    5 RTDMERIGLFSEMGYTSIGDKYAPPGSKPFNESASKNRQILPGGSKSMANILGGYFDAQFKRVFEGESYSDVLKQRRQYRMQQSKKNLGKPFLPSSGEKKPSGLGSFYGTVGGPVVAFSAELKPRKAYTAPGKNFYTNPPKQGSGYGYTSVTIGKPYLYSSENYDIATELIKKEIENHKSKLKG-GPFKLNLHPKDHFNPNPYYTDKPLPPLKVHS--QKKETEKPFKPSSPGKQAGGMKAGTFDTYPTHSNDPYTIKSAKTPIK----ERKIFHPPGGPKTYPVHSILTSNVIKSVTAVNYKTV 302          
BLAST of UPF0602 protein C4orf47 homolog vs. Ensembl Mouse
Match: 1700029J07Rik (RIKEN cDNA 1700029J07 gene [Source:MGI Symbol;Acc:MGI:1916729])

HSP 1 Score: 237.654 bits (605), Expect = 1.461e-75
Identity = 135/307 (43.97%), Postives = 182/307 (59.28%), Query Frame = 2
Query:   41 KTDMERVGLFKELGYHTIGDPYKSSALQQFNQSASKGKQVLPGGEKSKSASNVGYFQ-EFTRIFDGESYSDPIKLIRKRRNESSKKKLGKNWVPVNGIKESCGSGTYYGTFSGAIPHFEAISKEQRAKGIQGKNFYTNPAKKGVGYGFVGVTLNKYPEYQSEKYDRSKDITKQENEEHKSKLHSRGVFRLGMHLRDYFDMNPYSGPSEKYRVTSVNSKSQNFKTFKPSSPSKLDGGMKAGCFGSFPEYSSETYKAKIPKRPVNVVNSSG-RTFIPPIGPKSRPVNSVLQQNIIRTITPANYRQIQSV 955
            KTDMER+GLF E+ Y T+GD Y S   + FN++ASK +Q+LPGG K  S+   GYF  +F RIF+GE Y +  ++ R+     SKK LGK ++P +G K+  G G+YYGT  G +P F A  K +      GKN YTNP KKG GYG+  VT+ K   + S+ YD ++   K+E+EEH  +L     F+L +H +DYFD NPY        +     K  +FK FKPSSP K  GGMKAG F  +P +S++ Y  K+ K     + S G R F PP GPKSRPV S++  N+ R +   NY+   S 
Sbjct:    7 KTDMERIGLFSEMEYITVGDKYVSPFNRPFNEAASKNRQILPGGTKEMSSLQAGYFDSQFARIFEGEGYVNLNQVRRRYMLAESKKNLGKAFIPSSGEKKPSGLGSYYGTIGGPVPFFSAQIKPKDKYQPPGKNLYTNPGKKGTGYGYANVTIGKQLSHSSDLYDAARQSYKKESEEH-HRLIKGSPFKLHLHPKDYFDTNPYFLEHHLPPLRREEKKEVSFKPFKPSSPGKKAGGMKAGAFDPYPAHSADPYVVKVEK----AIPSKGERVFHPPNGPKSRPVESIMALNVKRALNVKNYKNASST 308          
BLAST of UPF0602 protein C4orf47 homolog vs. Ensembl Mouse
Match: 1700029J07Rik (RIKEN cDNA 1700029J07 gene [Source:MGI Symbol;Acc:MGI:1916729])

HSP 1 Score: 237.654 bits (605), Expect = 1.461e-75
Identity = 135/307 (43.97%), Postives = 182/307 (59.28%), Query Frame = 2
Query:   41 KTDMERVGLFKELGYHTIGDPYKSSALQQFNQSASKGKQVLPGGEKSKSASNVGYFQ-EFTRIFDGESYSDPIKLIRKRRNESSKKKLGKNWVPVNGIKESCGSGTYYGTFSGAIPHFEAISKEQRAKGIQGKNFYTNPAKKGVGYGFVGVTLNKYPEYQSEKYDRSKDITKQENEEHKSKLHSRGVFRLGMHLRDYFDMNPYSGPSEKYRVTSVNSKSQNFKTFKPSSPSKLDGGMKAGCFGSFPEYSSETYKAKIPKRPVNVVNSSG-RTFIPPIGPKSRPVNSVLQQNIIRTITPANYRQIQSV 955
            KTDMER+GLF E+ Y T+GD Y S   + FN++ASK +Q+LPGG K  S+   GYF  +F RIF+GE Y +  ++ R+     SKK LGK ++P +G K+  G G+YYGT  G +P F A  K +      GKN YTNP KKG GYG+  VT+ K   + S+ YD ++   K+E+EEH  +L     F+L +H +DYFD NPY        +     K  +FK FKPSSP K  GGMKAG F  +P +S++ Y  K+ K     + S G R F PP GPKSRPV S++  N+ R +   NY+   S 
Sbjct:    7 KTDMERIGLFSEMEYITVGDKYVSPFNRPFNEAASKNRQILPGGTKEMSSLQAGYFDSQFARIFEGEGYVNLNQVRRRYMLAESKKNLGKAFIPSSGEKKPSGLGSYYGTIGGPVPFFSAQIKPKDKYQPPGKNLYTNPGKKGTGYGYANVTIGKQLSHSSDLYDAARQSYKKESEEH-HRLIKGSPFKLHLHPKDYFDTNPYFLEHHLPPLRREEKKEVSFKPFKPSSPGKKAGGMKAGAFDPYPAHSADPYVVKVEK----AIPSKGERVFHPPNGPKSRPVESIMALNVKRALNVKNYKNASST 308          
BLAST of UPF0602 protein C4orf47 homolog vs. Ensembl Mouse
Match: 1700029J07Rik (RIKEN cDNA 1700029J07 gene [Source:MGI Symbol;Acc:MGI:1916729])

HSP 1 Score: 92.4337 bits (228), Expect = 1.808e-22
Identity = 48/99 (48.48%), Postives = 66/99 (66.67%), Query Frame = 2
Query:   41 KTDMERVGLFKELGYHTIGDPYKSSALQQFNQSASKGKQVLPGGEKSKSASNVGYFQ-EFTRIFDGESYSDPIKLIRKRRNESSKKKLGKNWVPVNGIK 334
            KTDMER+GLF E+ Y T+GD Y S   + FN++ASK +Q+LPGG K  S+   GYF  +F RIF+GE Y +  ++ R+     SKK LGK ++P +G K
Sbjct:    7 KTDMERIGLFSEMEYITVGDKYVSPFNRPFNEAASKNRQILPGGTKEMSSLQAGYFDSQFARIFEGEGYVNLNQVRRRYMLAESKKNLGKAFIPSSGEK 105          
BLAST of UPF0602 protein C4orf47 homolog vs. UniProt/SwissProt
Match: sp|Q5XHC1|CD047_XENLA (UPF0602 protein C4orf47 homolog OS=Xenopus laevis OX=8355 PE=2 SV=1)

