Neuropeptide-18
Overview
Neoblast Clusters
Zeng et. al., 2018▻ Overview▻ Neoblast Population▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Overview
Single cell RNA-seq of pluripotent neoblasts and its early progeniesWe isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)Explore this single cell expression dataset with our NB Cluster Shiny App
Neoblast Population
Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Embryonic Expression
Davies et. al., 2017
Hover the mouse over a column in the graph to view average RPKM values per sample. Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult. back to top Anatomical Expression
PAGE et. al., 2020SMED30031980 has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGEPAGE Curations: 17
Homology
BLAST of Neuropeptide-18 vs. TrEMBL
Match: E3CTK2 (Neuropeptide-18 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1) HSP 1 Score: 149.443 bits (376), Expect = 2.198e-43 Identity = 74/74 (100.00%), Postives = 74/74 (100.00%), Query Frame = 2 Query: 332 FSRTTVFFLIIFPIWMMSVILIEARNMDLDEYDSLLPKDKRGAEFFIRRVVGKRGAEFFIRRVVGKRNSDYLIQ 553 FSRTTVFFLIIFPIWMMSVILIEARNMDLDEYDSLLPKDKRGAEFFIRRVVGKRGAEFFIRRVVGKRNSDYLIQ Sbjct: 4 FSRTTVFFLIIFPIWMMSVILIEARNMDLDEYDSLLPKDKRGAEFFIRRVVGKRGAEFFIRRVVGKRNSDYLIQ 77
BLAST of Neuropeptide-18 vs. TrEMBL
Match: E3CTK3 (Secreted peptide prohormone-10 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1) HSP 1 Score: 55.4546 bits (132), Expect = 9.008e-7 Identity = 31/61 (50.82%), Postives = 40/61 (65.57%), Query Frame = 2 Query: 371 IWMMSVILIEARNMDLDEY-----DSLLPKDKRGAEFFIRRVVGKRGAEFFIRRVVGKRNS 538 I +M +I N L +Y + L KRGAEFF++RV GKRGAEFF+RRVVGKR++ Sbjct: 9 IMIMCHFVITVFNEPLSKYYPDNNEDLSATIKRGAEFFLQRVEGKRGAEFFLRRVVGKRST 69
BLAST of Neuropeptide-18 vs. Planmine SMEST
Match: SMESG000023745.1 (SMESG000023745.1) HSP 1 Score: 55.4546 bits (132), Expect = 2.505e-10 Identity = 31/61 (50.82%), Postives = 40/61 (65.57%), Query Frame = 2 Query: 371 IWMMSVILIEARNMDLDEY-----DSLLPKDKRGAEFFIRRVVGKRGAEFFIRRVVGKRNS 538 I +M +I N L +Y + L KRGAEFF++RV GKRGAEFF+RRVVGKR++ Sbjct: 9 IMIMCHFVITVFNEPLSKYYPDNNEDLSATIKRGAEFFLQRVEGKRGAEFFLRRVVGKRST 69
BLAST of Neuropeptide-18 vs. Planmine SMEST
Match: SMESG000023745.1 (SMESG000023745.1) HSP 1 Score: 55.4546 bits (132), Expect = 2.765e-10 Identity = 31/61 (50.82%), Postives = 40/61 (65.57%), Query Frame = 2 Query: 371 IWMMSVILIEARNMDLDEY-----DSLLPKDKRGAEFFIRRVVGKRGAEFFIRRVVGKRNS 538 I +M +I N L +Y + L KRGAEFF++RV GKRGAEFF+RRVVGKR++ Sbjct: 17 IMIMCHFVITVFNEPLSKYYPDNNEDLSATIKRGAEFFLQRVEGKRGAEFFLRRVVGKRST 77 The following BLAST results are available for this feature:
BLAST of Neuropeptide-18 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99) Total hits: 0
BLAST of Neuropeptide-18 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99) Total hits: 0
BLAST of Neuropeptide-18 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99) Total hits: 0
BLAST of Neuropeptide-18 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99) Total hits: 0
BLAST of Neuropeptide-18 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99) Total hits: 0
BLAST of Neuropeptide-18 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99) Total hits: 0
BLAST of Neuropeptide-18 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt) Total hits: 0
BLAST of Neuropeptide-18 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL) Total hits: 2
BLAST of Neuropeptide-18 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99) Total hits: 0
BLAST of Neuropeptide-18 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99) Total hits: 0
BLAST of Neuropeptide-18 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46) Total hits: 0
BLAST of Neuropeptide-18 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46) Total hits: 0
BLAST of Neuropeptide-18 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99) Total hits: 0
BLAST of Neuropeptide-18 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST) Total hits: 2
Analyses
This transcript is derived from or has results from the following analyses Sequences
The following sequences are available for this feature:
transcript sequence >SMED30031980 ID=SMED30031980|Name=Neuropeptide-18|organism=Schmidtea mediterranea sexual|type=transcript|length=636bpback to top Aliases
The feature 'Neuropeptide-18' has the following synonyms
Annotated Terms
The following terms have been associated with this transcript:
|