telomerase reverse transcriptase subunit isoform 2

Overview
Nametelomerase reverse transcriptase subunit isoform 2 (AEK12105.1)
Smed IDSMED30031978
Length (bp)6373
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of telomerase reverse transcriptase subunit isoform 2 (SMED30031978) t-SNE clustered cells

Violin plots show distribution of expression levels for telomerase reverse transcriptase subunit isoform 2 (SMED30031978) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of telomerase reverse transcriptase subunit isoform 2 (SMED30031978) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for telomerase reverse transcriptase subunit isoform 2 (SMED30031978) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031978

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 25

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
posterior region of the whole animalSMED30031978SMESG000061910.1 dd_Smed_v4_14161_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30031978SMESG000061910.1 SmedASXL_014738SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
X1 cellSMED30031978SMESG000061912.1 SmedASXL_014595SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30031978 SmedASXL_063745SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30031978SMESG000061910.1 dd_Smed_v4_14161_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30031978SMESG000061910.1 dd_Smed_v4_14161_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30031978SMESG000061910.1 dd_Smed_v4_14161_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30031978SMESG000061910.1 dd_Smed_v4_14161_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30031978 dd_Smed_v4_56732_0_2dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30031978SMESG000061912.1 dd_Smed_v6_17877_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30031978SMESG000061910.1 dd_Smed_v6_14161_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
ovarySMED30031978SMESG000061912.1 JF693291.1smed_ncbi_20200123PMID:22371573
Tan et al., 2012
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30031978SMESG000061912.1 JF693291.1smed_ncbi_20200123PMID:22371573
Tan et al., 2012
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
neoblastSMED30031978SMESG000061912.1 JF693291.1smed_ncbi_20200123PMID:22371573
Tan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30031978SMESG000061912.1 JF693291.1smed_ncbi_20200123PMID:22371573
Tan et al., 2012
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
parenchymal cellSMED30031978SMESG000061912.1 JF693291.1smed_ncbi_20200123PMID:22371573
Tan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30031978SMESG000061912.1 JF693291.1smed_ncbi_20200123PMID:22371573
Tan et al., 2012
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
ovarySMED30031978SMESG000061910.1 SMESG000061912.1 SMED30031978smed_20140614PMID:22371573
Tan et al., 2012
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30031978SMESG000061910.1 SMESG000061912.1 SMED30031978smed_20140614PMID:22371573
Tan et al., 2012
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
neoblastSMED30031978SMESG000061910.1 SMESG000061912.1 SMED30031978smed_20140614PMID:22371573
Tan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30031978SMESG000061910.1 SMESG000061912.1 SMED30031978smed_20140614PMID:22371573
Tan et al., 2012
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
parenchymal cellSMED30031978SMESG000061910.1 SMESG000061912.1 SMED30031978smed_20140614PMID:22371573
Tan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30031978SMESG000061910.1 SMESG000061912.1 SMED30031978smed_20140614PMID:22371573
Tan et al., 2012
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
enteric muscle cellSMED30031978SMESG000061910.1 dd_Smed_v4_14161_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30031978SMESG000061912.1 dd_Smed_v4_17877_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of telomerase reverse transcriptase subunit isoform 2 vs. Ensembl Human
Match: TERT (telomerase reverse transcriptase [Source:HGNC Symbol;Acc:HGNC:11730])

HSP 1 Score: 59.6918 bits (143), Expect = 6.654e-8
Identity = 34/98 (34.69%), Postives = 53/98 (54.08%), Query Frame = -2
Query: 1822 FYDFLENIYVKFGSNYYHQICGIPQGSQLSSYLCGIYMLHIKRKAFSDFSTKDNALLLQYVDDVLFISLSQTEAECFLKRLLTVYPKYGLELNNSKII 2115
            F  F+ +  V+     Y Q  GIPQGS LS+ LC +    ++ K F+    + + LLL+ VDD L ++   T A+ FL+ L+   P+YG  +N  K +
Sbjct:  809 FLRFMCHHAVRIRGKSYVQCQGIPQGSILSTLLCSLCYGDMENKLFAGI--RRDGLLLRLVDDFLLVTPHLTHAKTFLRTLVRGVPEYGCVVNLRKTV 904          
BLAST of telomerase reverse transcriptase subunit isoform 2 vs. Ensembl Zebrafish
Match: tert (telomerase reverse transcriptase [Source:ZFIN;Acc:ZDB-GENE-080405-1])

HSP 1 Score: 70.4774 bits (171), Expect = 2.656e-11
Identity = 39/129 (30.23%), Postives = 64/129 (49.61%), Query Frame = -2
Query: 1762 FYDFLENIYVKFGSNYYHQICGIPQGSQLSSYLCGIYMLHIKRKAFSDFSTKDNALLLQYVDDVLFISLSQTEAECFLKRLLTVYPKYGLELNNSKI-----IC-SWKNP-----ESPSVIPWLGYNLN 2115
            F   L +  + +    + Q+CGIPQGS +SS LC +   H+++    D +      L++ +DD L I+   ++A  FL  LL+  P YG ++N  K+     +C SW N       S  + PW G  ++
Sbjct:  778 FQKMLSSYVIHYDQQMFRQVCGIPQGSSVSSLLCNLCYGHMEKALLKDIA--KGGCLMRLIDDFLLITPHLSKATEFLTTLLSGVPDYGCQINPQKVAVNFPVCVSWVNSGVSVLPSSCLFPWCGLMIH 904          
BLAST of telomerase reverse transcriptase subunit isoform 2 vs. Ensembl Xenopus
Match: ENSXETT00000011836.1 (telomerase reverse transcriptase [Source:NCBI gene;Acc:101731917])

HSP 1 Score: 70.4774 bits (171), Expect = 3.663e-11
Identity = 52/193 (26.94%), Postives = 88/193 (45.60%), Query Frame = -2
Query: 1792 VKQNKFYIVRADMKNCYESLRHQDLRSIFSDLISKTKDPE-----------------IKSKKFSLKSEFYDFLENIYVKFGSN-----------------YYHQICGIPQGSQLSSYLCGIYMLHIKRKAFSDFSTKDNALLLQYVDDVLFISLSQTEAECFLKRLLTVYPKYGLELNNSKIICSWKNPESPS 2268
             ++ KFY V+ D+K  Y+++ H  L  +   +I+   +                   IKS K  + S   D L N+  +F SN                 YY Q CGIPQGS LS+ LC +    ++ K F     + N +L++ +DD LF++    +A+ FL+ L    P+YG  ++  K + ++   + P+
Sbjct:  740 AEKGKFYFVKTDVKGAYDTIPHSKLDEVILKVINPNANEVYCIRRYASVSVDSTGRIIKSFKRHV-SALADVLPNMK-QFVSNQQEKNLTRNTILVEQVIYYMQCCGIPQGSMLSTILCSLCYGDMENKLFG--GIQQNGVLMRLIDDFLFVTPHLNQAKTFLRTLAEGIPQYGCSISPQKTVVNFPVDDIPA 928          
BLAST of telomerase reverse transcriptase subunit isoform 2 vs. Ensembl Xenopus
Match: ENSXETT00000011858.1 (telomerase reverse transcriptase [Source:NCBI gene;Acc:101731917])

HSP 1 Score: 70.4774 bits (171), Expect = 3.803e-11
Identity = 52/193 (26.94%), Postives = 88/193 (45.60%), Query Frame = -2
Query: 1792 VKQNKFYIVRADMKNCYESLRHQDLRSIFSDLISKTKDPE-----------------IKSKKFSLKSEFYDFLENIYVKFGSN-----------------YYHQICGIPQGSQLSSYLCGIYMLHIKRKAFSDFSTKDNALLLQYVDDVLFISLSQTEAECFLKRLLTVYPKYGLELNNSKIICSWKNPESPS 2268
             ++ KFY V+ D+K  Y+++ H  L  +   +I+   +                   IKS K  + S   D L N+  +F SN                 YY Q CGIPQGS LS+ LC +    ++ K F     + N +L++ +DD LF++    +A+ FL+ L    P+YG  ++  K + ++   + P+
Sbjct:  782 AEKGKFYFVKTDVKGAYDTIPHSKLDEVILKVINPNANEVYCIRRYASVSVDSTGRIIKSFKRHV-SALADVLPNMK-QFVSNQQEKNLTRNTILVEQVIYYMQCCGIPQGSMLSTILCSLCYGDMENKLFG--GIQQNGVLMRLIDDFLFVTPHLNQAKTFLRTLAEGIPQYGCSISPQKTVVNFPVDDIPA 970          
BLAST of telomerase reverse transcriptase subunit isoform 2 vs. Ensembl Xenopus
Match: ENSXETT00000028308.1 (telomerase reverse transcriptase [Source:NCBI gene;Acc:101731917])