HSP 1 Score: 261.536 bits (667), Expect = 2.647e-84
Identity = 143/303 (47.19%), Postives = 194/303 (64.03%), Query Frame = 2
Query:   41 KTDMERVGLFKELGYHTIGDPYKSSALQQFNQSASKGKQVLPGGEKSKSASNVGYFQ-EFTRIFDGESYSDPIKLIRKRRNESSKKKLGKNWVPVNGIKESCGSGTYYGTFSGAIPHFEAISKEQRAKGIQGKNFYTNPAKKGVGYGFVGVTLNKYPEYQSEKYDRSKDITKQENEEHKSKLHSRGVFRLGMHLRDYFDMNPYSGPSEKYRVTSVNSKSQNFKTFKPSSPSKLDGGMKAGCFGSFPEYSSETYKAKIPKRPVNVVNSSGRTFIPPIGPKSRPVNSVLQQNIIRTITPANYRQI 946
            KTDMER+GLF E+GY +IGD Y +   + FN+SASK +Q+LPGG KS +    GYF  +F R+F+GESYSDP K  R+ R + SKK LGK ++P +G K+  G G++YGT  G +  F A  K ++A    GKNFYTNP K G GYG+  VT+ K   Y SE YD S+++ K+E E HKSKL   G F+L +H +DYF+ NPY        +   + K +  K FKPSSP+K  GGMKAG F  +P +S++ Y AK  K PV       + F PP GPK+ PV+S+L  N+I+++T  NY+ +
Sbjct:    5 KTDMERIGLFSEMGYTSIGDKYAAPGSKPFNESASKNRQMLPGGSKSMANMLGGYFDGQFKRVFEGESYSDPFKQRRQHRMQQSKKNLGKPFLPSSGEKKRSGLGSFYGTLGGPVVAFSAELKSRKAYTAPGKNFYTNPPKDGSGYGYPSVTIGKPYPYSSENYDISRELIKKEIEHHKSKLKG-GAFKLNLHPKDYFEPNPYYTDKTLPPLKVHSQKKETEKPFKPSSPAKEAGGMKAGTFDPYPTHSNDPYTAKPSKTPVK----ERKVFHPPGGPKTYPVHSILTSNVIKSVTALNYKTV 302          
BLAST of UPF0602 protein C4orf47 homolog vs. UniProt/SwissProt
Match: sp|Q0P4C5|CD047_DANRE (UPF0602 protein C4orf47 homolog OS=Danio rerio OX=7955 GN=zgc:153146 PE=2 SV=1)

HSP 1 Score: 256.144 bits (653), Expect = 4.103e-82
Identity = 141/309 (45.63%), Postives = 189/309 (61.17%), Query Frame = 2
Query:   41 KTDMERVGLFKELGYHTIGDPYKSSALQQFNQSASKGKQVLPGGEKSKSASNVGYFQ-EFTRIFDGESYSDPIKLIRKRRNESSKKKLGKNWVPVNGIKESCGSGTYYGTFSGAIPHFEAISKEQRAKGIQGKNFYTNPAKKGVGYGFVGVTLNKYPEYQSEKYDRSKDITKQENEEHKSKLHSRGVFRLGMHLRDYFDMNPYSGPSEKYRVTSVNSKSQNFKTFKPSSPSKLDGGMKAGCFGSFPEYSSETYKAKIPKRPVNVVNSSGRTFIPPIGPKSRPVNSVLQQNIIRTITPANYRQIQSVMNY 964
            K+DMER+G+FKE+GY +IGD Y S   + FN SA K KQ+L GG KSK     GYF  +F RIF+ E+++DP+++ R+ R   +KK +GK ++P NG K +CG GTYYGTF G I    A+   ++     GKNFYTNP K+G GYG   +TL+K   Y S+ YDR+K++ K+E   HKS L   G FRL +H  +YFD NPY           +  K      FKPSSPSK  GGMKAG F S+P YS+E Y  K  K    V N+  + F P  GPKS P+ S++  N+ + +   NY +I SVM++
Sbjct:    6 KSDMERIGVFKEMGYISIGDKYTSFIYRPFNDSAYKNKQMLLGGTKSKCGLQTGYFDTQFKRIFEREAFTDPVRIDRQYRILQAKKNIGKAFLPSNGEKTTCGMGTYYGTFGGPIQAMSALQIPRKQNKSAGKNFYTNPPKEGSGYGCPDITLSKMVSYSSDPYDRAKEMLKREITAHKSMLKG-GAFRLNLHPNEYFDGNPYKFDKPLPPPKKIEEKKHFAVPFKPSSPSKKAGGMKAGAFDSYPTYSAEPYGTK--KTKSVVANNEVKIFHPSPGPKSTPIKSIISLNVNKAVNSTNYNRIPSVMSF 311          
BLAST of UPF0602 protein C4orf47 homolog vs. UniProt/SwissProt
Match: sp|Q2T9M0|CD047_BOVIN (UPF0602 protein C4orf47 homolog OS=Bos taurus OX=9913 PE=2 SV=1)

HSP 1 Score: 247.284 bits (630), Expect = 1.208e-78
Identity = 139/309 (44.98%), Postives = 186/309 (60.19%), Query Frame = 2
Query:   41 KTDMERVGLFKELGYHTIGDPYKSSALQQFNQSASKGKQVLPGGEKSKSASNVGYFQ-EFTRIFDGESYSDPIKLIRKRRNESSKKKLGKNWVPVNGIKESCGSGTYYGTFSGAIPHFEAISKEQRAKGIQGKNFYTNPAKKGVGYGFVGVTLNKYPEYQSEKYDRSKDITKQENEEHKSKLHSRGVFRLGMHLRDYFDMNPYSGPSEKYRVTSVNSKSQNFKTFKPSSPSKLDGGMKAGCFGSFPEYSSETYKAKIPKRPVNVVNSSGRTFIPPIGPKSRPVNSVLQQNIIRTITPANYRQIQSVMNY 964
            KTDMER+GLF E+ Y T+GD Y S   + FN+SASK +Q+LPGG K  S    GYF   F RIF+GESY +P ++ R+   E +KK L K ++P NG K+ CG G+YYGT  G +P F A SK +      GKN YTNP KKG GYG+  +T+ K   + S+ YD +K   K+ENEEH+ +L     F+L ++ R+YFD NPY        +  V  K      FKPSSP K  GGMKAG F  +P +S++ Y  K+ K P    + S + F PP GPKSRP+ S++  N+ R +   NY+   SV +Y
Sbjct:    7 KTDMERIGLFSEMEYITVGDKYVSQFNRPFNESASKNRQILPGGSKEMSNLQAGYFDPHFVRIFEGESYVNPNQVRRRYMMEEAKKNLSKAFLPSNGEKKPCGLGSYYGTIGGPVPFFSAQSKPKEKYEPPGKNLYTNPGKKGTGYGYANITIGKQFSHSSDLYDAAKLNNKKENEEHR-RLLKGTAFKLNLYTREYFDTNPYMSEKPLPPIKKVEKKETVGNPFKPSSPGKKAGGMKAGTFDPYPSHSADPYVVKL-KSP---SSKSAKVFHPPGGPKSRPIESIMALNVKRALNMKNYK-TASVQSY 309          
BLAST of UPF0602 protein C4orf47 homolog vs. UniProt/SwissProt
Match: sp|A7E2U8|CD047_HUMAN (UPF0602 protein C4orf47 OS=Homo sapiens OX=9606 GN=C4orf47 PE=2 SV=1)

HSP 1 Score: 245.358 bits (625), Expect = 7.040e-78
Identity = 135/301 (44.85%), Postives = 179/301 (59.47%), Query Frame = 2
Query:   41 KTDMERVGLFKELGYHTIGDPYKSSALQQFNQSASKGKQVLPGGEKSKSASNVGYFQ-EFTRIFDGESYSDPIKLIRKRRNESSKKKLGKNWVPVNGIKESCGSGTYYGTFSGAIPHFEAISKEQRAKGIQGKNFYTNPAKKGVGYGFVGVTLNKYPEYQSEKYDRSKDITKQENEEHKSKLHSRGVFRLGMHLRDYFDMNPYSGPSEKYRVTSVNSKSQNFKTFKPSSPSKLDGGMKAGCFGSFPEYSSETYKAKIPKRPVNVVNSSGRTFIPPIGPKSRPVNSVLQQNIIRTITPANYR 940
            KTDMER+GLF E+ Y T+GD Y S   + FN++ASK KQ+LPGG K  S    GYF   F RIF+GE Y +  ++ R+   E++KK LGK ++P NG K+ CG G+YYGT  G +P F A SK +      GKN YTNP KKG GYG+  +T+ K   + ++ YD +K   K+ NEEH  +L     F+L +H RDYFD NPY        +     K     TFKPSSP K  GGMKAG F  +P +S++ Y AK+     N+     + F PP GPKSRPV S++  N+ R +   NY+
Sbjct:    7 KTDMERIGLFSEMEYITVGDKYVSQFNRPFNEAASKNKQMLPGGSKEMSDLQAGYFDPHFVRIFEGEGYINLNQVRRRDMVEAAKKNLGKAFLPSNGEKKPCGLGSYYGTIGGPVPFFSAQSKPREKYKAPGKNLYTNPGKKGTGYGYANITIGKQFSHSADFYDAAKLKYKKANEEHH-RLLKGAPFKLNLHPRDYFDANPYFSEESLPPIKKEEKKKTISNTFKPSSPGKKPGGMKAGTFDPYPSHSADPYVAKL----ANISGKDDKIFHPPSGPKSRPVESIMTLNVRRALNSKNYK 302          
BLAST of UPF0602 protein C4orf47 homolog vs. UniProt/SwissProt
Match: sp|Q3U1D9|CD047_MOUSE (UPF0602 protein C4orf47 homolog OS=Mus musculus OX=10090 PE=2 SV=1)

HSP 1 Score: 237.654 bits (605), Expect = 1.022e-74
Identity = 135/307 (43.97%), Postives = 182/307 (59.28%), Query Frame = 2
Query:   41 KTDMERVGLFKELGYHTIGDPYKSSALQQFNQSASKGKQVLPGGEKSKSASNVGYFQ-EFTRIFDGESYSDPIKLIRKRRNESSKKKLGKNWVPVNGIKESCGSGTYYGTFSGAIPHFEAISKEQRAKGIQGKNFYTNPAKKGVGYGFVGVTLNKYPEYQSEKYDRSKDITKQENEEHKSKLHSRGVFRLGMHLRDYFDMNPYSGPSEKYRVTSVNSKSQNFKTFKPSSPSKLDGGMKAGCFGSFPEYSSETYKAKIPKRPVNVVNSSG-RTFIPPIGPKSRPVNSVLQQNIIRTITPANYRQIQSV 955
            KTDMER+GLF E+ Y T+GD Y S   + FN++ASK +Q+LPGG K  S+   GYF  +F RIF+GE Y +  ++ R+     SKK LGK ++P +G K+  G G+YYGT  G +P F A  K +      GKN YTNP KKG GYG+  VT+ K   + S+ YD ++   K+E+EEH  +L     F+L +H +DYFD NPY        +     K  +FK FKPSSP K  GGMKAG F  +P +S++ Y  K+ K     + S G R F PP GPKSRPV S++  N+ R +   NY+   S 
Sbjct:    7 KTDMERIGLFSEMEYITVGDKYVSPFNRPFNEAASKNRQILPGGTKEMSSLQAGYFDSQFARIFEGEGYVNLNQVRRRYMLAESKKNLGKAFIPSSGEKKPSGLGSYYGTIGGPVPFFSAQIKPKDKYQPPGKNLYTNPGKKGTGYGYANVTIGKQLSHSSDLYDAARQSYKKESEEH-HRLIKGSPFKLHLHPKDYFDTNPYFLEHHLPPLRREEKKEVSFKPFKPSSPGKKAGGMKAGAFDPYPAHSADPYVVKVEK----AIPSKGERVFHPPNGPKSRPVESIMALNVKRALNVKNYKNASST 308          
BLAST of UPF0602 protein C4orf47 homolog vs. TrEMBL
Match: A0A267FK75 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig016035g1 PE=4 SV=1)

