Neuropeptide-18

Overview
NameNeuropeptide-18
Smed IDSMED30031980
Length (bp)636
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Neuropeptide-18 (SMED30031980) t-SNE clustered cells

Violin plots show distribution of expression levels for Neuropeptide-18 (SMED30031980) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Neuropeptide-18 (SMED30031980) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Neuropeptide-18 (SMED30031980) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031980

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 17

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30031980h1SMcG0020171 dd_Smed_v4_117_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30031980h1SMcG0020171 dd_Smed_v4_117_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30031980h1SMcG0020171 dd_Smed_v4_117_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30031980h1SMcG0020171 dd_Smed_v4_117_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30031980h1SMcG0020171 dd_Smed_v4_117_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30031980h1SMcG0020171 dd_Smed_v4_117_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30031980h1SMcG0020171 dd_Smed_v4_117_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30031980h1SMcG0020171 dd_Smed_v4_117_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30031980h1SMcG0020171 dd_Smed_v4_117_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30031980h1SMcG0020171 dd_Smed_v4_1117_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30031980h1SMcG0020171 dd_Smed_v4_1117_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30031980h1SMcG0020171 dd_Smed_v4_1117_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30031980h1SMcG0020171 dd_Smed_v4_1117_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
non-ciliated neuronSMED30031980h1SMcG0020171 dd_Smed_v4_1117_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cement glandSMED30031980h1SMcG0020171 BK007027smed_ncbi_20240424PMID:20967238
Collins JJ et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
gamma neoblastSMED30031980h1SMcG0020171 dd_Smed_v6_117_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30031980h1SMcG0020171 dd_Smed_v6_117_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Neuropeptide-18 vs. TrEMBL
Match: E3CTK2 (Neuropeptide-18 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 2.198e-43
Identity = 74/74 (100.00%), Postives = 74/74 (100.00%), Query Frame = 2
Query:  332 FSRTTVFFLIIFPIWMMSVILIEARNMDLDEYDSLLPKDKRGAEFFIRRVVGKRGAEFFIRRVVGKRNSDYLIQ 553
            FSRTTVFFLIIFPIWMMSVILIEARNMDLDEYDSLLPKDKRGAEFFIRRVVGKRGAEFFIRRVVGKRNSDYLIQ
Sbjct:    4 FSRTTVFFLIIFPIWMMSVILIEARNMDLDEYDSLLPKDKRGAEFFIRRVVGKRGAEFFIRRVVGKRNSDYLIQ 77          
BLAST of Neuropeptide-18 vs. TrEMBL
Match: E3CTK3 (Secreted peptide prohormone-10 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 55.4546 bits (132), Expect = 9.008e-7
Identity = 31/61 (50.82%), Postives = 40/61 (65.57%), Query Frame = 2
Query:  371 IWMMSVILIEARNMDLDEY-----DSLLPKDKRGAEFFIRRVVGKRGAEFFIRRVVGKRNS 538
            I +M   +I   N  L +Y     + L    KRGAEFF++RV GKRGAEFF+RRVVGKR++
Sbjct:    9 IMIMCHFVITVFNEPLSKYYPDNNEDLSATIKRGAEFFLQRVEGKRGAEFFLRRVVGKRST 69          
BLAST of Neuropeptide-18 vs. Planmine SMEST
Match: SMESG000023745.1 (SMESG000023745.1)

HSP 1 Score: 55.4546 bits (132), Expect = 2.505e-10
Identity = 31/61 (50.82%), Postives = 40/61 (65.57%), Query Frame = 2
Query:  371 IWMMSVILIEARNMDLDEY-----DSLLPKDKRGAEFFIRRVVGKRGAEFFIRRVVGKRNS 538
            I +M   +I   N  L +Y     + L    KRGAEFF++RV GKRGAEFF+RRVVGKR++
Sbjct:    9 IMIMCHFVITVFNEPLSKYYPDNNEDLSATIKRGAEFFLQRVEGKRGAEFFLRRVVGKRST 69          
BLAST of Neuropeptide-18 vs. Planmine SMEST
Match: SMESG000023745.1 (SMESG000023745.1)

HSP 1 Score: 55.4546 bits (132), Expect = 2.765e-10
Identity = 31/61 (50.82%), Postives = 40/61 (65.57%), Query Frame = 2
Query:  371 IWMMSVILIEARNMDLDEY-----DSLLPKDKRGAEFFIRRVVGKRGAEFFIRRVVGKRNS 538
            I +M   +I   N  L +Y     + L    KRGAEFF++RV GKRGAEFF+RRVVGKR++
Sbjct:   17 IMIMCHFVITVFNEPLSKYYPDNNEDLSATIKRGAEFFLQRVEGKRGAEFFLRRVVGKRST 77          
The following BLAST results are available for this feature:
BLAST of Neuropeptide-18 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neuropeptide-18 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neuropeptide-18 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neuropeptide-18 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neuropeptide-18 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neuropeptide-18 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neuropeptide-18 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neuropeptide-18 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 2
Match NameE-valueIdentityDescription
E3CTK22.198e-43100.00Neuropeptide-18 OS=Schmidtea mediterranea OX=79327... [more]
E3CTK39.008e-750.82Secreted peptide prohormone-10 OS=Schmidtea medite... [more]
back to top
BLAST of Neuropeptide-18 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neuropeptide-18 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neuropeptide-18 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neuropeptide-18 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neuropeptide-18 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neuropeptide-18 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000023745.12.505e-1050.82SMESG000023745.1[more]
SMESG000023745.12.765e-1050.82SMESG000023745.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031980 ID=SMED30031980|Name=Neuropeptide-18|organism=Schmidtea mediterranea sexual|type=transcript|length=636bp
AATGAGCTAATACCGATATTTAATATCTTCAATCATATCGTTTTTCATGT
CATCTTATTCAAACAAAATGAATGATTGGACTCAGTATTATCTTATTGAA
TTATTTTTTCCATACTTAAATGTCTTTTTTTAGATAAATAACTATTTATC
AAAATCGGTAAAAGTTTCAGCATATGTCGAGGAATTTATTTTTTATATAA
ATACATTTATTTTAAATTTTTACGAATTTATTCAAACAAAAATGGAAGTA
AGGCTATAATAATAATTATTATTATAACTATAATTGTTATAGTTATTATT
ATTAACATTAATTTATATTTTACTTAAGTTATTCAGTAGAACTACAGTAT
TTTTCCTTATAATATTTCCAATTTGGATGATGTCGGTTATTCTAATTGAA
GCGCGAAATATGGATCTAGACGAATATGATTCTTTGCTGCCGAAAGATAA
AAGGGGGGCAGAGTTTTTTATTCGACGAGTTGTTGGTAAACGGGGTGCAG
AATTTTTCATTCGTCGAGTCGTCGGAAAAAGGAATTCTGATTATCTCATT
CAATAAAACTGCCAAGTGAATGAATGCTTTTTGGAAACAATTTATGAACG
TTTAATAAATAACAATTTTTTTGGTTTAAAAAAAAA
back to top
Aliases
The feature 'Neuropeptide-18' has the following synonyms
Synonym
npp-18
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000224cement gland
Vocabulary: biological process
TermDefinition
GO:0007218neuropeptide signaling pathway
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane