Selenoprotein F

Overview
NameSelenoprotein F
Smed IDSMED30031984
Length (bp)1723
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Selenoprotein F (SMED30031984) t-SNE clustered cells

Violin plots show distribution of expression levels for Selenoprotein F (SMED30031984) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Selenoprotein F (SMED30031984) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Selenoprotein F (SMED30031984) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031984

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30031984SMESG000044517.1 dd_Smed_v4_2376_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30031984SMESG000044517.1 dd_Smed_v4_2376_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30031984SMESG000044517.1 dd_Smed_v4_2376_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30031984SMESG000044517.1 dd_Smed_v4_2376_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031984 Contig38769uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031984 Contig38769newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30031984 dd_Smed_v4_304_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30031984 dd_Smed_v4_304_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30031984 dd_Smed_v4_304_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30031984 dd_Smed_v4_304_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30031984 dd_Smed_v4_304_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30031984 dd_Smed_v4_304_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
body wall musculatureSMED30031984 dd_Smed_v4_304_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30031984 dd_Smed_v6_304_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30031984 dd_Smed_v6_304_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Selenoprotein F vs. Ensembl Human
Match: SELENOF (selenoprotein F [Source:HGNC Symbol;Acc:HGNC:17705])

HSP 1 Score: 126.716 bits (317), Expect = 2.070e-33
Identity = 62/122 (50.82%), Postives = 78/122 (63.93%), Query Frame = 1
Query:  568 CKSLGFSSDLKCSRCSELKNFNLLTIQASCNSCCDKNQTESTATKYPYAKLIVCG*QLGRFPQIQAFVKSAKAAEFPNVEISYVRGSEPVIRLLDSNRVAVEELGIEKWDTDTIVEFFQERL 933
            C+ LGFSS+L CS C  L  FNLL +   C  CC +     T   Y  A L VCG +LGRFPQ+QAFV+S K   F  ++I YVRGS+PV++LLD N    EEL I KW+TD++ EF  E+L
Sbjct:   41 CRELGFSSNLLCSSCDLLGQFNLLQLDPDCRGCCQEEAQFETKKLYAGAILEVCGUKLGRFPQVQAFVRSDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLSEKL 162          
BLAST of Selenoprotein F vs. Ensembl Human
Match: SELENOF (selenoprotein F [Source:HGNC Symbol;Acc:HGNC:17705])

HSP 1 Score: 124.02 bits (310), Expect = 1.990e-32
Identity = 62/122 (50.82%), Postives = 78/122 (63.93%), Query Frame = 1
Query:  568 CKSLGFSSDLKCSRCSELKNFNLLTIQASCNSCCDKNQTESTATKYPYAKLIVCG*QLGRFPQIQAFVKSAKAAEFPNVEISYVRGSEPVIRLLDSNRVAVEELGIEKWDTDTIVEFFQERL 933
            C+ LGFSS+L CS C  L  FNLL +   C  CC +     T   Y  A L VCG +LGRFPQ+QAFV+S K   F  ++I YVRGS+PV++LLD N    EEL I KW+TD++ EF  E+L
Sbjct:   41 CRELGFSSNLLCSSCDLLGQFNLLQLDPDCRGCCQEEAQFETKKLYAGAILEVCG-KLGRFPQVQAFVRSDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLSEKL 161          
BLAST of Selenoprotein F vs. Ensembl Human
Match: SERP2 (stress associated endoplasmic reticulum protein family member 2 [Source:HGNC Symbol;Acc:HGNC:20607])

HSP 1 Score: 89.3521 bits (220), Expect = 2.582e-21
Identity = 39/57 (68.42%), Postives = 47/57 (82.46%), Query Frame = -2
Query:  289 RFANEKASKKVLNRGNVPKSLRPQDDKYPVSTWLLGLFIFVVCGSAIFEIVQHIRLG 459
            R ANEK SK +  RGNV K+LRPQ++KYPV  WLL LF+FVVCGSAIF+I+Q IR+G
Sbjct:    8 RMANEKHSKNITQRGNVAKTLRPQEEKYPVGPWLLALFVFVVCGSAIFQIIQSIRMG 64          
BLAST of Selenoprotein F vs. Ensembl Human
Match: SELENOF (selenoprotein F [Source:HGNC Symbol;Acc:HGNC:17705])

HSP 1 Score: 78.1814 bits (191), Expect = 1.141e-16
Identity = 40/85 (47.06%), Postives = 49/85 (57.65%), Query Frame = 1
Query:  568 CKSLGFSSDLKCSRCSELKNFNLLTIQASCNSCCDKNQTESTATKYPYAKLIVCG*QLGRFPQIQAFVKSAKAAEFPNVEISYVR 822
            C+ LGFSS+L CS C  L  FNLL +   C  CC +     T   Y  A L VCG +LGRFPQ+QAFV+S K   F  ++I   R
Sbjct:   41 CRELGFSSNLLCSSCDLLGQFNLLQLDPDCRGCCQEEAQFETKKLYAGAILEVCGUKLGRFPQVQAFVRSDKPKLFRGLQIKAGR 125          
BLAST of Selenoprotein F vs. Ensembl Human
Match: SERP2 (stress associated endoplasmic reticulum protein family member 2 [Source:HGNC Symbol;Acc:HGNC:20607])

HSP 1 Score: 73.9442 bits (180), Expect = 8.511e-16
Identity = 33/52 (63.46%), Postives = 41/52 (78.85%), Query Frame = -2
Query:  307 RFANEKASKKVLNRGNVPKSLRPQDDKYPVSTWLLGLFIFVVCGS-AIFEIV 459
            R ANEK SK +  RGNV K+LRPQ++KYPV  WLL LF+FVVCGS ++F +V
Sbjct:    8 RMANEKHSKNITQRGNVAKTLRPQEEKYPVGPWLLALFVFVVCGSVSVFSLV 59          
BLAST of Selenoprotein F vs. Ensembl Celegans
Match: Y76B12C.3 (pep chromosome:WBcel235:IV:1973702:1975677:1 gene:WBGene00022297.1 transcript:Y76B12C.3a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y76B12C.3)

HSP 1 Score: 95.5153 bits (236), Expect = 6.389e-23
Identity = 53/124 (42.74%), Postives = 74/124 (59.68%), Query Frame = 1
Query:  568 CKSLGFSSD-LKCSRCSELKNFNLLTIQASCNSCCDKNQTESTATKYPYAKLIVCG*QLGRFPQIQAFVKSAKAAEFP-NVEISYVRGSEPVIRLLDSNRVAVEELGIEKWDTDTIVEFFQERL 933
            CK+ GF+ + LKC  C  L +++L T+   C  CC K + E    KYP A L VC   L RFPQ+QAFV    A +F   V++ +VRG  P + L D++    E L +EKWDTDT+++FF + L
Sbjct:   29 CKAAGFNPETLKCGLCERLSDYHLETLLTDCLQCCIKEE-EFKHEKYPTAILEVCECNLARFPQVQAFVHKDMARQFGGKVKVKHVRGVRPQVALKDADFKTKEVLSVEKWDTDTLIDFFNQWL 151          
BLAST of Selenoprotein F vs. Ensembl Celegans
Match: F59F4.2 (pep chromosome:WBcel235:X:15841572:15842379:1 gene:WBGene00010337.1 transcript:F59F4.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F59F4.2)

HSP 1 Score: 83.5741 bits (205), Expect = 9.021e-20
Identity = 34/57 (59.65%), Postives = 49/57 (85.96%), Query Frame = -2
Query:  286 FANEKASKKVLNRGNVPKSLRPQDDKYPVSTWLLGLFIFVVCGSAIFEIVQHIRLGF 456
             AN++ SK V NRGNV KSL+P +DKYP + WL+GLF+FVVCGSA+FEI++++++G+
Sbjct:    9 LANKQFSKNVNNRGNVAKSLKPAEDKYPAAPWLIGLFVFVVCGSAVFEIIRYVKMGW 65          
BLAST of Selenoprotein F vs. Ensembl Celegans
Match: T09A12.5 (pep chromosome:WBcel235:IV:8225676:8226366:1 gene:WBGene00020374.1 transcript:T09A12.5.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T09A12.5)

HSP 1 Score: 73.559 bits (179), Expect = 3.306e-16
Identity = 31/54 (57.41%), Postives = 42/54 (77.78%), Query Frame = -2
Query:  292 ANEKASKKVLNRGNVPKSLRPQDDKYPVSTWLLGLFIFVVCGSAIFEIVQHIRL 453
            AN + SK V  RGNVPK  +  + K+P S WL+GLFIFVVCGSAIFE++++I++
Sbjct:   10 ANAQFSKNVTQRGNVPKGNKTNESKFPTSQWLIGLFIFVVCGSAIFEVIRYIKV 63          
BLAST of Selenoprotein F vs. Ensembl Celegans
Match: T09A12.5 (pep chromosome:WBcel235:IV:8225674:8226352:1 gene:WBGene00020374.1 transcript:T09A12.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T09A12.5)

HSP 1 Score: 73.559 bits (179), Expect = 3.306e-16
Identity = 31/54 (57.41%), Postives = 42/54 (77.78%), Query Frame = -2
Query:  292 ANEKASKKVLNRGNVPKSLRPQDDKYPVSTWLLGLFIFVVCGSAIFEIVQHIRL 453
            AN + SK V  RGNVPK  +  + K+P S WL+GLFIFVVCGSAIFE++++I++
Sbjct:   10 ANAQFSKNVTQRGNVPKGNKTNESKFPTSQWLIGLFIFVVCGSAIFEVIRYIKV 63          
BLAST of Selenoprotein F vs. Ensembl Fly
Match: CG7484 (gene:FBgn0036745 transcript:FBtr0075184)

HSP 1 Score: 117.087 bits (292), Expect = 4.233e-30
Identity = 55/124 (44.35%), Postives = 80/124 (64.52%), Query Frame = 1
Query:  565 NCKSLGF-SSDLKCSRCSELKNFNLLTIQASCNSCCDKNQTESTATKYPYAKLIVCG*QLGRFPQIQAFVKSAKAAEFPNVEISYVRGSEPVIRLLDSNRVAVEELGIEKWDTDTIVEFFQERL 933
            +C++LGF  + L CS C +L +F L TI+  C  CC  +Q  +    Y  A L VC  +   +PQIQAF++S + A+FPN++I YVRG +PV++LLD++    E L I KW+TDT+ EFF+  L
Sbjct:   25 DCRALGFIKAQLMCSSCEKLDDFGLDTIKPQCKQCCTLDQQPAAQRTYAKAILEVCTCKFRAYPQIQAFIQSGRPAKFPNLQIKYVRGLDPVVKLLDASGKVQETLSITKWNTDTVEEFFETHL 148          
BLAST of Selenoprotein F vs. Ensembl Fly
Match: CG32276 (gene:FBgn0047135 transcript:FBtr0073107)

HSP 1 Score: 79.7221 bits (195), Expect = 2.336e-18
Identity = 39/55 (70.91%), Postives = 44/55 (80.00%), Query Frame = -2
Query:  295 RFANEKASKKVLNRGNVPKSLRPQDDKYPVSTWLLGLFIFVVCGSAIFEIVQHIR 459
            R ANEKASK V  RGNVPKS + ++ +YPV  WLL LFIFVVCGSAIF+IVQ IR
Sbjct:    8 RVANEKASKYVTMRGNVPKSSKTKEGQYPVGPWLLALFIFVVCGSAIFQIVQSIR 62          
BLAST of Selenoprotein F vs. Ensembl Fly
Match: CG32276 (gene:FBgn0047135 transcript:FBtr0073106)

HSP 1 Score: 79.7221 bits (195), Expect = 2.336e-18
Identity = 39/55 (70.91%), Postives = 44/55 (80.00%), Query Frame = -2
Query:  295 RFANEKASKKVLNRGNVPKSLRPQDDKYPVSTWLLGLFIFVVCGSAIFEIVQHIR 459
            R ANEKASK V  RGNVPKS + ++ +YPV  WLL LFIFVVCGSAIF+IVQ IR
Sbjct:    8 RVANEKASKYVTMRGNVPKSSKTKEGQYPVGPWLLALFIFVVCGSAIFQIVQSIR 62          
BLAST of Selenoprotein F vs. Ensembl Zebrafish
Match: selenof (selenoprotein F [Source:NCBI gene;Acc:352923])

HSP 1 Score: 122.094 bits (305), Expect = 4.077e-32
Identity = 60/122 (49.18%), Postives = 77/122 (63.11%), Query Frame = 1
Query:  568 CKSLGFSSDLKCSRCSELKNFNLLTIQASCNSCCDKNQTESTATKYPYAKLIVCG*QLGRFPQIQAFVKSAKAAEFPNVEISYVRGSEPVIRLLDSNRVAVEELGIEKWDTDTIVEFFQERL 933
            C+ LGFSS+L CS C  L  F+L  +   C  CC +         YP A L VCG +LGRFPQ+QAFV+S K   F  ++I YVRGS+PV++LLD N    EEL I KW+TD++ EF  E+L
Sbjct:   29 CRELGFSSNLLCSSCELLGQFSLNQLDLPCRQCCQEEAQLENRKLYPGAILEVCGUKLGRFPQVQAFVRSDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLSEKL 150          
BLAST of Selenoprotein F vs. Ensembl Zebrafish
Match: serp2 (stress-associated endoplasmic reticulum protein family member 2 [Source:ZFIN;Acc:ZDB-GENE-081104-143])

HSP 1 Score: 89.3521 bits (220), Expect = 1.643e-21
Identity = 39/57 (68.42%), Postives = 47/57 (82.46%), Query Frame = -2
Query:  289 RFANEKASKKVLNRGNVPKSLRPQDDKYPVSTWLLGLFIFVVCGSAIFEIVQHIRLG 459
            R ANEK SK +  RGNV K+LRPQ++KYPV  WLL LF+FVVCGSAIF+I+Q IR+G
Sbjct:    8 RMANEKHSKNITQRGNVAKTLRPQEEKYPVGPWLLALFVFVVCGSAIFQIIQSIRMG 64          
BLAST of Selenoprotein F vs. Ensembl Zebrafish
Match: SERP1 (zgc:92744 [Source:ZFIN;Acc:ZDB-GENE-040718-312])