HSP 1 Score: 326.635 bits (836), Expect = 2.755e-107
Identity = 161/312 (51.60%), Postives = 217/312 (69.55%), Query Frame = 2
Query:   32 MTSKTDMERVGLFKELGYHTIGDPYKSSALQQFNQSASKGKQVLPGGEKSKSASNVGYFQEFTRIFDGESYSDPIKLIRKRRNESSKKKLGKNWVPVNGIKESCGSGTYYGTFSGAIPHFEAISKEQRAKGIQGKNFYTNPAKKGVGYGFVGVTLNKYPEYQSEKYDRSKDITKQENEEHKSKLHSRGVFRLGMHLRDYFDMNPYSGPSEKYRVTSVNSKSQNF-KTFKPSSPSKLDGGMKAGCFGSFPEYSSETYKAKIPKRPVNVVNSSGRTFIPPIGPKSRPVNSVLQQNIIRTITPANYRQIQSVMNY 964
            M +K+DM+R+G+FKE+ YHT+GDPYK+    QFN SA KG+Q+LPGG K KS  + GY  EF R+F+GE YSDPIK  R+ R ++S + L ++W P +  K   G+G++YGTFSG + +F A S  +     +GKN  TNP KKG GYG+  VTLNKYP+Y+S+ Y++ KDI K+ENE+HK K+  +G F+L  H  D+FD NPY G S    +T   +K++   + FKPS+P K DGGMKAG F SFP YSSE Y+ K   RPV VVNSSG+TF+P  GPK+    SVL QN+ R++  +NY+ +QSVM+Y
Sbjct:    1 MGTKSDMDRIGIFKEMSYHTVGDPYKNPGNFQFNTSAYKGRQMLPGGTKKKSGLSQGYMSEFGRVFEGEGYSDPIKTRRQERQKASSRNLSRSWNPTSFPKVGSGTGSHYGTFSGPVQYFNAFSSSKGKAAPEGKNILTNPPKKGTGYGYAFVTLNKYPDYKSDTYEKYKDIQKRENEQHKQKVAGKGAFKLSTHPADFFDANPYKGGSA---LTKSEAKAEPIARPFKPSNPGKKDGGMKAGTFDSFPTYSSEKYQKKSLTRPVQVVNSSGKTFVPNSGPKTTLQTSVLHQNVTRSVNSSNYKSVQSVMSY 309          
BLAST of UPF0602 protein C4orf47 homolog vs. TrEMBL
Match: A0A1S3HMA8 (UPF0602 protein C4orf47 homolog isoform X1 OS=Lingula unguis OX=7574 GN=LOC106156065 PE=4 SV=1)

HSP 1 Score: 289.656 bits (740), Expect = 1.023e-92
Identity = 145/306 (47.39%), Postives = 205/306 (66.99%), Query Frame = 2
Query:   41 KTDMERVGLFKELGYHTIGDPYKSSALQQFNQSASKGKQVLPGGEKSKSASNVGYFQE-FTRIFDGESYSDPIKLIRKRRNESSKKKLGKNWVPVNGIKESCGSGTYYGTFSGAIPHFEAISKEQRAKGIQGKNFYTNPAKKGVGYGFVGVTLNKYPEYQSEKYDRSKDITKQENEEHKSKLHSRGVFRLGMHLRDYFDMNPYSGPSEKYRVTSVNSKSQNFKTFKPSSPSKLDGGMKAGCFGSFPEYSSETYKAKIPKRPVNVVNSSGRTFIPPIGPKSRPVNSVLQQNIIRTITPANYRQIQSV 955
            KTDMER+G+F+E+ Y TIGD Y+     QFN SASKGKQ+LPGG K +SA   GYF E F R+F+ E+Y+DPIK+ R+RR +  +K +GK ++P +G K   G G +YGTF+G +  F  ++K ++     G+NF TNPAKKG GYG++ VT++KYPEY+  +YD++K+I+K+ENE H+  L   G FRL MH + YFD NP+             SK  + K F+PS+P K  GG KAG F  +P +S + Y  K  KRPV+VVN +G+ F+P  GPK+ P++S+L QN+ + +   NYR ++SV
Sbjct:    7 KTDMERIGVFQEMSYATIGDRYRRPGEIQFNVSASKGKQMLPGGSKERSALQHGYFHEKFNRVFESEAYTDPIKIRRQRRVKEMQKNIGKQFIPSSGEKMPSGLGNHYGTFAGPVSAFSPVAKARQGYKAPGRNFTTNPAKKGTGYGYLSVTISKYPEYKGNEYDKTKEISKRENEAHRKALKG-GAFRLNMHPKAYFDGNPFMSDRPLPPAKKGVSKPPDVKPFRPSNPPKKAGGSKAGTFDPYPSHSQDPYGIKY-KRPVHVVNKTGKIFVPSTGPKTAPISSILDQNVTKVVNSMNYRTVRSV 310          
BLAST of UPF0602 protein C4orf47 homolog vs. TrEMBL
Match: A0A1S3HKS1 (UPF0602 protein C4orf47 homolog isoform X2 OS=Lingula unguis OX=7574 GN=LOC106156065 PE=4 SV=1)

HSP 1 Score: 284.263 bits (726), Expect = 1.270e-90
Identity = 143/306 (46.73%), Postives = 201/306 (65.69%), Query Frame = 2
Query:   41 KTDMERVGLFKELGYHTIGDPYKSSALQQFNQSASKGKQVLPGGEKSKSASNVGYFQE-FTRIFDGESYSDPIKLIRKRRNESSKKKLGKNWVPVNGIKESCGSGTYYGTFSGAIPHFEAISKEQRAKGIQGKNFYTNPAKKGVGYGFVGVTLNKYPEYQSEKYDRSKDITKQENEEHKSKLHSRGVFRLGMHLRDYFDMNPYSGPSEKYRVTSVNSKSQNFKTFKPSSPSKLDGGMKAGCFGSFPEYSSETYKAKIPKRPVNVVNSSGRTFIPPIGPKSRPVNSVLQQNIIRTITPANYRQIQSV 955
            KTDMER+G+F+E+ Y TIGD Y+     QFN SASKGKQ+LPGG K +SA   GYF E F R+F+ E+Y+DPIK+ R+RR +  +K +GK ++P +G K   G G +YGTF+G +  F  ++K ++     G+NF TNPAKKG GYGF+ VT+  YP+Y +E+Y++ K + K+ENE H+  L   G FRL MH + YFD NP+             SK  + K F+PS+P K  GG KAG F  +P +S + Y  K  KRPV+VVN +G+ F+P  GPK+ P++S+L QN+ + +   NYR ++SV
Sbjct:    7 KTDMERIGVFQEMSYATIGDRYRRPGEIQFNVSASKGKQMLPGGSKERSALQHGYFHEKFNRVFESEAYTDPIKIRRQRRVKEMQKNIGKQFIPSSGEKMPSGLGNHYGTFAGPVSAFSPVAKARQGYKAPGRNFTTNPAKKGTGYGFISVTIGDYPKYSTEQYEKGKILQKRENEAHRKALKG-GAFRLNMHPKAYFDGNPFMSDRPLPPAKKGVSKPPDVKPFRPSNPPKKAGGSKAGTFDPYPSHSQDPYGIKY-KRPVHVVNKTGKIFVPSTGPKTAPISSILDQNVTKVVNSMNYRTVRSV 310          
BLAST of UPF0602 protein C4orf47 homolog vs. TrEMBL
Match: A0A210QGT9 (UPF0602 protein C4orf47-like OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT05429 PE=4 SV=1)

HSP 1 Score: 282.337 bits (721), Expect = 9.261e-90
Identity = 145/309 (46.93%), Postives = 210/309 (67.96%), Query Frame = 2
Query:   41 KTDMERVGLFKELGYHTIGDPYKSSALQQFNQSASKGKQVLPGGEKSKSASNVGYFQE-FTRIFDGESYSDPIKLIRKRRNESSKKKLGKNWVPVNGIKESCGSGTYYGTFSGAIPHFEAISKEQRAKGIQGKNFYTNPAKKGVGYGFVGVTLNKYPEYQSEKYDRSKDITKQENEEHKSKLHSRGVFRLGMHLRDYFDMNPYSGPSEKYR--VTSVNSKSQNFKTFKPSSPSKLDGGMKAGCFGSFPEYSSETYKAKIPKRPVNVVNSSGRTFIPPIGPKSRPVNSVLQQNIIRTITPANYRQIQSVM 958
            K DM+R+G+F+E+GY TIGD YK   +Q FN +ASKGKQ+LPGG K++SA   GYF E + R+ +GE+YSDPIK+ R+ R + S++ +GK ++P +G K+  G G++YGT +G I  F   ++  +     GKNF TNP KKG G+GFV +TL  YP+YQ++ Y+R++++TK+E   HK+ +     F+L MH + YFD NPY+      R  V++  SK ++ K FKPSSP K   GMKAG F  +P +S++ YK K+    VNVVN +G+TF+P  GPKS P NS++ QNI++TI   NYR + S++
Sbjct:    7 KNDMDRIGVFQEMGYVTIGDRYKPPGIQ-FNAAASKGKQILPGGSKTRSALQSGYFLEKYGRVMEGEAYSDPIKMRRQHRLKESQRNIGKAFLPSSGEKKPSGLGSHYGTLAGPISAFSPNARPGKGYKSPGKNFLTNPGKKGTGFGFVEITLGSYPKYQADAYERARELTKKELANHKNAVKG-AAFKLNMHPKPYFDQNPYASDKLLGRRSVSAGVSKKEDVKPFKPSSPGKKPAGMKAGTFDPYPSHSADPYKIKV-SHSVNVVNKTGKTFMPSQGPKSVPTNSIVNQNILKTINVQNYRSMTSII 312          
BLAST of UPF0602 protein C4orf47 homolog vs. TrEMBL
Match: A0A2C9K232 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106078477 PE=4 SV=1)

HSP 1 Score: 281.952 bits (720), Expect = 1.311e-89
Identity = 146/306 (47.71%), Postives = 195/306 (63.73%), Query Frame = 2
Query:   41 KTDMERVGLFKELGYHTIGDPYKSSALQQFNQSASKGKQVLPGGEKSKSASNVGYFQEFTRIFDGESYSDPIKLIRKRRNESSKKKLGKNWVPVNGIKESCGSGTYYGTFSGAIPHFEAISKEQRAKGIQGKNFYTNPAKKGVGYGFVGVTLNKYPEYQSEKYDRSKDITKQENEEHKSKLHSRGVFRLGMHLRDYFDMNPY----SGPSEKYRVTSVNSKSQNFKTFKPSSPSKLDGGMKAGCFGSFPEYSSETYKAKIPKRPVNVVNSSGRTFIPPIGPKSRPVNSVLQQNIIRTITPANYRQI 946
            K+DMERVGLFKE+ Y T+GDPYK+     FN+ A KGKQ++PGG K KSA + GYF +F R+F+GESYSDP+KL R+ R   SKK L K +VP NG +   G GT+YGT  G +P     +    +K    KN  TNP KKG GYG+  + LN YP +  + Y++   + KQE ++HK+ L + G FRL MH  DYF+ NPY    + P+ +     + +K      F+PS+P K   GMKAG F  +P +S++ Y  K  KRPVNVVN  G+TF+PP GPKS P NS++ QNI+R++   NYR I
Sbjct:    7 KSDMERVGLFKEMDYVTVGDPYKTPGQGVFNEPAGKGKQMIPGGTKEKSAKSDGYFADFGRVFEGESYSDPVKLRRQHRMSESKKNLSKAFVPTNGYRTMNGLGTFYGTLGGVVPALSPATSGGGSKREPLKNILTNPGKKGTGYGYANICLNPYPPHSEDDYNKGISMYKQELQKHKAALKA-GAFRLNMHPSDYFNGNPYRSDVAAPAARKWAGDLPAKPIT-TPFRPSNPGKHLAGMKAGTFDPYPSHSADPYGIKY-KRPVNVVNKFGKTFVPPPGPKSTPCNSIINQNIMRSVNSTNYRSI 309          
BLAST of UPF0602 protein C4orf47 homolog vs. Ensembl Cavefish
Match: zgc:153146 (chromosome 24 C4orf47 homolog [Source:NCBI gene;Acc:103030756])

HSP 1 Score: 235.343 bits (599), Expect = 6.864e-75
Identity = 139/311 (44.69%), Postives = 184/311 (59.16%), Query Frame = 2
Query:   41 KTDMERVGLFKELGYHTIGDPYKSSALQQFNQSASKGKQVLPGGEKSKSASNVGYFQ-EFTRIFDGESYSDPIKLIRKRRNESSKKKLGKNWVPVNGIKESCGSGTYYGTFSGAIPHFEAISKEQRAKGIQGKNFYTNPAKKGVGYGFVGVTLNKYPEYQSEKYDRSKDITKQENEEHKSKLHSRGVFRLGMHLRDYFDMNPYSGPSEKYRVTSVNSKSQNFKT-FKPSSPSKLDGGMKAGCFGSFPEYSSETYKAKIPKRPVNV-VNSSGRTFIPPIGPKSRPVNSVLQQNIIRTITPANYRQIQSVMNY 964
            K+DMERVGLFKE+GY +IGD Y     + FN+SA K KQ+L GG K KS    GYF  +F RIF+ E+ +D IK+ R+ + E +K+ LGK ++P +G K+  G G+YYGT  G+I     +   ++     GKN YT+P KKG GYG+ GVTL K   Y S+ YDR+KDI K+E   HKS L   G FRL +H ++ FD NPY              K  +F   FKPSSPSK  GGMKAG F  +P +S + Y   IP +P    +N   + F P  GPKS PV S++  N+ + +   N  QI S+M Y
Sbjct:    6 KSDMERVGLFKEMGYISIGDKYTPFLYRAFNESAHKNKQMLVGGSKKKSGLQTGYFDAQFKRIFEKEALTDLIKIQRQYKLEQTKRNLGKAFLPSSGEKKRSGIGSYYGTLGGSIQAMSPLKIPKQPYKSPGKNMYTSPPKKGSGYGYPGVTLGKLDLYSSDPYDRAKDIVKRELIAHKSMLKG-GPFRLNLHPKECFDANPYKPDKPLPPSKKTEDKKTHFGVPFKPSSPSKKIGGMKAGTFDLYPTHSVDPY---IPHKPKTAGLNKELKIFHPSPGPKSTPVKSIISLNVNKFVNSKNCNQIPSIMAY 312          
BLAST of UPF0602 protein C4orf47 homolog vs. Ensembl Sea Lamprey
Match: zgc:153146 (pep scaffold:Pmarinus_7.0:GL477013:54605:76454:-1 gene:ENSPMAG00000001809.1 transcript:ENSPMAT00000001995.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:zgc:153146)