HSP 1 Score: 68.5514 bits (166), Expect = 1.260e-10
Identity = 52/198 (26.26%), Postives = 88/198 (44.44%), Query Frame = -2
Query: 1792 VKQNKFYIVRADMKNCYESLRHQDLRSIFSDLISKTKDPE-----------------IKSKKFSLKSEFYDFLENIYVKFGSN----------------------YYHQICGIPQGSQLSSYLCGIYMLHIKRKAFSDFSTKDNALLLQYVDDVLFISLSQTEAECFLKRLLTVYPKYGLELNNSKIICSWKNPESPS 2268
             ++ KFY V+ D+K  Y+++ H  L  +   +I+   +                   IKS K  + S   D L N+  +F SN                      YY Q CGIPQGS LS+ LC +    ++ K F     + N +L++ +DD LF++    +A+ FL+ L    P+YG  ++  K + ++   + P+
Sbjct:  794 AEKGKFYFVKTDVKGAYDTIPHSKLDEVILKVINPNANEVYCIRRYASVSVDSTGRIIKSFKRHV-SALADVLPNMK-QFVSNQQEKNLTLFLFFFNLIILAQQLYYMQCCGIPQGSMLSTILCSLCYGDMENKLFG--GIQQNGVLMRLIDDFLFVTPHLNQAKTFLRTLAEGIPQYGCSISPQKTVVNFPVDDIPA 987          
BLAST of telomerase reverse transcriptase subunit isoform 2 vs. Ensembl Mouse
Match: Tert (telomerase reverse transcriptase [Source:MGI Symbol;Acc:MGI:1202709])

HSP 1 Score: 54.6842 bits (130), Expect = 1.853e-6
Identity = 42/132 (31.82%), Postives = 65/132 (49.24%), Query Frame = -2
Query: 1762 FYDFLENIYVKFGSNYYHQICGIPQGSQLSSYLCGIYMLHIKRKAFSDFSTKDNALLLQYVDDVLFISLSQTEAECFLKRLLTVYPKYGLELNNSKIICSWKNPESPSVI--------------PWLGYNLN 2115
            F  FL +  VK G   Y Q  GIPQGS LS+ LC +    ++ K F++   + + LLL++VDD L ++    +A+ FL  L+   P+YG  +N  K + ++  P  P  +              PW G  L+
Sbjct:  802 FLHFLRHSVVKIGDRCYTQCQGIPQGSSLSTLLCSLCFGDMENKLFAE--VQRDGLLLRFVDDFLLVTPHLDQAKTFLSTLVHGVPEYGCMINLQKTVVNF--PVEPGTLGGAAPYQLPAHCLFPWCGLLLD 929          
BLAST of telomerase reverse transcriptase subunit isoform 2 vs. UniProt/SwissProt
Match: sp|Q4KTA7|TERT_TAKRU (Telomerase reverse transcriptase OS=Takifugu rubripes OX=31033 GN=tert PE=1 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 3.428e-11
Identity = 40/113 (35.40%), Postives = 63/113 (55.75%), Query Frame = -2
Query: 1777 FYDFLENIYVKFGSNYYHQICGIPQGSQLSSYLCGIYMLHIKRKAFSDFSTKDNALLLQYVDDVLFISLSQTEAECFLKRLLTVYPKYGLELNNSKIICSWKNPESPSVIPWL 2115
            F   L+   ++FG   Y Q  G+PQGS +SS LC +   H++   F D   K +  L++ VDD L I+ +  +A+ FLK LL   P+YGL +N  K++ ++++  S    P L
Sbjct:  750 FTQILKGSVIQFGKKTYRQCQGVPQGSAVSSVLCCLCYGHMENVLFKDIINKKSC-LMRLVDDFLLITPNLHDAQTFLKILLAGVPQYGLVVNPQKVVVNFEDYGSTDSCPGL 861          
BLAST of telomerase reverse transcriptase subunit isoform 2 vs. UniProt/SwissProt
Match: sp|Q1PS67|TERT_ORYLA (Telomerase reverse transcriptase OS=Oryzias latipes OX=8090 GN=tert PE=1 SV=2)

HSP 1 Score: 71.633 bits (174), Expect = 8.662e-11
Identity = 38/111 (34.23%), Postives = 57/111 (51.35%), Query Frame = -2
Query: 1783 FYDFLENIYVKFGSNYYHQICGIPQGSQLSSYLCGIYMLHIKRKAFSDFSTKDNALLLQYVDDVLFISLSQTEAECFLKRLLTVYPKYGLELNNSKIICSWKNPESPSVIP 2115
            F   L    V+ G   Y Q  GIPQGS +SS LC +   H++   F D   K+   L++ VDD L I+  + +A+ FL  LL   P+YG+  N  K++ +++  E     P
Sbjct:  767 FTQMLTGSVVQHGKKTYRQCRGIPQGSVVSSLLCCLCYGHMENVLFRDI--KNKGWLMRLVDDFLLITPDRNQAQSFLSILLAGVPQYGVVANPQKVVVNFQGSEGGGAFP 875          
BLAST of telomerase reverse transcriptase subunit isoform 2 vs. UniProt/SwissProt
Match: sp|O13339|TERT_SCHPO (Telomerase reverse transcriptase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=trt1 PE=1 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.782e-10
Identity = 64/228 (28.07%), Postives = 102/228 (44.74%), Query Frame = -2
Query: 1762 YIVRADMKNCYESLRHQDLRSIFSDLISKTKDPEIKSKKF----------------------------------SLKSE---FYDF------------------LENIYVKFGSNYYHQICGIPQGSQLSSYLCGIYMLHIKRKAFSDFSTKDNALLLQYVDDVLFISLSQTEAECFLKRLLTVYPKYGLELNNSKIICSWKNP----------ESPSVIPWLGYNLN 2250
            Y VR D+K+CY+ ++ QDL  +F  +  K KDPE   +K+                                  S+K+    F DF                  L    VK G++ Y Q  GIPQGS LSS+LC  YM  +  +  S F+ K  ++LL+ VDD LFI++++ +A+ FL   L  + K+    +  K + +++N           ES   +P+ G+++N
Sbjct:  585 YFVRIDIKSCYDRIK-QDL--MFRIVKKKLKDPEFVIRKYATIHATSDRATKNFVSEAFSYFDMVPFEKVVQLLSMKTSDTLFVDFVDYWTKSSSEIFKMLKEHLSGHIVKIGNSQYLQKVGIPQGSILSSFLCHFYMEDLIDEYLS-FTKKKGSVLLRVVDDFLFITVNKKDAKKFLNLSLRGFEKHNFSTSLEKTVINFENSNGIINNTFFNESKKRMPFFGFSVN 808          
BLAST of telomerase reverse transcriptase subunit isoform 2 vs. UniProt/SwissProt
Match: sp|Q6A548|TERT_CANLF (Telomerase reverse transcriptase OS=Canis lupus familiaris OX=9615 GN=TERT PE=2 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 4.963e-9
Identity = 37/121 (30.58%), Postives = 60/121 (49.59%), Query Frame = -2
Query: 1828 SIFSDLISKTKDPEIKSKKFSLKSEFYDFLENIYVKFGSNYYHQICGIPQGSQLSSYLCGIYMLHIKRKAFSDFSTKDNALLLQYVDDVLFISLSQTEAECFLKRLLTVYPKYGLELNNSK 2190
            S+  D +   +   +     SL   F   + N  V+ G   Y Q  G+PQGS LS+ LC +    ++R+ F     + + +LL+ VDD L ++   T+A+ FL+ L+   P+YG   N  K
Sbjct:  775 SLLRDAVVIEQSSSLNEAGSSLFHLFLRLVHNHVVRIGGKSYIQCQGVPQGSILSTLLCSLCYGDMERRLFPGI--EQDGVLLRLVDDFLLVTPHLTQAQAFLRTLVKGVPEYGCRANLQK 893          
BLAST of telomerase reverse transcriptase subunit isoform 2 vs. UniProt/SwissProt
Match: sp|Q8LKW0|TERT_ORYSJ (Telomerase reverse transcriptase OS=Oryza sativa subsp. japonica OX=39947 GN=TERT PE=2 SV=2)