HSP 1 Score: 75.0998 bits (183), Expect = 1.669e-16
Identity = 34/58 (58.62%), Postives = 40/58 (68.97%), Query Frame = -2
Query:  286 RFANEKASKKVLNRGNVPKSLRPQDDKYPVSTWLLGLFIFVVCGSAIFEIVQHIRLGF 459
            R ANEK SK +  RGNV  S    +DK  V  WLL LF+FVVCGSAIF+I+Q IR+G 
Sbjct:    8 RMANEKHSKNITQRGNVKSSRNVSEDKVSVGPWLLALFVFVVCGSAIFQIIQSIRMGM 65          
BLAST of Selenoprotein F vs. Ensembl Zebrafish
Match: serp1 (stress-associated endoplasmic reticulum protein 1 [Source:ZFIN;Acc:ZDB-GENE-030131-8741])

HSP 1 Score: 72.4034 bits (176), Expect = 1.523e-15
Identity = 36/58 (62.07%), Postives = 43/58 (74.14%), Query Frame = -2
Query:  289 RFANEKASKKVLNRGNVPKSLR-PQDDKYPVSTWLLGLFIFVVCGSAIFEIVQHIRLG 459
            R ANEK SK +  RGNV KS R  Q++K  V  WLL LF+FVVCGSAIF+I+Q IR+G
Sbjct:    8 RMANEKHSKNITLRGNVAKSTRGTQEEKAVVGPWLLALFVFVVCGSAIFQIIQSIRMG 65          
BLAST of Selenoprotein F vs. Ensembl Zebrafish
Match: zgc:85858 (zgc:85858 [Source:ZFIN;Acc:ZDB-GENE-040426-2333])

HSP 1 Score: 68.1662 bits (165), Expect = 4.814e-14
Identity = 33/58 (56.90%), Postives = 42/58 (72.41%), Query Frame = -2
Query:  289 RFANEKASKKVLNRGNVPKSLRP-QDDKYPVSTWLLGLFIFVVCGSAIFEIVQHIRLG 459
            + ANEK SK +  RG+V K+ R   ++K PV  WLL LF+FVVCGSAIF+I+Q IR G
Sbjct:    8 KVANEKHSKTITQRGHVQKTTRVVNEEKSPVGPWLLALFVFVVCGSAIFQIIQSIRQG 65          
BLAST of Selenoprotein F vs. Ensembl Xenopus
Match: serp2 (stress-associated endoplasmic reticulum protein family member 2 [Source:NCBI gene;Acc:779835])

HSP 1 Score: 89.3521 bits (220), Expect = 2.341e-21
Identity = 39/57 (68.42%), Postives = 47/57 (82.46%), Query Frame = -2
Query:  289 RFANEKASKKVLNRGNVPKSLRPQDDKYPVSTWLLGLFIFVVCGSAIFEIVQHIRLG 459
            R ANEK SK +  RGNV K+LRPQ++KYPV  WLL LF+FVVCGSAIF+I+Q IR+G
Sbjct:    8 RMANEKHSKNITQRGNVAKTLRPQEEKYPVGPWLLALFVFVVCGSAIFQIIQSIRMG 64          
BLAST of Selenoprotein F vs. Ensembl Xenopus
Match: serp2 (stress-associated endoplasmic reticulum protein family member 2 [Source:NCBI gene;Acc:779835])

HSP 1 Score: 72.7886 bits (177), Expect = 1.631e-15
Identity = 31/47 (65.96%), Postives = 37/47 (78.72%), Query Frame = -2
Query:  319 RFANEKASKKVLNRGNVPKSLRPQDDKYPVSTWLLGLFIFVVCGSAI 459
            R ANEK SK +  RGNV K+LRPQ++KYPV  WLL LF+FVVCGS +
Sbjct:    8 RMANEKHSKNITQRGNVAKTLRPQEEKYPVGPWLLALFVFVVCGSGM 54          
BLAST of Selenoprotein F vs. Ensembl Xenopus
Match: kiaa0513 (KIAA0513 [Source:Xenbase;Acc:XB-GENE-5956311])

HSP 1 Score: 73.1738 bits (178), Expect = 4.438e-15
Identity = 36/59 (61.02%), Postives = 42/59 (71.19%), Query Frame = -2
Query:  286 RFANEKASKKVLNRGNVPKSLRP-QDDKYPVSTWLLGLFIFVVCGSAIFEIVQHIRLGF 459
            R ANEK SK +  RGNV KS R   ++K  V  WLL LFIFVVCGSAIF+I+Q IR+G 
Sbjct:   63 RMANEKHSKNITQRGNVAKSSRNVTEEKSAVGPWLLALFIFVVCGSAIFQIIQSIRMGM 121          
BLAST of Selenoprotein F vs. Ensembl Xenopus
Match: kiaa0513 (KIAA0513 [Source:Xenbase;Acc:XB-GENE-5956311])

HSP 1 Score: 73.1738 bits (178), Expect = 4.471e-15
Identity = 36/59 (61.02%), Postives = 42/59 (71.19%), Query Frame = -2
Query:  286 RFANEKASKKVLNRGNVPKSLRP-QDDKYPVSTWLLGLFIFVVCGSAIFEIVQHIRLGF 459
            R ANEK SK +  RGNV KS R   ++K  V  WLL LFIFVVCGSAIF+I+Q IR+G 
Sbjct:   63 RMANEKHSKNITQRGNVAKSSRNVTEEKSAVGPWLLALFIFVVCGSAIFQIIQSIRMGM 121          
BLAST of Selenoprotein F vs. Ensembl Xenopus
Match: kiaa0513 (KIAA0513 [Source:Xenbase;Acc:XB-GENE-5956311])

HSP 1 Score: 55.0694 bits (131), Expect = 2.537e-9
Identity = 28/48 (58.33%), Postives = 32/48 (66.67%), Query Frame = -2
Query:  319 RFANEKASKKVLNRGNVPKSLRP-QDDKYPVSTWLLGLFIFVVCGSAI 459
            R ANEK SK +  RGNV KS R   ++K  V  WLL LFIFVVCGS +
Sbjct:    8 RMANEKHSKNITQRGNVAKSSRNVTEEKSAVGPWLLALFIFVVCGSGV 55          
BLAST of Selenoprotein F vs. Ensembl Mouse
Match: Selenof (selenoprotein F [Source:MGI Symbol;Acc:MGI:1927947])

HSP 1 Score: 126.331 bits (316), Expect = 1.795e-33
Identity = 62/122 (50.82%), Postives = 78/122 (63.93%), Query Frame = 1
Query:  568 CKSLGFSSDLKCSRCSELKNFNLLTIQASCNSCCDKNQTESTATKYPYAKLIVCG*QLGRFPQIQAFVKSAKAAEFPNVEISYVRGSEPVIRLLDSNRVAVEELGIEKWDTDTIVEFFQERL 933
            C+ LGFSS+L CS C  L  FNLL +   C  CC +     T   Y  A L VCG +LGRFPQ+QAFV+S K   F  ++I YVRGS+PV++LLD N    EEL I KW+TD++ EF  E+L
Sbjct:   38 CRELGFSSNLLCSSCDLLGQFNLLPLDPVCRGCCQEEAQFETKKLYAGAILEVCGUKLGRFPQVQAFVRSDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLSEKL 159          
BLAST of Selenoprotein F vs. Ensembl Mouse
Match: Serp2 (stress-associated endoplasmic reticulum protein family member 2 [Source:MGI Symbol;Acc:MGI:1919911])

HSP 1 Score: 89.3521 bits (220), Expect = 1.773e-21
Identity = 39/57 (68.42%), Postives = 47/57 (82.46%), Query Frame = -2
Query:  289 RFANEKASKKVLNRGNVPKSLRPQDDKYPVSTWLLGLFIFVVCGSAIFEIVQHIRLG 459
            R ANEK SK +  RGNV K+LRPQ++KYPV  WLL LF+FVVCGSAIF+I+Q IR+G
Sbjct:    8 RMANEKHSKNITQRGNVAKTLRPQEEKYPVGPWLLALFVFVVCGSAIFQIIQSIRMG 64          
BLAST of Selenoprotein F vs. Ensembl Mouse
Match: Serp2 (stress-associated endoplasmic reticulum protein family member 2 [Source:MGI Symbol;Acc:MGI:1919911])

HSP 1 Score: 70.8626 bits (172), Expect = 3.687e-15
Identity = 31/46 (67.39%), Postives = 36/46 (78.26%), Query Frame = -2
Query:  322 RFANEKASKKVLNRGNVPKSLRPQDDKYPVSTWLLGLFIFVVCGSA 459
            R ANEK SK +  RGNV K+LRPQ++KYPV  WLL LF+FVVCGS 
Sbjct:    8 RMANEKHSKNITQRGNVAKTLRPQEEKYPVGPWLLALFVFVVCGSG 53          
BLAST of Selenoprotein F vs. Ensembl Mouse
Match: Serp1 (stress-associated endoplasmic reticulum protein 1 [Source:MGI Symbol;Acc:MGI:92638])

HSP 1 Score: 70.4774 bits (171), Expect = 6.695e-15
Identity = 35/58 (60.34%), Postives = 42/58 (72.41%), Query Frame = -2
Query:  289 RFANEKASKKVLNRGNVPKSLR-PQDDKYPVSTWLLGLFIFVVCGSAIFEIVQHIRLG 459
            R ANEK SK +  RGNV K+ R   ++K  V  WLL LFIFVVCGSAIF+I+Q IR+G
Sbjct:    8 RMANEKHSKNITQRGNVAKTSRNAPEEKASVGPWLLALFIFVVCGSAIFQIIQSIRMG 65          
BLAST of Selenoprotein F vs. Ensembl Mouse
Match: Selenof (selenoprotein F [Source:MGI Symbol;Acc:MGI:1927947])

HSP 1 Score: 64.3142 bits (155), Expect = 4.545e-12
Identity = 32/65 (49.23%), Postives = 38/65 (58.46%), Query Frame = 1
Query:  568 CKSLGFSSDLKCSRCSELKNFNLLTIQASCNSCCDKNQTESTATKYPYAKLIVCG*QLGRFPQIQ 762
            C+ LGFSS+L CS C  L  FNLL +   C  CC +     T   Y  A L VCG +LGRFPQ+Q
Sbjct:   38 CRELGFSSNLLCSSCDLLGQFNLLPLDPVCRGCCQEEAQFETKKLYAGAILEVCGUKLGRFPQVQ 102          
BLAST of Selenoprotein F vs. UniProt/SwissProt
Match: sp|O60613|SEP15_HUMAN (Selenoprotein F OS=Homo sapiens OX=9606 GN=SELENOF PE=1 SV=4)

HSP 1 Score: 126.716 bits (317), Expect = 9.941e-33
Identity = 62/122 (50.82%), Postives = 78/122 (63.93%), Query Frame = 1
Query:  568 CKSLGFSSDLKCSRCSELKNFNLLTIQASCNSCCDKNQTESTATKYPYAKLIVCG*QLGRFPQIQAFVKSAKAAEFPNVEISYVRGSEPVIRLLDSNRVAVEELGIEKWDTDTIVEFFQERL 933
            C+ LGFSS+L CS C  L  FNLL +   C  CC +     T   Y  A L VCG +LGRFPQ+QAFV+S K   F  ++I YVRGS+PV++LLD N    EEL I KW+TD++ EF  E+L
Sbjct:   41 CRELGFSSNLLCSSCDLLGQFNLLQLDPDCRGCCQEEAQFETKKLYAGAILEVCGUKLGRFPQVQAFVRSDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLSEKL 162          
BLAST of Selenoprotein F vs. UniProt/SwissProt
Match: sp|Q9ERR7|SEP15_MOUSE (Selenoprotein F OS=Mus musculus OX=10090 GN=Selenof PE=1 SV=3)

HSP 1 Score: 126.331 bits (316), Expect = 1.320e-32
Identity = 62/122 (50.82%), Postives = 78/122 (63.93%), Query Frame = 1
Query:  568 CKSLGFSSDLKCSRCSELKNFNLLTIQASCNSCCDKNQTESTATKYPYAKLIVCG*QLGRFPQIQAFVKSAKAAEFPNVEISYVRGSEPVIRLLDSNRVAVEELGIEKWDTDTIVEFFQERL 933
            C+ LGFSS+L CS C  L  FNLL +   C  CC +     T   Y  A L VCG +LGRFPQ+QAFV+S K   F  ++I YVRGS+PV++LLD N    EEL I KW+TD++ EF  E+L
Sbjct:   38 CRELGFSSNLLCSSCDLLGQFNLLPLDPVCRGCCQEEAQFETKKLYAGAILEVCGUKLGRFPQVQAFVRSDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLSEKL 159          
BLAST of Selenoprotein F vs. UniProt/SwissProt
Match: sp|Q923V8|SEP15_RAT (Selenoprotein F OS=Rattus norvegicus OX=10116 GN=Selenof PE=1 SV=3)

HSP 1 Score: 126.331 bits (316), Expect = 1.347e-32
Identity = 62/122 (50.82%), Postives = 78/122 (63.93%), Query Frame = 1
Query:  568 CKSLGFSSDLKCSRCSELKNFNLLTIQASCNSCCDKNQTESTATKYPYAKLIVCG*QLGRFPQIQAFVKSAKAAEFPNVEISYVRGSEPVIRLLDSNRVAVEELGIEKWDTDTIVEFFQERL 933
            C+ LGFSS+L CS C  L  FNLL +   C  CC +     T   Y  A L VCG +LGRFPQ+QAFV+S K   F  ++I YVRGS+PV++LLD N    EEL I KW+TD++ EF  E+L
Sbjct:   38 CRELGFSSNLLCSSCDLLGQFNLLPLDPVCRGCCQEEAQFETKKLYAGAILEVCGUKLGRFPQVQAFVRSDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLSEKL 159          
BLAST of Selenoprotein F vs. UniProt/SwissProt
Match: sp|A8YXY3|SEP15_BOVIN (Selenoprotein F OS=Bos taurus OX=9913 GN=SELENOF PE=2 SV=2)

HSP 1 Score: 125.176 bits (313), Expect = 2.971e-32
Identity = 61/123 (49.59%), Postives = 79/123 (64.23%), Query Frame = 1
Query:  565 NCKSLGFSSDLKCSRCSELKNFNLLTIQASCNSCCDKNQTESTATKYPYAKLIVCG*QLGRFPQIQAFVKSAKAAEFPNVEISYVRGSEPVIRLLDSNRVAVEELGIEKWDTDTIVEFFQERL 933
            +C+ LGFSS+L CS C  L  FNLL +   C  CC +     T   Y  A L VCG +LGRFPQ+QAFV+S K   F  ++I YVRGS+PV++LLD +    EEL I KW+TD++ EF  E+L
Sbjct:   37 SCRELGFSSNLLCSSCDLLGQFNLLQLDPDCRGCCQEEAQFETKKLYAGAILEVCGUKLGRFPQVQAFVRSDKPKLFKGLQIKYVRGSDPVLKLLDDSGNIAEELSILKWNTDSVEEFLSEKL 159          
BLAST of Selenoprotein F vs. UniProt/SwissProt
Match: sp|A1Z623|SEP15_PIG (Selenoprotein F OS=Sus scrofa OX=9823 GN=SELENOF PE=2 SV=2)

HSP 1 Score: 124.405 bits (311), Expect = 6.230e-32
Identity = 60/123 (48.78%), Postives = 78/123 (63.41%), Query Frame = 1
Query:  565 NCKSLGFSSDLKCSRCSELKNFNLLTIQASCNSCCDKNQTESTATKYPYAKLIVCG*QLGRFPQIQAFVKSAKAAEFPNVEISYVRGSEPVIRLLDSNRVAVEELGIEKWDTDTIVEFFQERL 933
            +C+ LGFSS+L C  C  L  F+LL +   C  CC +     T   Y  A L VCG +LGRFPQ+QAFV+S K   F  ++I YVRGS+PV++LLD N    EEL I KW+TD++ EF  E+L
Sbjct:   37 SCRELGFSSNLLCGSCDLLGQFDLLQLDPDCRGCCQEEAQFETKKLYAGAILEVCGUKLGRFPQVQAFVRSDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLSEKL 159          
BLAST of Selenoprotein F vs. TrEMBL
Match: A0A2C9KDI0 (Sep15_SelM domain-containing protein OS=Biomphalaria glabrata OX=6526 PE=4 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 2.262e-36
Identity = 65/123 (52.85%), Postives = 88/123 (71.54%), Query Frame = 1
Query:  568 CKSLGFSSDLKCSRCSELKNFNLLTIQASCNSCCDKNQTE-STATKYPYAKLIVCG*QLGRFPQIQAFVKSAKAAEFPNVEISYVRGSEPVIRLLDSNRVAVEELGIEKWDTDTIVEFFQERL 933
            C   GF+ +L CS C  + +FNL  I+ SC  CC K++ E S   KYPYA+L+VCG +LGRFPQ+QAFVKS +  +FP + + YVRG++P+I+LLD N   VE LGI+KW+TD++ EFF E L
Sbjct:   29 CALKGFTPNLLCSTCELMDDFNLSPIKPSCLECCQKDEAELSGPVKYPYAELVVCGCKLGRFPQVQAFVKSDRPNQFPRLTVRYVRGADPIIKLLDENHNVVETLGIDKWNTDSVEEFFLEHL 151          
BLAST of Selenoprotein F vs. TrEMBL
Match: A0A1S3IE82 (selenoprotein F-like OS=Lingula unguis OX=7574 GN=LOC106179527 PE=4 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 8.774e-36
Identity = 63/126 (50.00%), Postives = 91/126 (72.22%), Query Frame = 1
Query:  559 SLNCKSLGFSSDLKCSRCSELKNFNLLTIQASCNSCCDKNQTESTATK-YPYAKLIVCG*QLGRFPQIQAFVKSAKAAEFPNVEISYVRGSEPVIRLLDSNRVAVEELGIEKWDTDTIVEFFQERL 933
            S  C+ LGF+++L CS C+EL NF L  +   C+ CC +++ E    + +P+A+L VC  +LGR+PQ+QAFVKS + ++FP + + YVRG++PVI+LLD NRV  E L IEKW+TD++ EFF ERL
Sbjct:   25 SEQCRELGFTTNLFCSTCNELANFELQKLSEDCHQCCQEDKDEEKNEQLFPFAELQVCQUKLGRYPQVQAFVKSDRPSQFPGLRVKYVRGADPVIKLLDDNRVVQETLSIEKWNTDSVEEFFHERL 150          
BLAST of Selenoprotein F vs. TrEMBL
Match: A0A1U7TBM3 (selenoprotein F OS=Tarsius syrichta OX=1868482 GN=SELENOF PE=4 SV=2)

HSP 1 Score: 127.487 bits (319), Expect = 1.312e-30
Identity = 62/123 (50.41%), Postives = 80/123 (65.04%), Query Frame = 1
Query:  565 NCKSLGFSSDLKCSRCSELKNFNLLTIQASCNSCCDKNQTESTATKYPYAKLIVCG*QLGRFPQIQAFVKSAKAAEFPNVEISYVRGSEPVIRLLDSNRVAVEELGIEKWDTDTIVEFFQERL 933
            +C+ LGFSS+L CS C  L  FNLL +  +C  CC +     T   Y  A L VCG +LGRFPQ+QAFV+S K   F  ++I YVRGS+PV++LLD N    EEL I KW+TD++ EF  E+L
Sbjct:   37 SCRELGFSSNLLCSSCDLLGQFNLLQLDPNCRGCCQEEAQFETKKLYAGAILEVCGUKLGRFPQVQAFVRSDKTKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLSEKL 159          
BLAST of Selenoprotein F vs. TrEMBL
Match: A0A2U3Y6P5 (LOW QUALITY PROTEIN: 15 kDa selenoprotein-like OS=Leptonychotes weddellii OX=9713 GN=LOC102726805 PE=4 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 1.803e-30
Identity = 62/122 (50.82%), Postives = 78/122 (63.93%), Query Frame = 1
Query:  568 CKSLGFSSDLKCSRCSELKNFNLLTIQASCNSCCDKNQTESTATKYPYAKLIVCG*QLGRFPQIQAFVKSAKAAEFPNVEISYVRGSEPVIRLLDSNRVAVEELGIEKWDTDTIVEFFQERL 933
            C+ LGFSS+L CS C  L  FNLL +   C  CC +     T   Y  A L VCG +LGRFPQ+QAFV+S K   F  ++I YVRGS+PV++LLD N    EEL I KW+TD++ EF  E+L
Sbjct:   41 CRELGFSSNLLCSSCDLLGQFNLLQLDPDCRGCCQEEAQFETKKLYAGAILEVCGXKLGRFPQVQAFVRSDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLSEKL 162          
BLAST of Selenoprotein F vs. TrEMBL
Match: A0A384C1Z0 (LOW QUALITY PROTEIN: 15 kDa selenoprotein OS=Ursus maritimus OX=29073 GN=LOC103662940 PE=4 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 1.973e-30
Identity = 62/122 (50.82%), Postives = 78/122 (63.93%), Query Frame = 1
Query:  568 CKSLGFSSDLKCSRCSELKNFNLLTIQASCNSCCDKNQTESTATKYPYAKLIVCG*QLGRFPQIQAFVKSAKAAEFPNVEISYVRGSEPVIRLLDSNRVAVEELGIEKWDTDTIVEFFQERL 933
            C+ LGFSS+L CS C  L  FNLL +   C  CC +     T   Y  A L VCG +LGRFPQ+QAFV+S K   F  ++I YVRGS+PV++LLD N    EEL I KW+TD++ EF  E+L
Sbjct:   41 CRELGFSSNLLCSSCDLLGQFNLLQLDPDCRGCCQEEAQFETKKLYAGAILEVCGXKLGRFPQVQAFVRSDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLSEKL 162          
BLAST of Selenoprotein F vs. Ensembl Cavefish
Match: selenof (selenoprotein F [Source:NCBI gene;Acc:352923])

HSP 1 Score: 105.916 bits (263), Expect = 1.644e-26
Identity = 54/123 (43.90%), Postives = 76/123 (61.79%), Query Frame = 1
Query:  568 CKSLGFSSDLKCSRCSELKNFNLLTIQASCNSCC-DKNQTESTATKYPYAKLIVCG*QLGRFPQIQAFVKSAKAAEFPNVEISYVRGSEPVIRLLDSNRVAVEELGIEKWDTDTIVEFFQERL 933
            C+ +GFSS+L CS C  L  F+L  ++  C  CC ++ Q ES   K P   +I+       FPQ+QAFV+S K   F  ++I YVRGS+PV++LLD N    +EL I KW+TD++ EF  E+L
Sbjct:   30 CREMGFSSNLLCSSCDLLGEFSLTQLEPFCRKCCQEEAQLESRKVKIPIYLVIL-------FPQVQAFVRSDKPKMFKGLQIKYVRGSDPVLKLLDDNGNIADELSILKWNTDSVEEFLGEKL 145          
BLAST of Selenoprotein F vs. Ensembl Cavefish
Match: serp2 (stress-associated endoplasmic reticulum protein 2 [Source:NCBI gene;Acc:111190086])

HSP 1 Score: 89.3521 bits (220), Expect = 1.392e-21
Identity = 39/57 (68.42%), Postives = 47/57 (82.46%), Query Frame = -2
Query:  289 RFANEKASKKVLNRGNVPKSLRPQDDKYPVSTWLLGLFIFVVCGSAIFEIVQHIRLG 459
            R ANEK SK +  RGNV K+LRPQ++KYPV  WLL LF+FVVCGSAIF+I+Q IR+G
Sbjct:    8 RMANEKHSKNITQRGNVAKTLRPQEEKYPVGPWLLALFVFVVCGSAIFQIIQSIRMG 64          
BLAST of Selenoprotein F vs. Ensembl Cavefish
Match: ENSAMXT00000036257.1 (stress-associated endoplasmic reticulum protein 2 [Source:NCBI gene;Acc:111190086])

HSP 1 Score: 89.3521 bits (220), Expect = 1.392e-21
Identity = 39/57 (68.42%), Postives = 47/57 (82.46%), Query Frame = -2
Query:  289 RFANEKASKKVLNRGNVPKSLRPQDDKYPVSTWLLGLFIFVVCGSAIFEIVQHIRLG 459
            R ANEK SK +  RGNV K+LRPQ++KYPV  WLL LF+FVVCGSAIF+I+Q IR+G
Sbjct:    8 RMANEKHSKNITQRGNVAKTLRPQEEKYPVGPWLLALFVFVVCGSAIFQIIQSIRMG 64          
BLAST of Selenoprotein F vs. Ensembl Cavefish
Match: serp1 (stress associated endoplasmic reticulum protein 1 [Source:NCBI gene;Acc:103030196])

HSP 1 Score: 78.5666 bits (192), Expect = 7.349e-18
Identity = 38/58 (65.52%), Postives = 44/58 (75.86%), Query Frame = -2
Query:  289 RFANEKASKKVLNRGNVPKSLR-PQDDKYPVSTWLLGLFIFVVCGSAIFEIVQHIRLG 459
            R ANEK SK +  RGNV KS R PQD+K  V  WLL LF+FVVCGSAIF+I+Q IR+G
Sbjct:    8 RMANEKHSKNITQRGNVAKSSRGPQDEKAAVGPWLLALFVFVVCGSAIFQIIQSIRMG 65          
BLAST of Selenoprotein F vs. Ensembl Cavefish
Match: zgc:92744 (stress-associated endoplasmic reticulum protein 1-like [Source:NCBI gene;Acc:103025790])

HSP 1 Score: 70.8626 bits (172), Expect = 4.132e-15
Identity = 33/57 (57.89%), Postives = 40/57 (70.18%), Query Frame = -2
Query:  289 RFANEKASKKVLNRGNVPKSLRPQDDKYPVSTWLLGLFIFVVCGSAIFEIVQHIRLG 459
            R ANEK SK +  RGNV  +    +DK  V  WLL LF+FVVCGSAIF+I+Q IR+G
Sbjct:    8 RMANEKHSKNITQRGNVKSTKNNVEDKVSVGPWLLALFVFVVCGSAIFQIIQSIRMG 64          
BLAST of Selenoprotein F vs. Ensembl Sea Lamprey
Match: selenof (selenoprotein F [Source:NCBI gene;Acc:352923])

HSP 1 Score: 62.3882 bits (150), Expect = 7.341e-13
Identity = 28/56 (50.00%), Postives = 39/56 (69.64%), Query Frame = 1
Query:  766 FVKSAKAAEFPNVEISYVRGSEPVIRLLDSNRVAVEELGIEKWDTDTIVEFFQERL 933
            FV+S K + F  + I YVRGS+PV++LLD +    EEL I KW+TD++ EF  E+L
Sbjct:    1 FVRSNKPSTFKGLTIKYVRGSDPVLKLLDESGNVAEELSITKWNTDSVEEFLSEKL 56          
BLAST of Selenoprotein F vs. Ensembl Nematostella
Match: EDO37917 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEF7])

HSP 1 Score: 80.1073 bits (196), Expect = 6.890e-19
Identity = 38/57 (66.67%), Postives = 45/57 (78.95%), Query Frame = -2
Query:  289 RFANEKASKKVLNRGNVPKSLRPQDDKYPVSTWLLGLFIFVVCGSAIFEIVQHIRLG 459
            R ANEK S+ V  RGNVPKSL+P ++KY V   LLGLFIFVVCGSAIF+I+Q IR+ 
Sbjct:    8 RLANEKHSQNVQTRGNVPKSLKPAEEKYAVGPILLGLFIFVVCGSAIFQIIQSIRMA 64          
BLAST of Selenoprotein F vs. Ensembl Nematostella
Match: EDO43335 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ27])

HSP 1 Score: 61.2326 bits (147), Expect = 2.933e-12
Identity = 26/56 (46.43%), Postives = 39/56 (69.64%), Query Frame = 1
Query:  766 FVKSAKAAEFPNVEISYVRGSEPVIRLLDSNRVAVEELGIEKWDTDTIVEFFQERL 933
            FV+S +  +FPN+ + +VRGS+P+++L   +    EEL IEKWDTD + EF  E+L
Sbjct:    2 FVRSDRPDKFPNLRVEFVRGSDPILKLHGDDGGIKEELSIEKWDTDNVEEFLMEKL 57          
BLAST of Selenoprotein F vs. Ensembl Medaka
Match: selenof (selenoprotein F [Source:NCBI gene;Acc:101158232])

HSP 1 Score: 117.087 bits (292), Expect = 1.760e-30
Identity = 60/122 (49.18%), Postives = 77/122 (63.11%), Query Frame = 1
Query:  568 CKSLGFSSDLKCSRCSELKNFNLLTIQASCNSCCDKNQTESTATKYPYAKLIVCG*QLGRFPQIQAFVKSAKAAEFPNVEISYVRGSEPVIRLLDSNRVAVEELGIEKWDTDTIVEFFQERL 933
            C+ LGFSS+L CS C  L  F+L  +Q  C  CC +         YP A L VCG +LGRFPQ+Q FV+S K   F  ++I YVRGS+PV++LLD N    EEL I KW+TD++ EF  E+L
Sbjct:   27 CRDLGFSSNLLCSSCDLLGEFSLTKLQPDCGRCCQQEAQMEGRKLYPGAILEVCG-KLGRFPQVQ-FVRSEKPKIFKGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLGEKL 146          
BLAST of Selenoprotein F vs. Ensembl Medaka
Match: serp2 (stress-associated endoplasmic reticulum protein 2 [Source:NCBI gene;Acc:101163859])

HSP 1 Score: 73.9442 bits (180), Expect = 7.181e-16
Identity = 39/89 (43.82%), Postives = 47/89 (52.81%), Query Frame = -2
Query:  289 RFANEKASKKVLNRGNVPKSL--------------------------------RPQDDKYPVSTWLLGLFIFVVCGSAIFEIVQHIRLG 459
            R ANEK SK +  RGNV K+L                                RPQ++KYPV  WLL LF+FVVCGSAIF+I+Q IR+G
Sbjct:    8 RMANEKHSKNITQRGNVAKTLKASAELSLRTAVMSSRCESRLHQKANVENWEKRPQEEKYPVGPWLLALFVFVVCGSAIFQIIQSIRMG 96          
BLAST of Selenoprotein F vs. Ensembl Medaka
Match: serp2 (stress-associated endoplasmic reticulum protein 2 [Source:NCBI gene;Acc:101163859])

HSP 1 Score: 72.0182 bits (175), Expect = 1.672e-15
Identity = 31/46 (67.39%), Postives = 36/46 (78.26%), Query Frame = -2
Query:  322 RFANEKASKKVLNRGNVPKSLRPQDDKYPVSTWLLGLFIFVVCGSA 459
            R ANEK SK +  RGNV K+LRPQ++KYPV  WLL LF+FVVCGS 
Sbjct:    8 RMANEKHSKNITQRGNVAKTLRPQEEKYPVGPWLLALFVFVVCGSG 53          
BLAST of Selenoprotein F vs. Ensembl Medaka
Match: serp2 (stress-associated endoplasmic reticulum protein 2 [Source:NCBI gene;Acc:101163859])

HSP 1 Score: 67.0106 bits (162), Expect = 2.558e-13
Identity = 39/98 (39.80%), Postives = 47/98 (47.96%), Query Frame = -2
Query:  289 RFANEKASKKVLNRGNVPKSL-----------------------------------------RPQDDKYPVSTWLLGLFIFVVCGSAIFEIVQHIRLG 459
            R ANEK SK +  RGNV K+L                                         RPQ++KYPV  WLL LF+FVVCGSAIF+I+Q IR+G
Sbjct:    8 RMANEKHSKNITQRGNVAKTLFQCKHGVKKKASAELSLRTAVMSSRCESRLHQKANVENWEKRPQEEKYPVGPWLLALFVFVVCGSAIFQIIQSIRMG 105          
BLAST of Selenoprotein F vs. Planmine SMEST
Match: SMESG000044517.1 (SMESG000044517.1)

HSP 1 Score: 126.331 bits (316), Expect = 9.722e-35
Identity = 79/79 (100.00%), Postives = 79/79 (100.00%), Query Frame = 1
Query:  496 MKELYXXXXXXXXXXXXXXAESLNCKSLGFSSDLKCSRCSELKNFNLLTIQASCNSCCDKNQTESTATKYPYAKLIVCG 732
            MKELYIFISSFLCFLSSVFAESLNCKSLGFSSDLKCSRCSELKNFNLLTIQASCNSCCDKNQTESTATKYPYAKLIVCG
Sbjct:    1 MKELYIFISSFLCFLSSVFAESLNCKSLGFSSDLKCSRCSELKNFNLLTIQASCNSCCDKNQTESTATKYPYAKLIVCG 79          
The following BLAST results are available for this feature:
BLAST of Selenoprotein F vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SELENOF2.070e-3350.82selenoprotein F [Source:HGNC Symbol;Acc:HGNC:17705... [more]
SELENOF1.990e-3250.82selenoprotein F [Source:HGNC Symbol;Acc:HGNC:17705... [more]
SERP22.582e-2168.42stress associated endoplasmic reticulum protein fa... [more]
SELENOF1.141e-1647.06selenoprotein F [Source:HGNC Symbol;Acc:HGNC:17705... [more]
SERP28.511e-1663.46stress associated endoplasmic reticulum protein fa... [more]
back to top
BLAST of Selenoprotein F vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Y76B12C.36.389e-2342.74pep chromosome:WBcel235:IV:1973702:1975677:1 gene:... [more]
F59F4.29.021e-2059.65pep chromosome:WBcel235:X:15841572:15842379:1 gene... [more]
T09A12.53.306e-1657.41pep chromosome:WBcel235:IV:8225676:8226366:1 gene:... [more]
T09A12.53.306e-1657.41pep chromosome:WBcel235:IV:8225674:8226352:1 gene:... [more]
back to top
BLAST of Selenoprotein F vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CG74844.233e-3044.35gene:FBgn0036745 transcript:FBtr0075184[more]
CG322762.336e-1870.91gene:FBgn0047135 transcript:FBtr0073107[more]
CG322762.336e-1870.91gene:FBgn0047135 transcript:FBtr0073106[more]
back to top
BLAST of Selenoprotein F vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
selenof4.077e-3249.18selenoprotein F [Source:NCBI gene;Acc:352923][more]
serp21.643e-2168.42stress-associated endoplasmic reticulum protein fa... [more]
SERP11.669e-1658.62zgc:92744 [Source:ZFIN;Acc:ZDB-GENE-040718-312][more]
serp11.523e-1562.07stress-associated endoplasmic reticulum protein 1 ... [more]
zgc:858584.814e-1456.90zgc:85858 [Source:ZFIN;Acc:ZDB-GENE-040426-2333][more]
back to top
BLAST of Selenoprotein F vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
serp22.341e-2168.42stress-associated endoplasmic reticulum protein fa... [more]
serp21.631e-1565.96stress-associated endoplasmic reticulum protein fa... [more]
kiaa05134.438e-1561.02KIAA0513 [Source:Xenbase;Acc:XB-GENE-5956311][more]
kiaa05134.471e-1561.02KIAA0513 [Source:Xenbase;Acc:XB-GENE-5956311][more]
kiaa05132.537e-958.33KIAA0513 [Source:Xenbase;Acc:XB-GENE-5956311][more]
back to top
BLAST of Selenoprotein F vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Selenof1.795e-3350.82selenoprotein F [Source:MGI Symbol;Acc:MGI:1927947... [more]
Serp21.773e-2168.42stress-associated endoplasmic reticulum protein fa... [more]
Serp23.687e-1567.39stress-associated endoplasmic reticulum protein fa... [more]
Serp16.695e-1560.34stress-associated endoplasmic reticulum protein 1 ... [more]
Selenof4.545e-1249.23selenoprotein F [Source:MGI Symbol;Acc:MGI:1927947... [more]
back to top
BLAST of Selenoprotein F vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O60613|SEP15_HUMAN9.941e-3350.82Selenoprotein F OS=Homo sapiens OX=9606 GN=SELENOF... [more]
sp|Q9ERR7|SEP15_MOUSE1.320e-3250.82Selenoprotein F OS=Mus musculus OX=10090 GN=Seleno... [more]
sp|Q923V8|SEP15_RAT1.347e-3250.82Selenoprotein F OS=Rattus norvegicus OX=10116 GN=S... [more]
sp|A8YXY3|SEP15_BOVIN2.971e-3249.59Selenoprotein F OS=Bos taurus OX=9913 GN=SELENOF P... [more]
sp|A1Z623|SEP15_PIG6.230e-3248.78Selenoprotein F OS=Sus scrofa OX=9823 GN=SELENOF P... [more]
back to top
BLAST of Selenoprotein F vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9KDI02.262e-3652.85Sep15_SelM domain-containing protein OS=Biomphalar... [more]
A0A1S3IE828.774e-3650.00selenoprotein F-like OS=Lingula unguis OX=7574 GN=... [more]
A0A1U7TBM31.312e-3050.41selenoprotein F OS=Tarsius syrichta OX=1868482 GN=... [more]
A0A2U3Y6P51.803e-3050.82LOW QUALITY PROTEIN: 15 kDa selenoprotein-like OS=... [more]
A0A384C1Z01.973e-3050.82LOW QUALITY PROTEIN: 15 kDa selenoprotein OS=Ursus... [more]
back to top
BLAST of Selenoprotein F vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
selenof1.644e-2643.90selenoprotein F [Source:NCBI gene;Acc:352923][more]
serp21.392e-2168.42stress-associated endoplasmic reticulum protein 2 ... [more]
ENSAMXT00000036257.11.392e-2168.42stress-associated endoplasmic reticulum protein 2 ... [more]
serp17.349e-1865.52stress associated endoplasmic reticulum protein 1 ... [more]
zgc:927444.132e-1557.89stress-associated endoplasmic reticulum protein 1-... [more]
back to top
BLAST of Selenoprotein F vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
selenof7.341e-1350.00selenoprotein F [Source:NCBI gene;Acc:352923][more]
back to top
BLAST of Selenoprotein F vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Selenoprotein F vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO379176.890e-1966.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO433352.933e-1246.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Selenoprotein F vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
selenof1.760e-3049.18selenoprotein F [Source:NCBI gene;Acc:101158232][more]
serp27.181e-1643.82stress-associated endoplasmic reticulum protein 2 ... [more]
serp21.672e-1567.39stress-associated endoplasmic reticulum protein 2 ... [more]
serp22.558e-1339.80stress-associated endoplasmic reticulum protein 2 ... [more]
back to top
BLAST of Selenoprotein F vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000044517.19.722e-35100.00SMESG000044517.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031984 ID=SMED30031984|Name=Selenoprotein F|organism=Schmidtea mediterranea sexual|type=transcript|length=1723bp
TAAAATGTCATTTATAAATTATTGTTTAGTAAGAAATTTAAAAGTTATGA
TAACTATTGCTTTCAATTCATTAACTTTGTTATAAAAATTTCAATACCAC
AAAATTGTTTCTTTTATAGTTATATATATATATATAGATTCGCGTAAGCA
TAATAATGAGCAAGATTCAAGAGATAAAATTACGAAAACCATTCAATGAC
AAATGAAATAACCATTGATTAATTGCAAATCATTTAATAAGAAAATGTCC
GATTTATCACATTTATTTTTAAAAAGTAATGATTAAAATCCAAGTCTTAT
ATGTTGAACAATTTCAAAAATCGCTGATCCACAAACAACAAAGATAAATA
ACCCTAACAACCAAGTTGATACTGGATATTTATCGTCTTGTGGTCTTAAT
GACTTGGGAACATTACCACGATTTAACACTTTCTTCGATGCTTTTTCATT
AGCAAAACGTTGAAATAAGTTTAGTGAAATGAAATTTATTTTACAATGAA
AGAGTTATATATATTTATTTCGTCGTTTTTGTGTTTCCTTAGTTCGGTTT
TTGCCGAATCTTTAAATTGTAAATCACTGGGATTCTCATCAGATCTCAAG
TGTTCTAGGTGTTCAGAACTAAAAAATTTTAATTTACTGACTATTCAAGC
TTCTTGTAATTCTTGTTGTGATAAAAATCAAACTGAATCTACAGCTACAA
AATATCCATATGCTAAATTAATTGTATGTGGGTGACAGTTAGGTCGATTT
CCGCAGATTCAAGCATTTGTTAAAAGTGCTAAGGCCGCGGAATTCCCTAA
TGTAGAGATCAGTTATGTTAGAGGATCTGAACCTGTCATCAGATTATTAG
ACAGCAATCGAGTAGCAGTGGAAGAATTGGGTATAGAAAAATGGGATACT
GATACTATTGTAGAGTTTTTTCAAGAGCGTCTTTTATAAACAATGAATTT
ATTCTCAATTATGATGCAAACGTGGTAAACAAATTTCTTTGTCCACGAGT
GCTGATGCTGGGAGAATATATCAACACTTGATTGTATTTTTTATAAAATG
CGCGACTAATTTTTTTTATATTCTTAATATTTAATTGGTATTATTTTGTT
CTCAATTTGTAGTTTATGTGATCTAGTTCACTTTCGAAATTATTTATTTT
GTGAAAATAATATAAATAGAGGACTATTTTCTAGTACGAGGGCCGATAAC
AAAATTATTAATTGAGCCGATTACAGAAAAAACGGAGAAAACCTAACCAA
TACGATTAGAAACCCAAAAGTGGACCAGATTAGTTTAAATCAATTGAAGA
TCGTTTTTAAGAAAAAGGAAATATCGATTATTNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAGAA
AAAGTTAATTTTAAAAGAAATTCAATTTTGGAAATTCATAAAACAACCTA
TCAGTAGTGACCCTTCGAAAATTTCCACTCGATTCAAAGTTGGCAAATCT
CTTCTGATCATACCNNNNNNNNNNNNNNTGATCATACCAGTTTGAAAAGG
AAATTAAAAGAAAAGTTCGGAAAACTTAGTCGTGAATTTTGGATACACAT
TATCCAGAGGAGTATTTTTGGTA
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000035Category 3 cell
PLANA:0000240body wall musculature
PLANA:0000484secretory system
PLANA:0002032epidermal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR010580ER_stress-assoc
IPR014912Sep15_SelM
IPR012336Thioredoxin-like_fold
Vocabulary: cellular component
TermDefinition
GO:0005783endoplasmic reticulum
GO:0005788endoplasmic reticulum lumen
GO:0070062extracellular exosome
Vocabulary: molecular function
TermDefinition
GO:0008430selenium binding
Vocabulary: biological process
TermDefinition
GO:0051084'de novo' posttranslational protein folding