HSP 1 Score: 239.965 bits (611), Expect = 2.036e-77
Identity = 134/296 (45.27%), Postives = 176/296 (59.46%), Query Frame = 2
Query:   41 KTDMERVGLFKELGYHTIGDPYKSSALQQFNQSASKGKQVLPGGEKSKSASNVGYF-QEFTRIFDGESYSDPIKLIRKRRNESSKKKLGKNWVPVNGIKESCGSGTYYGTFSGAIPHFEAISKEQRAKGIQGKNFYTNPAKKGVGYGFVGVTLNKYPEYQSEKYDRSKDITKQENEEHKSKLHSRGVFRLGMHLRDYFDMNPYSGPSEKYRVTSVNSKSQNFKTFKPSSPSKLDGGMKAGCFGSFPEYSSETY---KAKIPKRPVNVVNSSGRTFIPPIGPKSRPVNSVLQQNIIR 916
            KTDMERVGLF ELGY +IGD YKSS  + FN +A++G+Q+L  G KS+SA   GYF Q FTR+  GE+YSDPIK+ R+RR + +KK LGK  +P +  K+  G G+YYGT  G IP        ++     G+NF TNP KKG GYG+  V +   P Y  + YDR+K+I ++E E HK K+     FRL +H  D FD+NPY             +   + K FKPSSP+K  GGMKAG F S+P +S + Y   +A       +     G  F P  GPKS PV S++  NII+
Sbjct:    6 KTDMERVGLFSELGYISIGDKYKSSFNKAFNAAANRGRQMLTEGPKSRSALPAGYFSQGFTRVMQGEAYSDPIKIRRQRRLQEAKKNLGKALLPSSCPKKPSGLGSYYGTLGGPIPALSPAQLPKKPYSAPGRNFVTNPPKKGTGYGYPQVMIGSLPPYMPDPYDRAKEIRRKEMETHK-KMVKGAPFRLNLHPLDIFDVNPYRSDQPARATHPPRATKSSEKAFKPSSPAKKMGGMKAGTFDSYPSHSEDAYIVKRASALAGGSSGNKGGGHVFRPSPGPKSTPVRSIIDANIIK 300          
BLAST of UPF0602 protein C4orf47 homolog vs. Ensembl Nematostella
Match: EDO34007 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQL2])

HSP 1 Score: 245.743 bits (626), Expect = 2.321e-79
Identity = 136/304 (44.74%), Postives = 186/304 (61.18%), Query Frame = 2
Query:   41 KTDMERVGLFKELGYHTIGDPYKSSALQQFNQSASKGKQVLPGGEKSKSASNVGYF-QEFTRIFDGESYSDPIKLIRKRRNESSKKKLGKNWVPVNGIKESCGSGTYYGTFSGAIPHFEAISKEQRAKGIQGKNFYTNPAKKGVGYGFVGVTLNKYPEYQSEKYDRSKDITKQENEEHKSKLHSRGVFRLGMHLRDYFDMNPYSGPSEKYRVTSVNSKSQNFKTFKPSSPSKLDGGMKAGCFGSFPEYSSETYKAKIPKRPVNVVNSSG--RTFIPPIGPKSRPVNSVLQQNIIRTITPANYRQ 943
            K D+ RVGLF ELGY +IGDPYK      FN +A KGKQ+LPGG K +S+   GYF Q+F R+ +GE++SDP+K  R  R +++K  +GK +VP NG K   G G +YGTF+GA+P F  ++K + A    GKNF TNP KKG GYG++ VT+   P+Y S+ YDR K++ K+E +    ++   G F+L +H + YFD NPY        V        +FK FKPS P K  GGMKAGCF S+P +S + ++ K  K      N  G  + F P  GPKS P+ S++ QN+ R I   N++Q
Sbjct:    9 KNDLNRVGLFSELGYISIGDPYKIQN-GNFNLAAHKGKQMLPGGSKIRSSKQDGYFDQKFNRVMEGEAFSDPVKRRRLDRLKATKLNIGKAFVPSNGDKLPSGIGNHYGTFAGAVPAFSPVTKSKSAHVSPGKNFLTNPPKKGTGYGYLQVTIGASPKYMSDAYDRGKELRKKEMDTSGKQMKG-GAFKLNLHPKSYFDGNPYKSDRPLPPVKDGRKAKPDFKPFKPSHPPKEIGGMKAGCFTSYPSHSEDPFQPKKKK------NGDGERKIFRPSQGPKSTPMKSIINQNVDRRINRLNFKQ 304          
BLAST of UPF0602 protein C4orf47 homolog vs. Planmine SMEST
Match: SMESG000078789.1 (SMESG000078789.1)

HSP 1 Score: 635.95 bits (1639), Expect = 0.000e+0
Identity = 310/311 (99.68%), Postives = 311/311 (100.00%), Query Frame = 2
Query:   32 MTSKTDMERVGLFKELGYHTIGDPYKSSALQQFNQSASKGKQVLPGGEKSKSASNVGYFQEFTRIFDGESYSDPIKLIRKRRNESSKKKLGKNWVPVNGIKESCGSGTYYGTFSGAIPHFEAISKEQRAKGIQGKNFYTNPAKKGVGYGFVGVTLNKYPEYQSEKYDRSKDITKQENEEHKSKLHSRGVFRLGMHLRDYFDMNPYSGPSEKYRVTSVNSKSQNFKTFKPSSPSKLDGGMKAGCFGSFPEYSSETYKAKIPKRPVNVVNSSGRTFIPPIGPKSRPVNSVLQQNIIRTITPANYRQIQSVMNY 964
            MTSKTDMERVGLFKELGYHTIGDPYKSSALQQFNQSASKGKQVLPGGEKSKSASNVGYFQEFTRIFDGESYSDPIKL+RKRRNESSKKKLGKNWVPVNGIKESCGSGTYYGTFSGAIPHFEAISKEQRAKGIQGKNFYTNPAKKGVGYGFVGVTLNKYPEYQSEKYDRSKDITKQENEEHKSKLHSRGVFRLGMHLRDYFDMNPYSGPSEKYRVTSVNSKSQNFKTFKPSSPSKLDGGMKAGCFGSFPEYSSETYKAKIPKRPVNVVNSSGRTFIPPIGPKSRPVNSVLQQNIIRTITPANYRQIQSVMNY
Sbjct:    1 MTSKTDMERVGLFKELGYHTIGDPYKSSALQQFNQSASKGKQVLPGGEKSKSASNVGYFQEFTRIFDGESYSDPIKLMRKRRNESSKKKLGKNWVPVNGIKESCGSGTYYGTFSGAIPHFEAISKEQRAKGIQGKNFYTNPAKKGVGYGFVGVTLNKYPEYQSEKYDRSKDITKQENEEHKSKLHSRGVFRLGMHLRDYFDMNPYSGPSEKYRVTSVNSKSQNFKTFKPSSPSKLDGGMKAGCFGSFPEYSSETYKAKIPKRPVNVVNSSGRTFIPPIGPKSRPVNSVLQQNIIRTITPANYRQIQSVMNY 311          
BLAST of UPF0602 protein C4orf47 homolog vs. Planmine SMEST
Match: SMESG000042363.1 (SMESG000042363.1)

HSP 1 Score: 190.66 bits (483), Expect = 1.033e-57
Identity = 123/317 (38.80%), Postives = 179/317 (56.47%), Query Frame = 2
Query:   32 MTSKTDMERVGLFKELGYHTIGDPYKSSALQQFNQSASKGKQVLPGGEKSKSASNVGYFQE-FTRIFDGESYSDPIKLIRKRRNESSKKKLGKNWVPVNGIKESCGSGTYYGTFSGAIPHFEAISKEQRAKGIQGKNFYTNPAKKGVGYGFVGVTLNKYPEYQSEKYDRSKDIT-KQENEEHKSKLHSRGVFRLGMHLRDYFDMNPYS---GPSEKYRVTSVNSKSQNFKTFKPSSPSKLDGGMKAGCFGSFPEYSSETYKAKIPKRPV-NVVNSSGRTFIPPIGPKSRPVNSVLQQNIIRTITPANYRQIQSVMNY 964
            MT KTDMERVGLFKE+GYHTI DPYK        Q   KGK  L    +SK+A++ GYF + F+R+F+GES ++ + + R+ RN++ +K +GK ++  N  K+  G+G+  G     IP+F  I++  R K    KNF TNP KKG GYG+  V LN YPE++S+ YD ++++  ++E  EH+ +  +R  F        YF  NPY    GP E+    +VN   +  + F P S  K+ GG K GC   +P      YK K  +  V +V N++ + +    G KS    SVLQ+N+   +   N   I++VMNY
Sbjct:    1 MTEKTDMERVGLFKEMGYHTINDPYKPFFYSS-RQDIIKGKGFLGDMTRSKAATDDGYFTKPFSRVFEGESETNLMAMRRRWRNQNKEKNVGKTFIMSNPGKKQSGTGSRMGCMDYMIPYFSGITRTVRGKLPNKKNFITNPGKKGSGYGYADVCLNPYPEWKSDVYDGARNMYFRKEMAEHQKRTLNRKEFIPTNAYGSYFYSNPYEGGMGPYEEKHGKTVNYLQK--RPFIPGSYPKILGGNKDGCLTPYPPAFPAEYKDKFTRNLVHDVRNNTNKLYNHTPGSKSCIFQSVLQKNVNFRVNNLNSHSIRNVMNY 314          
BLAST of UPF0602 protein C4orf47 homolog vs. Planmine SMEST
Match: SMESG000033217.1 (SMESG000033217.1)

HSP 1 Score: 179.489 bits (454), Expect = 1.302e-53
Identity = 124/313 (39.62%), Postives = 174/313 (55.59%), Query Frame = 2
Query:   41 KTDMERVGLFKELGYHTIGDPYKSSALQQFNQSASKGKQVLPGGEKSKSASNVGYFQEFTRIFDGESYSDPIKLIRKRRNESSKKKLGKNWVPVNGI-KESCGSGTYYGTFSGAIPHF--EAISKEQRAKGIQGKNFYTNPAKKGVGYGFVGVTLNKYPEYQSEKYDRSKDITKQENEEHKSKLHSRGVFRLGMHLRDYFDMNPYSGPSEKYRVTSVNSKSQNFKTFKPSSPSKLDGGMKAGCFGSFPEYSSETYKAKIPKRPV----NVVNSSGRTFIPPIGPKSRPVNSVLQQNIIRTITPANYRQIQSVM 958
            K D+E+ GLF+E  Y +  D YK+    +FN S++KGKQ++    K+KSA N GYF  F R F+GE+YSDPIK IR+  N  +K+KL      +  I K   G G+YYGTFSG IP    E I +  ++  I+ +NFYTN +KKG GYG+VG+T NKYPEY+SE Y   K  + +E E      H+       +   D+FD NPY G    +         +N K+F       ++    +  F +FP+Y ++ Y  K+ KR +    NV+N S RTF    GPK+    S+L +NI R+I   NY  + SV 
Sbjct:    6 KNDLEKFGLFQEFPYQS--DLYKTPGNFEFNASSAKGKQIVIESNKTKSALNHGYFSNFLRTFEGEAYSDPIK-IRRELNRPNKEKLAGKVFHLPSIPKNPEGLGSYYGTFSGPIPAMLGETI-QFSKSDEIKKRNFYTNCSKKGTGYGYVGLTFNKYPEYKSEPYGILK--SSEEKENQNKPFHT-------VKSLDFFDSNPYKG--SIFSEGKEKPVKENLKSF------HVNTSHLSNSFNAFPKYENDVYDEKL-KRNLPYIKNVMNDSKRTFGAIPGPKTMRTFSILNKNIERSINAQNYGTVGSVF 296          
The following BLAST results are available for this feature:
BLAST of UPF0602 protein C4orf47 homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
C4orf471.466e-7844.85chromosome 4 open reading frame 47 [Source:HGNC Sy... [more]
C4orf473.386e-4548.21chromosome 4 open reading frame 47 [Source:HGNC Sy... [more]
C4orf471.021e-4350.32chromosome 4 open reading frame 47 [Source:HGNC Sy... [more]
back to top
BLAST of UPF0602 protein C4orf47 homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of UPF0602 protein C4orf47 homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of UPF0602 protein C4orf47 homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
C14H4orf472.352e-8445.95zgc:153146 [Source:NCBI gene;Acc:751702][more]
C14H4orf472.352e-8445.95zgc:153146 [Source:NCBI gene;Acc:751702][more]
zgc:1531464.653e-8445.95zgc:153146 [Source:NCBI gene;Acc:751702][more]
C14H4orf471.717e-1142.67zgc:153146 [Source:NCBI gene;Acc:751702][more]
back to top
BLAST of UPF0602 protein C4orf47 homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
C4orf472.117e-8045.90chromosome 4 open reading frame 47 [Source:NCBI ge... [more]
back to top
BLAST of UPF0602 protein C4orf47 homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
1700029J07Rik1.461e-7543.97RIKEN cDNA 1700029J07 gene [Source:MGI Symbol;Acc:... [more]
1700029J07Rik1.461e-7543.97RIKEN cDNA 1700029J07 gene [Source:MGI Symbol;Acc:... [more]
1700029J07Rik1.808e-2248.48RIKEN cDNA 1700029J07 gene [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of UPF0602 protein C4orf47 homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5XHC1|CD047_XENLA2.647e-8447.19UPF0602 protein C4orf47 homolog OS=Xenopus laevis ... [more]
sp|Q0P4C5|CD047_DANRE4.103e-8245.63UPF0602 protein C4orf47 homolog OS=Danio rerio OX=... [more]
sp|Q2T9M0|CD047_BOVIN1.208e-7844.98UPF0602 protein C4orf47 homolog OS=Bos taurus OX=9... [more]
sp|A7E2U8|CD047_HUMAN7.040e-7844.85UPF0602 protein C4orf47 OS=Homo sapiens OX=9606 GN... [more]
sp|Q3U1D9|CD047_MOUSE1.022e-7443.97UPF0602 protein C4orf47 homolog OS=Mus musculus OX... [more]
back to top
BLAST of UPF0602 protein C4orf47 homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FK752.755e-10751.60Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1S3HMA81.023e-9247.39UPF0602 protein C4orf47 homolog isoform X1 OS=Ling... [more]
A0A1S3HKS11.270e-9046.73UPF0602 protein C4orf47 homolog isoform X2 OS=Ling... [more]
A0A210QGT99.261e-9046.93UPF0602 protein C4orf47-like OS=Mizuhopecten yesso... [more]
A0A2C9K2321.311e-8947.71Uncharacterized protein OS=Biomphalaria glabrata O... [more]
back to top
BLAST of UPF0602 protein C4orf47 homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
zgc:1531466.864e-7544.69chromosome 24 C4orf47 homolog [Source:NCBI gene;Ac... [more]
back to top
BLAST of UPF0602 protein C4orf47 homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
zgc:1531462.036e-7745.27pep scaffold:Pmarinus_7.0:GL477013:54605:76454:-1 ... [more]
back to top
BLAST of UPF0602 protein C4orf47 homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of UPF0602 protein C4orf47 homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO340072.321e-7944.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of UPF0602 protein C4orf47 homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of UPF0602 protein C4orf47 homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000078789.10.000e+099.68SMESG000078789.1[more]
SMESG000042363.11.033e-5738.80SMESG000042363.1[more]
SMESG000033217.11.302e-5339.62SMESG000033217.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031988 ID=SMED30031988|Name=UPF0602 protein C4orf47 homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=1123bp
TTAGTTTTTTACTGACAATCAAATTTAGAAAATGACTTCTAAAACTGATA
TGGAAAGAGTTGGACTGTTTAAAGAATTAGGTTATCATACGATTGGTGAT
CCTTATAAATCATCTGCTTTACAACAATTTAATCAATCAGCTAGTAAAGG
TAAGCAAGTTTTACCTGGAGGAGAAAAATCAAAATCGGCTTCTAATGTTG
GATACTTTCAAGAATTCACAAGAATATTTGATGGAGAATCTTATTCTGAC
CCTATAAAGCTTATCAGAAAAAGAAGAAATGAATCTTCTAAGAAGAAACT
CGGGAAAAATTGGGTTCCTGTAAATGGAATCAAGGAATCATGTGGATCAG
GAACATATTATGGAACCTTTTCCGGAGCAATCCCTCATTTTGAAGCTATT
TCAAAAGAACAACGAGCTAAAGGTATTCAAGGTAAAAACTTCTATACAAA
TCCAGCTAAAAAAGGTGTCGGTTACGGTTTTGTTGGAGTCACTTTGAATA
AATATCCAGAATATCAATCAGAAAAATATGATCGAAGCAAGGATATAACT
AAGCAAGAAAATGAAGAGCACAAGTCCAAACTTCATAGTCGTGGTGTATT
TAGATTAGGAATGCATTTGAGAGATTATTTCGATATGAATCCGTATTCAG
GTCCGAGTGAAAAATATAGAGTCACTTCAGTTAATTCAAAAAGTCAAAAT
TTCAAAACATTCAAGCCTTCAAGTCCTTCAAAATTAGATGGTGGAATGAA
AGCAGGCTGTTTTGGATCATTCCCGGAGTACTCCAGCGAAACGTATAAAG
CTAAAATACCAAAAAGACCAGTAAATGTAGTCAACTCATCTGGAAGAACT
TTTATTCCTCCAATAGGACCAAAAAGCCGACCAGTTAATTCTGTGTTACA
ACAAAATATCATTCGAACTATTACGCCAGCTAATTATCGACAAATTCAGT
CAGTAATGAATTATTAAACATTAAAATTTATTTAATACCATAACTGCTTT
AATTGTTAAATTTAGATAACTCTGTATATTGTTTTTATCATTCTTTTTCA
TAAACTATTGATAATCCGCAGAACTAATTTTTTAAAAACTATTTTAATAT
ATAATTAATATTTCAAGACATTT
back to top

protein sequence of SMED30031988-orf-1

>SMED30031988-orf-1 ID=SMED30031988-orf-1|Name=SMED30031988-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=312bp
MTSKTDMERVGLFKELGYHTIGDPYKSSALQQFNQSASKGKQVLPGGEKS
KSASNVGYFQEFTRIFDGESYSDPIKLIRKRRNESSKKKLGKNWVPVNGI
KESCGSGTYYGTFSGAIPHFEAISKEQRAKGIQGKNFYTNPAKKGVGYGF
VGVTLNKYPEYQSEKYDRSKDITKQENEEHKSKLHSRGVFRLGMHLRDYF
DMNPYSGPSEKYRVTSVNSKSQNFKTFKPSSPSKLDGGMKAGCFGSFPEY
SSETYKAKIPKRPVNVVNSSGRTFIPPIGPKSRPVNSVLQQNIIRTITPA
NYRQIQSVMNY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR029358DUF4586
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005813centrosome
GO:0005815microtubule organizing center
GO:0005856cytoskeleton
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR029358Protein of unknown function DUF4586PFAMPF15239DUF4586coord: 5..293
e-value: 7.8E-90
score: 302.1
IPR029358Protein of unknown function DUF4586PANTHERPTHR31144FAMILY NOT NAMEDcoord: 3..298
NoneNo IPR availablePANTHERPTHR31144:SF1UPF0602 PROTEIN C4ORF47coord: 3..298