HSP 1 Score: 64.3142 bits (155), Expect = 1.266e-8
Identity = 53/159 (33.33%), Postives = 79/159 (49.69%), Query Frame = -2
Query: 1735 LKSEFYDFL-ENI---YVKFGSNYYHQICGIPQGSQLSSYLCGIYMLHIKRKAFSDF--STKDNA---------LLLQYVDDVLFISLSQTEAECFLKRLLTVYPKYGLELNNSKI---ICS----------WKNPESPSVIPWLGYNLNDSCEVTLKV 2127
            LK +F+  L E I    +K G  YY Q  GI QGS+LS  LC +Y  H++    S F   +K NA         LL++++DD +FIS S   A+ FL R+   +  Y   +N+SK     C+          ++  +  S +PW G  +N  CE TL++
Sbjct:  919 LKEQFHHLLYEQIKCNILKIGQKYYLQQVGIAQGSKLSPNLCSLYYGHLENSVLSKFLHDSKLNAGEAFSEPEYLLMRFIDDFIFISFSLEHAQKFLNRMRRGFVFYNCYMNDSKYGFNFCAGNSEPSSNRLYRGDDGVSFMPWSGLLIN--CE-TLEI 1074          
BLAST of telomerase reverse transcriptase subunit isoform 2 vs. TrEMBL
Match: G1BJ47 (Telomerase reverse transcriptase OS=Schmidtea mediterranea OX=79327 GN=Tert PE=2 SV=1)

HSP 1 Score: 842.417 bits (2175), Expect = 0.000e+0
Identity = 452/470 (96.17%), Postives = 453/470 (96.38%), Query Frame = -2
Query: 1279 QNFHWCESPANSSSVVYFTLSQWHEFQKASASYYINRGIFSGPISTERIKEIKNYNVGTARCLVKSLETRDYRLISNLKTKQSHLTKYSRKKYKIVDXXXXXXXXXXXXXXXXXXXLITDDLYAPDSYEEIRKYRDRMNSVKQNKFYIVRADMKNCYESLRHQDLRSIFSDLISKTKDPEIKSKKFSLKSEFYDFLENIYVKFGSNYYHQICGIPQGSQLSSYLCGIYMLHIKRKAFSDFSTKDNALLLQYVDDVLFISLSQTEAECFLKRLLTVYPKYGLELNNSKIICSWKNPESPSVIPWLGYNLNDSCEVTLKVNNQLKSEIWE*IINFRIVIPALSRFAGFPQNAQXXXXXXXXXXXYAFKRRAIIANSIHDNCCSEEIINYNCELLGSLSAYIFLCRVRACLEPHELLSGTSSQKIAGLLKAFLFNYIENYKLYEVALKSLKKTLLPYKGQMKWILHYLCKLSS 2688
            QNFHWCESPANSSSVVYFTLSQWHEFQKASASYYINRGIFSGPISTERIKEIKNYNVGTARCLVKSLETRDYRLISNLKTKQSHLTKYSRKK KIVDFKSLKLLELFKSLKLKKPELITDDLYAPDSYEEIRKYRDRMNSVKQNKFYIVRADMKNCYESLRHQDLRSIFSDLISKTKDPEIKSKKFSLKSEFYDFLENIYVKFGSNYYHQICGIPQGSQLSSYLCGIYMLHIKRKAFSDFSTKDNALLLQYVDDVLFISLSQTEAECFLKRLLTVYPKYGLELNNSKIICSWKNPESPSVIPWLGYNLNDSCEVTLKVNNQLK+               LSRFAGFPQNAQKSLNYLKLKLSYAFKRRAIIANSIHDNCCSEEIINYNCELLG LSAYIFLCRVRACLEPHELLSGTSSQKIAGLLKAFLFNYIENYKLYEVALKSLKKTLLPYKGQMKWILHYLCKLSS
Sbjct:   76 QNFHWCESPANSSSVVYFTLSQWHEFQKASASYYINRGIFSGPISTERIKEIKNYNVGTARCLVKSLETRDYRLISNLKTKQSHLTKYSRKKSKIVDFKSLKLLELFKSLKLKKPELITDDLYAPDSYEEIRKYRDRMNSVKQNKFYIVRADMKNCYESLRHQDLRSIFSDLISKTKDPEIKSKKFSLKSEFYDFLENIYVKFGSNYYHQICGIPQGSQLSSYLCGIYMLHIKRKAFSDFSTKDNALLLQYVDDVLFISLSQTEAECFLKRLLTVYPKYGLELNNSKIICSWKNPESPSVIPWLGYNLNDSCEVTLKVNNQLKT---------------LSRFAGFPQNAQKSLNYLKLKLSYAFKRRAIIANSIHDNCCSEEIINYNCELLGRLSAYIFLCRVRACLEPHELLSGTSSQKIAGLLKAFLFNYIENYKLYEVALKSLKKTLLPYKGQMKWILHYLCKLSS 530          

HSP 2 Score: 155.221 bits (391), Expect = 1.772e-35
Identity = 75/75 (100.00%), Postives = 75/75 (100.00%), Query Frame = -3
Query: 6099 MKLDLGTALLKLCEKFCIYELTVRSELNNNFEFDEKYKTIKNKCSEIKKRSPIYKSSNSYSGEGKIVPDSINHYQ 6323
            MKLDLGTALLKLCEKFCIYELTVRSELNNNFEFDEKYKTIKNKCSEIKKRSPIYKSSNSYSGEGKIVPDSINHYQ
Sbjct:    1 MKLDLGTALLKLCEKFCIYELTVRSELNNNFEFDEKYKTIKNKCSEIKKRSPIYKSSNSYSGEGKIVPDSINHYQ 75          
BLAST of telomerase reverse transcriptase subunit isoform 2 vs. TrEMBL
Match: G1BJ46 (Telomerase reverse transcriptase OS=Schmidtea mediterranea OX=79327 GN=Tert PE=2 SV=1)

HSP 1 Score: 842.032 bits (2174), Expect = 0.000e+0
Identity = 452/470 (96.17%), Postives = 453/470 (96.38%), Query Frame = -2
Query: 1279 QNFHWCESPANSSSVVYFTLSQWHEFQKASASYYINRGIFSGPISTERIKEIKNYNVGTARCLVKSLETRDYRLISNLKTKQSHLTKYSRKKYKIVDXXXXXXXXXXXXXXXXXXXLITDDLYAPDSYEEIRKYRDRMNSVKQNKFYIVRADMKNCYESLRHQDLRSIFSDLISKTKDPEIKSKKFSLKSEFYDFLENIYVKFGSNYYHQICGIPQGSQLSSYLCGIYMLHIKRKAFSDFSTKDNALLLQYVDDVLFISLSQTEAECFLKRLLTVYPKYGLELNNSKIICSWKNPESPSVIPWLGYNLNDSCEVTLKVNNQLKSEIWE*IINFRIVIPALSRFAGFPQNAQXXXXXXXXXXXYAFKRRAIIANSIHDNCCSEEIINYNCELLGSLSAYIFLCRVRACLEPHELLSGTSSQKIAGLLKAFLFNYIENYKLYEVALKSLKKTLLPYKGQMKWILHYLCKLSS 2688
            QNFHWCESPANSSSVVYFTLSQWHEFQKASASYYINRGIFSGPISTERIKEIKNYNVGTARCLVKSLETRDYRLISNLKTKQSHLTKYSRKK KIVDFKSLKLLELFKSLKLKKPELITDDLYAPDSYEEIRKYRDRMNSVKQNKFYIVRADMKNCYESLRHQDLRSIFSDLISKTKDPEIKSKKFSLKSEFYDFLENIYVKFGSNYYHQICGIPQGSQLSSYLCGIYMLHIKRKAFSDFSTKDNALLLQYVDDVLFISLSQTEAECFLKRLLTVYPKYGLELNNSKIICSWKNPESPSVIPWLGYNLNDSCEVTLKVNNQLK+               LSRFAGFPQNAQKSLNYLKLKLSYAFKRRAIIANSIHDNCCSEEIINYNCELLG LSAYIFLCRVRACLEPHELLSGTSSQKIAGLLKAFLFNYIENYKLYEVALKSLKKTLLPYKGQMKWILHYLCKLSS
Sbjct:  161 QNFHWCESPANSSSVVYFTLSQWHEFQKASASYYINRGIFSGPISTERIKEIKNYNVGTARCLVKSLETRDYRLISNLKTKQSHLTKYSRKKSKIVDFKSLKLLELFKSLKLKKPELITDDLYAPDSYEEIRKYRDRMNSVKQNKFYIVRADMKNCYESLRHQDLRSIFSDLISKTKDPEIKSKKFSLKSEFYDFLENIYVKFGSNYYHQICGIPQGSQLSSYLCGIYMLHIKRKAFSDFSTKDNALLLQYVDDVLFISLSQTEAECFLKRLLTVYPKYGLELNNSKIICSWKNPESPSVIPWLGYNLNDSCEVTLKVNNQLKT---------------LSRFAGFPQNAQKSLNYLKLKLSYAFKRRAIIANSIHDNCCSEEIINYNCELLGRLSAYIFLCRVRACLEPHELLSGTSSQKIAGLLKAFLFNYIENYKLYEVALKSLKKTLLPYKGQMKWILHYLCKLSS 615          

HSP 2 Score: 211.846 bits (538), Expect = 7.012e-54
Identity = 104/105 (99.05%), Postives = 105/105 (100.00%), Query Frame = -3
Query: 6009 MKLDLGTALLKLCEKFCIYELTVRSELNNNFEFDEKYKTIKNKCSEIKKRSPIYKSSNSYSGEGKIVPDSINHYQVFAFLKSQLKCLNLGDIFLNSLNTTIFFNY 6323
            MKLDLGTALLKLCEKFCIYELTVRSELNNNFEFDEKYKTIKNKCSEIKKRSPIYKSSNSYSGEGKIVPDSINHYQVFAFLKSQLKCLNLGDIFLNSLNT+IFFNY
Sbjct:    1 MKLDLGTALLKLCEKFCIYELTVRSELNNNFEFDEKYKTIKNKCSEIKKRSPIYKSSNSYSGEGKIVPDSINHYQVFAFLKSQLKCLNLGDIFLNSLNTSIFFNY 105          

HSP 3 Score: 102.834 bits (255), Expect = 3.080e-18
Identity = 55/69 (79.71%), Postives = 56/69 (81.16%), Query Frame = -1
Query: 2732 HCKYLISMAYKAYLSLSDVCKSMKVTRLSNICLLILQINSKCNTYTLHELYIYIMSYILFYEFVIPILK 2938
            +CKYLISMAYKAYLSLSDVCKSMK             INSKCNTYTLHELYIYIMSYILFYEFVIPILK
Sbjct:  105 YCKYLISMAYKAYLSLSDVCKSMK-------------INSKCNTYTLHELYIYIMSYILFYEFVIPILK 160          
BLAST of telomerase reverse transcriptase subunit isoform 2 vs. TrEMBL
Match: G1BJ48 (Telomerase reverse transcriptase OS=Schmidtea mediterranea OX=79327 GN=Tert PE=2 SV=1)

HSP 1 Score: 310.457 bits (794), Expect = 1.201e-104
Identity = 174/175 (99.43%), Postives = 174/175 (99.43%), Query Frame = -2
Query: 2164 QNFHWCESPANSSSVVYFTLSQWHEFQKASASYYINRGIFSGPISTERIKEIKNYNVGTARCLVKSLETRDYRLISNLKTKQSHLTKYSRKKYKIVDXXXXXXXXXXXXXXXXXXXLITDDLYAPDSYEEIRKYRDRMNSVKQNKFYIVRADMKNCYESLRHQDLRSIFSDLISK 2688
            QNFHWCESPANSSSVVYFTLSQWHEFQKASASYYINRGIFSGPISTERIKEIKNYNVGTARCLVKSLETRDYRLISNLKTKQSHLTKYSRKK KIVDFKSLKLLELFKSLKLKKPELITDDLYAPDSYEEIRKYRDRMNSVKQNKFYIVRADMKNCYESLRHQDLRSIFSDLISK
Sbjct:  161 QNFHWCESPANSSSVVYFTLSQWHEFQKASASYYINRGIFSGPISTERIKEIKNYNVGTARCLVKSLETRDYRLISNLKTKQSHLTKYSRKKSKIVDFKSLKLLELFKSLKLKKPELITDDLYAPDSYEEIRKYRDRMNSVKQNKFYIVRADMKNCYESLRHQDLRSIFSDLISK 335          

HSP 2 Score: 103.219 bits (256), Expect = 1.201e-104
Identity = 55/69 (79.71%), Postives = 56/69 (81.16%), Query Frame = -1
Query: 2732 HCKYLISMAYKAYLSLSDVCKSMKVTRLSNICLLILQINSKCNTYTLHELYIYIMSYILFYEFVIPILK 2938
            +CKYLISMAYKAYLSLSDVCKSMK             INSKCNTYTLHELYIYIMSYILFYEFVIPILK
Sbjct:  105 YCKYLISMAYKAYLSLSDVCKSMK-------------INSKCNTYTLHELYIYIMSYILFYEFVIPILK 160          

HSP 3 Score: 213.001 bits (541), Expect = 4.020e-57
Identity = 104/105 (99.05%), Postives = 105/105 (100.00%), Query Frame = -3
Query: 6009 MKLDLGTALLKLCEKFCIYELTVRSELNNNFEFDEKYKTIKNKCSEIKKRSPIYKSSNSYSGEGKIVPDSINHYQVFAFLKSQLKCLNLGDIFLNSLNTTIFFNY 6323
            MKLDLGTALLKLCEKFCIYELTVRSELNNNFEFDEKYKTIKNKCSEIKKRSPIYKSSNSYSGEGKIVPDSINHYQVFAFLKSQLKCLNLGDIFLNSLNT+IFFNY
Sbjct:    1 MKLDLGTALLKLCEKFCIYELTVRSELNNNFEFDEKYKTIKNKCSEIKKRSPIYKSSNSYSGEGKIVPDSINHYQVFAFLKSQLKCLNLGDIFLNSLNTSIFFNY 105          
BLAST of telomerase reverse transcriptase subunit isoform 2 vs. TrEMBL
Match: G1BJ49 (Telomerase reverse transcriptase subunit isoform 4 OS=Schmidtea mediterranea OX=79327 GN=Tert PE=2 SV=1)

HSP 1 Score: 309.686 bits (792), Expect = 6.169e-92
Identity = 174/175 (99.43%), Postives = 174/175 (99.43%), Query Frame = -2
Query: 2164 QNFHWCESPANSSSVVYFTLSQWHEFQKASASYYINRGIFSGPISTERIKEIKNYNVGTARCLVKSLETRDYRLISNLKTKQSHLTKYSRKKYKIVDXXXXXXXXXXXXXXXXXXXLITDDLYAPDSYEEIRKYRDRMNSVKQNKFYIVRADMKNCYESLRHQDLRSIFSDLISK 2688
            QNFHWCESPANSSSVVYFTLSQWHEFQKASASYYINRGIFSGPISTERIKEIKNYNVGTARCLVKSLETRDYRLISNLKTKQSHLTKYSRKK KIVDFKSLKLLELFKSLKLKKPELITDDLYAPDSYEEIRKYRDRMNSVKQNKFYIVRADMKNCYESLRHQDLRSIFSDLISK
Sbjct:   76 QNFHWCESPANSSSVVYFTLSQWHEFQKASASYYINRGIFSGPISTERIKEIKNYNVGTARCLVKSLETRDYRLISNLKTKQSHLTKYSRKKSKIVDFKSLKLLELFKSLKLKKPELITDDLYAPDSYEEIRKYRDRMNSVKQNKFYIVRADMKNCYESLRHQDLRSIFSDLISK 250          

HSP 2 Score: 156.377 bits (394), Expect = 1.471e-38
Identity = 75/75 (100.00%), Postives = 75/75 (100.00%), Query Frame = -3
Query: 6099 MKLDLGTALLKLCEKFCIYELTVRSELNNNFEFDEKYKTIKNKCSEIKKRSPIYKSSNSYSGEGKIVPDSINHYQ 6323
            MKLDLGTALLKLCEKFCIYELTVRSELNNNFEFDEKYKTIKNKCSEIKKRSPIYKSSNSYSGEGKIVPDSINHYQ
Sbjct:    1 MKLDLGTALLKLCEKFCIYELTVRSELNNNFEFDEKYKTIKNKCSEIKKRSPIYKSSNSYSGEGKIVPDSINHYQ 75          
BLAST of telomerase reverse transcriptase subunit isoform 2 vs. TrEMBL
Match: A0A5N4B488 (Uncharacterized protein OS=Photinus pyralis OX=7054 GN=PPYR_01334 PE=4 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 3.668e-22
Identity = 47/104 (45.19%), Postives = 72/104 (69.23%), Query Frame = 1
Query: 3712 FFDKYESILDEYKFVANCLHNVDETGLSAVHKPSKIIA*KGKHQVG*M-----GLTTTGVCCMNTAGEFILELMLIFKRTRMNDCLKK*APLGTIFGCSKNGWI 4008
            F+D  E +++++ F+ N + NVDETG++ VHKPS+++A KG+ QVG +     G TTT VCCM+ +G ++  L  IFKR RM + L +  P+G+I+ CS +GWI
Sbjct:  158 FYDNLEQVMEKHHFLPNRIFNVDETGITTVHKPSRVLAQKGRKQVGAITSGERGQTTTVVCCMSASGAYVPPL-FIFKRERMKEGLDRNGPVGSIYRCSSSGWI 260          

HSP 2 Score: 33.4982 bits (75), Expect = 3.668e-22
Identity = 17/54 (31.48%), Postives = 31/54 (57.41%), Query Frame = 2
Query: 4043 SHTLTCDYGIVMLSILAHTTHRLKTLRGSFVKYLKTNSNEPLFSWLKTNSETQL 4204
            S+    + GIV++S+  HT+HRL+ L  +F   LK   ++    ++K+N   Q+
Sbjct:  299 SYNFCRENGIVIVSLPPHTSHRLQPLDVTFFSSLKGAYSQECDQYMKSNHFVQI 352          

HSP 3 Score: 22.7126 bits (47), Expect = 3.668e-22
Identity = 11/34 (32.35%), Postives = 18/34 (52.94%), Query Frame = 3
Query: 4245 KISTC*YSLEWFKPTGI*PCNRYKFYDNGFCTST 4346
            +I+T    ++ F+ TGI P NR  F +  F  + 
Sbjct:  367 RITTTEKGIKGFEVTGIFPLNRNIFGEEEFVNTA 400          
BLAST of telomerase reverse transcriptase subunit isoform 2 vs. Ensembl Cavefish
Match: tert (telomerase reverse transcriptase [Source:ZFIN;Acc:ZDB-GENE-080405-1])

HSP 1 Score: 65.4698 bits (158), Expect = 7.736e-10
Identity = 38/133 (28.57%), Postives = 67/133 (50.38%), Query Frame = -2
Query: 1774 KKFSLKSEFYDFLENIYVKFGSNYYHQICGIPQGSQLSSYLCGIYMLHIKRKAFSDFSTKDNALLLQYVDDVLFISLSQTEAECFLKRLLTVYPKYGLELNNSKIICSWKN---------PESP--SVIPWLG 2139
            ++ S  +E   F + +   +   ++ Q+ G+PQGS +S+ LC +   H++     +  T+    L++ VDD L I+   ++A  FLK LL   P+YG E+N  K++ ++            E P  S+ PW G
Sbjct:  702 ERVSEGAEVLQFFKEMLSSYVIQWFRQVRGVPQGSAVSTMLCNLCYGHMENSLLKNI-TEKGGCLMRLVDDFLLITPKLSKAVHFLKTLLAGVPEYGCEINPQKVVVNFPVCDELVIPGISELPLQSLFPWCG 833          
BLAST of telomerase reverse transcriptase subunit isoform 2 vs. Ensembl Cavefish
Match: tert (telomerase reverse transcriptase [Source:ZFIN;Acc:ZDB-GENE-080405-1])

HSP 1 Score: 64.6994 bits (156), Expect = 1.325e-9
Identity = 37/127 (29.13%), Postives = 64/127 (50.39%), Query Frame = -2
Query: 1774 SEFYDFLENIYVKFGSNYYHQICGIPQGSQLSSYLCGIYMLHIKRKAFSDFSTKDNALLLQYVDDVLFISLSQTEAECFLKRLLTVYPKYGLELNNSKIICSWKN---------PESP--SVIPWLG 2121
            +E   F + +   +   ++ Q+ G+PQGS +S+ LC +   H++     +  T+    L++ VDD L I+   ++A  FLK LL   P+YG E+N  K++ ++            E P  S+ PW G
Sbjct:  710 AEVLQFFKEMLSSYVIQWFRQVRGVPQGSAVSTMLCNLCYGHMENSLLKNI-TEKGGCLMRLVDDFLLITPKLSKAVHFLKTLLAGVPEYGCEINPQKVVVNFPVCDELVIPGISELPLQSLFPWCG 835          
BLAST of telomerase reverse transcriptase subunit isoform 2 vs. Ensembl Cavefish
Match: tert (telomerase reverse transcriptase [Source:ZFIN;Acc:ZDB-GENE-080405-1])

HSP 1 Score: 64.3142 bits (155), Expect = 1.459e-9
Identity = 37/127 (29.13%), Postives = 64/127 (50.39%), Query Frame = -2
Query: 1774 SEFYDFLENIYVKFGSNYYHQICGIPQGSQLSSYLCGIYMLHIKRKAFSDFSTKDNALLLQYVDDVLFISLSQTEAECFLKRLLTVYPKYGLELNNSKIICSWKN---------PESP--SVIPWLG 2121
            +E   F + +   +   ++ Q+ G+PQGS +S+ LC +   H++     +  T+    L++ VDD L I+   ++A  FLK LL   P+YG E+N  K++ ++            E P  S+ PW G
Sbjct:  710 AEVLQFFKEMLSSYVIQWFRQVRGVPQGSAVSTMLCNLCYGHMENSLLKNI-TEKGGCLMRLVDDFLLITPKLSKAVHFLKTLLAGVPEYGCEINPQKVVVNFPVCDELVIPGISELPLQSLFPWCG 835          
BLAST of telomerase reverse transcriptase subunit isoform 2 vs. Ensembl Medaka
Match: tert (telomerase reverse transcriptase [Source:NCBI gene;Acc:100049443])

HSP 1 Score: 71.2478 bits (173), Expect = 6.086e-12
Identity = 38/111 (34.23%), Postives = 57/111 (51.35%), Query Frame = -2
Query: 1783 FYDFLENIYVKFGSNYYHQICGIPQGSQLSSYLCGIYMLHIKRKAFSDFSTKDNALLLQYVDDVLFISLSQTEAECFLKRLLTVYPKYGLELNNSKIICSWKNPESPSVIP 2115
            F   L    V+ G   Y Q  GIPQGS +SS LC +   H++   F D   K+   L++ VDD L I+  + +A+ FL  LL   P+YG+  N  K++ +++  E     P
Sbjct:  121 FTQMLTGSVVQHGKKTYRQCRGIPQGSVVSSLLCCLCYGHMENVLFRDI--KNKGCLMRLVDDFLLITPDRNQAQSFLSILLAGVPQYGVVANPQKVVVNFQGSEGGGAFP 229          
BLAST of telomerase reverse transcriptase subunit isoform 2 vs. Ensembl Medaka
Match: tert (telomerase reverse transcriptase [Source:NCBI gene;Acc:100049443])

HSP 1 Score: 71.633 bits (174), Expect = 7.957e-12
Identity = 38/111 (34.23%), Postives = 57/111 (51.35%), Query Frame = -2
Query: 1783 FYDFLENIYVKFGSNYYHQICGIPQGSQLSSYLCGIYMLHIKRKAFSDFSTKDNALLLQYVDDVLFISLSQTEAECFLKRLLTVYPKYGLELNNSKIICSWKNPESPSVIP 2115
            F   L    V+ G   Y Q  GIPQGS +SS LC +   H++   F D   K+   L++ VDD L I+  + +A+ FL  LL   P+YG+  N  K++ +++  E     P
Sbjct:  767 FTQMLTGSVVQHGKKTYRQCRGIPQGSVVSSLLCCLCYGHMENVLFRDI--KNKGCLMRLVDDFLLITPDRNQAQSFLSILLAGVPQYGVVANPQKVVVNFQGSEGGGAFP 875          
BLAST of telomerase reverse transcriptase subunit isoform 2 vs. Planmine SMEST
Match: SMESG000061912.1 (SMESG000061912.1)

HSP 1 Score: 847.425 bits (2188), Expect = 0.000e+0
Identity = 454/470 (96.60%), Postives = 455/470 (96.81%), Query Frame = -2
Query: 1279 QNFHWCESPANSSSVVYFTLSQWHEFQKASASYYINRGIFSGPISTERIKEIKNYNVGTARCLVKSLETRDYRLISNLKTKQSHLTKYSRKKYKIVDXXXXXXXXXXXXXXXXXXXLITDDLYAPDSYEEIRKYRDRMNSVKQNKFYIVRADMKNCYESLRHQDLRSIFSDLISKTKDPEIKSKKFSLKSEFYDFLENIYVKFGSNYYHQICGIPQGSQLSSYLCGIYMLHIKRKAFSDFSTKDNALLLQYVDDVLFISLSQTEAECFLKRLLTVYPKYGLELNNSKIICSWKNPESPSVIPWLGYNLNDSCEVTLKVNNQLKSEIWE*IINFRIVIPALSRFAGFPQNAQXXXXXXXXXXXYAFKRRAIIANSIHDNCCSEEIINYNCELLGSLSAYIFLCRVRACLEPHELLSGTSSQKIAGLLKAFLFNYIENYKLYEVALKSLKKTLLPYKGQMKWILHYLCKLSS 2688
            QNFHWCESPANSSSVVYFTLSQWHEFQKASASYYINRGIFSGPISTERIKEIKNYNVGTARCLVKSLETRDYRLISNLKTKQSHLTKYSRKKYKIVDFKSLKLLELFKSLKLKKPELITDDLYAPDSYEEIRKYRDRMNSVKQNKFYIVRADMKNCYESLRHQDLRSIFSDLISKTKDPEIKSKKFSLKSEFYDFLENIYVKFGSNYYHQICGIPQGSQLSSYLCGIYMLHIKRKAFSDFSTKDNALLLQYVDDVLFISLSQTEAECFLKRLLTVYPKYGLELNNSKIICSWKNPESPSVIPWLGYNLNDSCEVTLKVNNQLK+               LSRFAGFPQNAQKSLNYLKLKLSYAFKRRAIIANSIHDNCCSEEIINYNCELLGSLSAYIFLCRVRACLEPHELLSGTSSQKIAGLLKAFLFNYIENYKLYEVALKSLKKTLLPYKGQMKWILHYLCKLSS
Sbjct:   50 QNFHWCESPANSSSVVYFTLSQWHEFQKASASYYINRGIFSGPISTERIKEIKNYNVGTARCLVKSLETRDYRLISNLKTKQSHLTKYSRKKYKIVDFKSLKLLELFKSLKLKKPELITDDLYAPDSYEEIRKYRDRMNSVKQNKFYIVRADMKNCYESLRHQDLRSIFSDLISKTKDPEIKSKKFSLKSEFYDFLENIYVKFGSNYYHQICGIPQGSQLSSYLCGIYMLHIKRKAFSDFSTKDNALLLQYVDDVLFISLSQTEAECFLKRLLTVYPKYGLELNNSKIICSWKNPESPSVIPWLGYNLNDSCEVTLKVNNQLKT---------------LSRFAGFPQNAQKSLNYLKLKLSYAFKRRAIIANSIHDNCCSEEIINYNCELLGSLSAYIFLCRVRACLEPHELLSGTSSQKIAGLLKAFLFNYIENYKLYEVALKSLKKTLLPYKGQMKWILHYLCKLSS 504          

HSP 2 Score: 91.2781 bits (225), Expect = 2.602e-18
Identity = 49/62 (79.03%), Postives = 49/62 (79.03%), Query Frame = -1
Query: 2732 MAYKAYLSLSDVCKSMKVTRLSNICLLILQINSKCNTYTLHELYIYIMSYILFYEFVIPILK 2917
            MAYKAYLSLSDVCKSMK             INSKCNTYTLHELYIYIMSYILFYEFVIPILK
Sbjct:    1 MAYKAYLSLSDVCKSMK-------------INSKCNTYTLHELYIYIMSYILFYEFVIPILK 49          
BLAST of telomerase reverse transcriptase subunit isoform 2 vs. Planmine SMEST
Match: SMESG000061912.1 (SMESG000061912.1)

HSP 1 Score: 847.04 bits (2187), Expect = 0.000e+0
Identity = 454/470 (96.60%), Postives = 455/470 (96.81%), Query Frame = -2
Query: 1279 QNFHWCESPANSSSVVYFTLSQWHEFQKASASYYINRGIFSGPISTERIKEIKNYNVGTARCLVKSLETRDYRLISNLKTKQSHLTKYSRKKYKIVDXXXXXXXXXXXXXXXXXXXLITDDLYAPDSYEEIRKYRDRMNSVKQNKFYIVRADMKNCYESLRHQDLRSIFSDLISKTKDPEIKSKKFSLKSEFYDFLENIYVKFGSNYYHQICGIPQGSQLSSYLCGIYMLHIKRKAFSDFSTKDNALLLQYVDDVLFISLSQTEAECFLKRLLTVYPKYGLELNNSKIICSWKNPESPSVIPWLGYNLNDSCEVTLKVNNQLKSEIWE*IINFRIVIPALSRFAGFPQNAQXXXXXXXXXXXYAFKRRAIIANSIHDNCCSEEIINYNCELLGSLSAYIFLCRVRACLEPHELLSGTSSQKIAGLLKAFLFNYIENYKLYEVALKSLKKTLLPYKGQMKWILHYLCKLSS 2688
            QNFHWCESPANSSSVVYFTLSQWHEFQKASASYYINRGIFSGPISTERIKEIKNYNVGTARCLVKSLETRDYRLISNLKTKQSHLTKYSRKKYKIVDFKSLKLLELFKSLKLKKPELITDDLYAPDSYEEIRKYRDRMNSVKQNKFYIVRADMKNCYESLRHQDLRSIFSDLISKTKDPEIKSKKFSLKSEFYDFLENIYVKFGSNYYHQICGIPQGSQLSSYLCGIYMLHIKRKAFSDFSTKDNALLLQYVDDVLFISLSQTEAECFLKRLLTVYPKYGLELNNSKIICSWKNPESPSVIPWLGYNLNDSCEVTLKVNNQLK+               LSRFAGFPQNAQKSLNYLKLKLSYAFKRRAIIANSIHDNCCSEEIINYNCELLGSLSAYIFLCRVRACLEPHELLSGTSSQKIAGLLKAFLFNYIENYKLYEVALKSLKKTLLPYKGQMKWILHYLCKLSS
Sbjct:   86 QNFHWCESPANSSSVVYFTLSQWHEFQKASASYYINRGIFSGPISTERIKEIKNYNVGTARCLVKSLETRDYRLISNLKTKQSHLTKYSRKKYKIVDFKSLKLLELFKSLKLKKPELITDDLYAPDSYEEIRKYRDRMNSVKQNKFYIVRADMKNCYESLRHQDLRSIFSDLISKTKDPEIKSKKFSLKSEFYDFLENIYVKFGSNYYHQICGIPQGSQLSSYLCGIYMLHIKRKAFSDFSTKDNALLLQYVDDVLFISLSQTEAECFLKRLLTVYPKYGLELNNSKIICSWKNPESPSVIPWLGYNLNDSCEVTLKVNNQLKT---------------LSRFAGFPQNAQKSLNYLKLKLSYAFKRRAIIANSIHDNCCSEEIINYNCELLGSLSAYIFLCRVRACLEPHELLSGTSSQKIAGLLKAFLFNYIENYKLYEVALKSLKKTLLPYKGQMKWILHYLCKLSS 540          

HSP 2 Score: 176.022 bits (445), Expect = 6.282e-46
Identity = 85/85 (100.00%), Postives = 85/85 (100.00%), Query Frame = -3
Query: 6099 MTIKIERNGFMKLDLGTALLKLCEKFCIYELTVRSELNNNFEFDEKYKTIKNKCSEIKKRSPIYKSSNSYSGEGKIVPDSINHYQ 6353
            MTIKIERNGFMKLDLGTALLKLCEKFCIYELTVRSELNNNFEFDEKYKTIKNKCSEIKKRSPIYKSSNSYSGEGKIVPDSINHYQ
Sbjct:    1 MTIKIERNGFMKLDLGTALLKLCEKFCIYELTVRSELNNNFEFDEKYKTIKNKCSEIKKRSPIYKSSNSYSGEGKIVPDSINHYQ 85          
BLAST of telomerase reverse transcriptase subunit isoform 2 vs. Planmine SMEST
Match: SMESG000061912.1 (SMESG000061912.1)

HSP 1 Score: 846.655 bits (2186), Expect = 0.000e+0
Identity = 454/470 (96.60%), Postives = 455/470 (96.81%), Query Frame = -2
Query: 1279 QNFHWCESPANSSSVVYFTLSQWHEFQKASASYYINRGIFSGPISTERIKEIKNYNVGTARCLVKSLETRDYRLISNLKTKQSHLTKYSRKKYKIVDXXXXXXXXXXXXXXXXXXXLITDDLYAPDSYEEIRKYRDRMNSVKQNKFYIVRADMKNCYESLRHQDLRSIFSDLISKTKDPEIKSKKFSLKSEFYDFLENIYVKFGSNYYHQICGIPQGSQLSSYLCGIYMLHIKRKAFSDFSTKDNALLLQYVDDVLFISLSQTEAECFLKRLLTVYPKYGLELNNSKIICSWKNPESPSVIPWLGYNLNDSCEVTLKVNNQLKSEIWE*IINFRIVIPALSRFAGFPQNAQXXXXXXXXXXXYAFKRRAIIANSIHDNCCSEEIINYNCELLGSLSAYIFLCRVRACLEPHELLSGTSSQKIAGLLKAFLFNYIENYKLYEVALKSLKKTLLPYKGQMKWILHYLCKLSS 2688
            QNFHWCESPANSSSVVYFTLSQWHEFQKASASYYINRGIFSGPISTERIKEIKNYNVGTARCLVKSLETRDYRLISNLKTKQSHLTKYSRKKYKIVDFKSLKLLELFKSLKLKKPELITDDLYAPDSYEEIRKYRDRMNSVKQNKFYIVRADMKNCYESLRHQDLRSIFSDLISKTKDPEIKSKKFSLKSEFYDFLENIYVKFGSNYYHQICGIPQGSQLSSYLCGIYMLHIKRKAFSDFSTKDNALLLQYVDDVLFISLSQTEAECFLKRLLTVYPKYGLELNNSKIICSWKNPESPSVIPWLGYNLNDSCEVTLKVNNQLK+               LSRFAGFPQNAQKSLNYLKLKLSYAFKRRAIIANSIHDNCCSEEIINYNCELLGSLSAYIFLCRVRACLEPHELLSGTSSQKIAGLLKAFLFNYIENYKLYEVALKSLKKTLLPYKGQMKWILHYLCKLSS
Sbjct:   76 QNFHWCESPANSSSVVYFTLSQWHEFQKASASYYINRGIFSGPISTERIKEIKNYNVGTARCLVKSLETRDYRLISNLKTKQSHLTKYSRKKYKIVDFKSLKLLELFKSLKLKKPELITDDLYAPDSYEEIRKYRDRMNSVKQNKFYIVRADMKNCYESLRHQDLRSIFSDLISKTKDPEIKSKKFSLKSEFYDFLENIYVKFGSNYYHQICGIPQGSQLSSYLCGIYMLHIKRKAFSDFSTKDNALLLQYVDDVLFISLSQTEAECFLKRLLTVYPKYGLELNNSKIICSWKNPESPSVIPWLGYNLNDSCEVTLKVNNQLKT---------------LSRFAGFPQNAQKSLNYLKLKLSYAFKRRAIIANSIHDNCCSEEIINYNCELLGSLSAYIFLCRVRACLEPHELLSGTSSQKIAGLLKAFLFNYIENYKLYEVALKSLKKTLLPYKGQMKWILHYLCKLSS 530          

HSP 2 Score: 154.836 bits (390), Expect = 5.210e-39
Identity = 75/75 (100.00%), Postives = 75/75 (100.00%), Query Frame = -3
Query: 6099 MKLDLGTALLKLCEKFCIYELTVRSELNNNFEFDEKYKTIKNKCSEIKKRSPIYKSSNSYSGEGKIVPDSINHYQ 6323
            MKLDLGTALLKLCEKFCIYELTVRSELNNNFEFDEKYKTIKNKCSEIKKRSPIYKSSNSYSGEGKIVPDSINHYQ
Sbjct:    1 MKLDLGTALLKLCEKFCIYELTVRSELNNNFEFDEKYKTIKNKCSEIKKRSPIYKSSNSYSGEGKIVPDSINHYQ 75          
BLAST of telomerase reverse transcriptase subunit isoform 2 vs. Planmine SMEST
Match: SMESG000061910.1 (SMESG000061910.1)

HSP 1 Score: 550.051 bits (1416), Expect = 8.062e-174
Identity = 264/266 (99.25%), Postives = 266/266 (100.00%), Query Frame = 2
Query:  155 LAKSSRKTTDFENLCTFEDDPAPLNDQYRSSRDKALVKRLMEKDGTQHLIVKCELYKISLVGNITFRSNGPWRCPVNVSDYNSMIGSTGEFDNKIRISPQCQAAKNFSWMTSPHTCLSVLNLDDISGTFPISQIITYIKDINSYFCWLVVVKRNESVLYDMHLFETPQCQYILKTNEGITIIKSQAWASMTLQIGQPPFQTLSAKLTQTSIKTITLSESIKNWTPVDPLNSGQTTAESNAEQYGNIVHPSFLMIILMGIITNYATP 952
            ++KSSRKTTDFENLCTFEDDPAPLNDQYRSSRDKALVKRLMEKDGTQHLIVKCELYKISLVGNITFRSNGPWRCPVNVSDYNSMIGSTGEFDNKIRISPQCQAAKNFSWMTSPHTCLSVLNLDDISGTFPISQIITYIKDINSYFCWLVVVKRNESVLYDMHLFETPQCQYILKTNEGITIIKSQAWASMTLQIGQPPFQTLSAKLTQTSIKTITLSESIKNWTPVDPLNSGQTTAESNAEQYGNIVHPSFLMIILMGIITNYATP
Sbjct:  477 ISKSSRKTTDFENLCTFEDDPAPLNDQYRSSRDKALVKRLMEKDGTQHLIVKCELYKISLVGNITFRSNGPWRCPVNVSDYNSMIGSTGEFDNKIRISPQCQAAKNFSWMTSPHTCLSVLNLDDISGTFPISQIITYIKDINSYFCWLVVVKRNESVLYDMHLFETPQCQYILKTNEGITIIKSQAWASMTLQIGQPPFQTLSAKLTQTSIKTITLSESIKNWTPVDPLNSGQTTAESNAEQYGNIVHPSFLMIILMGIITNYATP 742          
BLAST of telomerase reverse transcriptase subunit isoform 2 vs. Planmine SMEST
Match: SMESG000061912.1 (SMESG000061912.1)

HSP 1 Score: 272.707 bits (696), Expect = 2.470e-84
Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = -3
Query: 5946 MTIKIERNGFMKLDLGTALLKLCEKFCIYELTVRSELNNNFEFDEKYKTIKNKCSEIKKRSPIYKSSNSYSGEGKIVPDSINHYQVFAFLKSQLKCLNLGDIFLNSLNTTIFFNYILSLNYPTGILIHFLLIFCKS 6353
            MTIKIERNGFMKLDLGTALLKLCEKFCIYELTVRSELNNNFEFDEKYKTIKNKCSEIKKRSPIYKSSNSYSGEGKIVPDSINHYQVFAFLKSQLKCLNLGDIFLNSLNTTIFFNYILSLNYPTGILIHFLLIFCKS
Sbjct:    1 MTIKIERNGFMKLDLGTALLKLCEKFCIYELTVRSELNNNFEFDEKYKTIKNKCSEIKKRSPIYKSSNSYSGEGKIVPDSINHYQVFAFLKSQLKCLNLGDIFLNSLNTTIFFNYILSLNYPTGILIHFLLIFCKS 136          
The following BLAST results are available for this feature:
BLAST of telomerase reverse transcriptase subunit isoform 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
TERT6.654e-834.69telomerase reverse transcriptase [Source:HGNC Symb... [more]
back to top
BLAST of telomerase reverse transcriptase subunit isoform 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of telomerase reverse transcriptase subunit isoform 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of telomerase reverse transcriptase subunit isoform 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tert2.656e-1130.23telomerase reverse transcriptase [Source:ZFIN;Acc:... [more]
back to top
BLAST of telomerase reverse transcriptase subunit isoform 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSXETT00000011836.13.663e-1126.94telomerase reverse transcriptase [Source:NCBI gene... [more]
ENSXETT00000011858.13.803e-1126.94telomerase reverse transcriptase [Source:NCBI gene... [more]
ENSXETT00000028308.11.260e-1026.26telomerase reverse transcriptase [Source:NCBI gene... [more]
back to top
BLAST of telomerase reverse transcriptase subunit isoform 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Tert1.853e-631.82telomerase reverse transcriptase [Source:MGI Symbo... [more]
back to top
BLAST of telomerase reverse transcriptase subunit isoform 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q4KTA7|TERT_TAKRU3.428e-1135.40Telomerase reverse transcriptase OS=Takifugu rubri... [more]
sp|Q1PS67|TERT_ORYLA8.662e-1134.23Telomerase reverse transcriptase OS=Oryzias latipe... [more]
sp|O13339|TERT_SCHPO1.782e-1028.07Telomerase reverse transcriptase OS=Schizosaccharo... [more]
sp|Q6A548|TERT_CANLF4.963e-930.58Telomerase reverse transcriptase OS=Canis lupus fa... [more]
sp|Q8LKW0|TERT_ORYSJ1.266e-833.33Telomerase reverse transcriptase OS=Oryza sativa s... [more]
back to top
BLAST of telomerase reverse transcriptase subunit isoform 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G1BJ471.772e-3596.17Telomerase reverse transcriptase OS=Schmidtea medi... [more]
G1BJ467.012e-5496.17Telomerase reverse transcriptase OS=Schmidtea medi... [more]
G1BJ481.201e-10499.43Telomerase reverse transcriptase OS=Schmidtea medi... [more]
G1BJ496.169e-9299.43Telomerase reverse transcriptase subunit isoform 4... [more]
A0A5N4B4883.668e-2245.19Uncharacterized protein OS=Photinus pyralis OX=705... [more]
back to top
BLAST of telomerase reverse transcriptase subunit isoform 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tert7.736e-1028.57telomerase reverse transcriptase [Source:ZFIN;Acc:... [more]
tert1.325e-929.13telomerase reverse transcriptase [Source:ZFIN;Acc:... [more]
tert1.459e-929.13telomerase reverse transcriptase [Source:ZFIN;Acc:... [more]
back to top
BLAST of telomerase reverse transcriptase subunit isoform 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of telomerase reverse transcriptase subunit isoform 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of telomerase reverse transcriptase subunit isoform 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of telomerase reverse transcriptase subunit isoform 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tert6.086e-1234.23telomerase reverse transcriptase [Source:NCBI gene... [more]
tert7.957e-1234.23telomerase reverse transcriptase [Source:NCBI gene... [more]
back to top
BLAST of telomerase reverse transcriptase subunit isoform 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000061912.12.602e-1896.60SMESG000061912.1[more]
SMESG000061912.16.282e-4696.60SMESG000061912.1[more]
SMESG000061912.15.210e-3996.60SMESG000061912.1[more]
SMESG000061910.18.062e-17499.25SMESG000061910.1[more]
SMESG000061912.12.470e-84100.00SMESG000061912.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30031978
GenBankAEK12105.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031978 ID=SMED30031978|Name=telomerase reverse transcriptase subunit isoform 2|organism=Schmidtea mediterranea sexual|type=transcript|length=6373bp
CTTATTTGTTCCAAAAGCCATTTATAGAGCTGAAATTTCTTCAAAGCGTC
CAATTTTCAATAAAATATATTTAGGAGCCATAATTTCTGTTCACAAATCC
TCTTTGTTATTTAAATTTTATCTTTAAATGCGATAAAAATTCTTCATTTA
AAATCTAGCGAAAAGTTCGAGAAAAACAACTGATTTTGAAAACCTCTGTA
CATTTGAAGATGATCCAGCTCCACTAAATGACCAGTATCGTTCTTCAAGA
GATAAAGCATTAGTCAAACGTTTAATGGAAAAAGATGGAACCCAGCACTT
AATAGTGAAATGTGAACTTTATAAAATATCATTAGTAGGGAATATCACTT
TCAGATCAAATGGACCTTGGCGGTGTCCAGTCAATGTCAGCGATTACAAC
AGTATGATTGGATCAACTGGGGAATTTGACAATAAAATACGAATTTCACC
TCAATGTCAAGCAGCCAAAAACTTCAGTTGGATGACTTCTCCTCACACTT
GTTTGAGTGTTTTGAATTTGGATGATATATCTGGAACATTTCCCATTTCT
CAAATTATTACATATATCAAAGATATCAATTCGTATTTTTGTTGGTTAGT
CGTGGTGAAAAGAAATGAATCTGTACTGTATGACATGCATCTTTTCGAGA
CTCCACAATGCCAATATATATTAAAAACCAATGAAGGAATTACAATTATT
AAATCACAAGCTTGGGCTTCAATGACTTTACAAATCGGTCAACCTCCGTT
TCAGACTTTATCTGCAAAATTGACTCAAACATCAATAAAAACAATAACAC
TCAGTGAAAGTATCAAAAATTGGACCCCAGTTGATCCTTTAAACAGTGGG
CAAACGACAGCTGAATCAAATGCAGAACAATATGGCAACATAGTTCATCC
ATCTTTTCTCATGATTATTTTAATGGGAATCATTACAAATTATGCAACAC
CTTGAATACATTTCAGTGAAAGTGAAAAGGAAATCAAATCTCATAATTTG
GCAATGTAAAATCCGTAGTCTTTAGTAGGCATCATTCTGCAATGTTGATT
TTTTTATTGTGAATAATAAATAAATATATGTTTGAAGTACGCGTCGATTT
AAATCAATACTAAATTGAACAAAATAATTTCAAAAGATAATATTTAATAT
GATAATAATTATTTATAATTAAATCAAAAGAAGCGATTAAATAAAGCAAT
TACTTGACAAGTAACATAGAAAAATAATCAGACTGCGGAATAATTATCAA
TGAAAGACAAATTTAAATCATATTTTTATGAACTCAATTTACATAAATAA
TGGAGAATCCATTTCATTTGACCCTTGTAAGGAAGCAGAGTCTTCTTCAA
AGATTTCAACGCTACCTCATACAATTTATAGTTCTCAATATAATTGAACA
AAAATGCCTTCAACAAACCAGCAATTTTTTGACTCGATGTTCCCGATAAT
AATTCATGGGGCTCTAGACAGGCTCGGACTCTACAAAGGAATATATACGC
AGACAGGCTGCCTAATAATTCGCAATTGTAATTAATTATTTCTTCACTAC
AGCAATTGTCATGGATGCTATTAGCTATAATTGCCCTCCTTTTAAAGGCA
TATGACAGTTTTAATTTCAAATAATTAAGAGATTTTTGCGCATTTTGTGG
AAATCCTGCAAATCTCGATAAAGCTGGAATTACTATTCTGAAATTTATTA
TTCATTCCCAAATCTCACTTTTCAATTGATTGTTGACTTTTAATGTTACT
TCACACGAATCGTTCAGATTGTATCCGAGCCACGGAATAACAGATGGAGA
TTCTGGATTTTTCCAAGAACAAATGATTTTTGAATTATTTAACTCCAAGC
CGTATTTTGGATAAACTGTAAGAAGTCGTTTTAGGAAACATTCAGCTTCA
GTTTGTGAAAGACTGATGAATAAAACATCATCAACATATTGAAGAAGTAA
TGCATTATCTTTCGTTGAAAAATCTGAAAACGCTTTCCTTTTGATATGAA
GCATATATATACCGCATAAATAGGAAGACAGTTGCGATCCCTGAGGTATT
CCGCATATTTGATGATAATAGTTAGAACCGAACTTCACATAAATATTCTC
AAGGAAATCATAAAACTCTGATTTTAAGGAAAATTTTTTGGACTTAATTT
CGGGATCTTTAGTCTTCGAAATCAAATCAGAAAAAATAGAGCGCAAATCT
TGATGGCGTAATGACTCATAGCAATTTTTCATATCAGCTCTAACTATATA
AAACTTATTTTGTTTAACAGAATTCATTCGATCACGATATTTTCTTATTT
CCTCATAACTATCGGGTGCATATAAATCGTCTGTAATCAATTCAGGTTTC
TTAAGTTTTAATGATTTGAAAAGTTCGAGCAACTTTAATGATTTGAAATC
AACAATCTTGTACTTTTTTCTAGAATATTTTGTAAGATGCGATTGTTTAG
TTTTCAAATTTGAAATAAGTCTATAATCACGAGTTTCTAAACTTTTTACA
AGACATCGAGCAGTTCCAACATTATAATTTTTAATTTCTTTTATTCTTTC
TGTGCTAATCGGGCCACTAAATATTCCCCGGTTTATGTAATATGAAGCTG
AGGCTTTCTGAAACTCATGCCATTGTGAGAGCGTGAAATACACTACTGAG
GAAGAATTAGCTGGAGATTCGCACCAGTGAAAATTTTGCTAAATTGTTGA
TGAATAAATAGTGCGAATATTACTATCAAACCTTCAAAATGGGAATAACA
AACTCATAGAACAAGATATAAGACATAATATAAATGTATAGTTCGTGTAA
CGTATAAGTATTACATTTGCTATTAATCTGCAAAATTAATAAACAAATAT
TCGATAAACGTGTTACCTTCATTGACTTGCATACGTCCGAAAGGGATAAA
TAAGCTTTGTAGGCCATACTTATCAAATATTTACAATGTAATCGTTTGAT
GTAAGAATAATATTTATTTATAGAGTTAAATGAAATCATTTAAATTGTTA
ACTTATTTACCTACGTTTTTATACATCAAGGATCAGATAAAATTTCGAAT
CTGAAGATTATGAACAGTATATTGGAAAAAACTTCGAAATTTGATTCAGA
GATAATCAAAATAATTATCACTCTTGTAAAATATATAAAAAATTGCAAAG
GAAAACAGTCGGAAAGTTTTCTAAAGACGAGAATTAATTAGAAAAGTTAT
AGACGTATGAAGATTGAAACTTTTAAATCCTTGAAAATTAGCTGTTTACA
ATTTTCAAATGCGTTCAGTTTTAAACTTAGTGTAAACACTTTCAATGAAT
TTAAAATTGTAAAAATGTTTATAAAAACCGTATTAAAAACCTTATGACAA
GAAGATATGAACGAGGCATTAACCAGATTATTGGAAGGAGTTATTAGATT
AAATGAAGCTCATAGAAAATACAACATCCTTTACGGCGTCATTTTAAAGG
AATAAATAATCTTAAATTTTGAAGGCCTAAGAATATGACTAAAGACATGG
AGTTAGTTTTGGCTTATCGTAACTGATCTAAGAAGACATGCTTATCGATC
GGCAGAAAAATATAAATTACCACATCGTTTCAAAAGAAAAAAGAAATTTC
AGGGAAGAGGTGATACTAATAAATTCATGAAAGATATTCCATGTTTATCT
TTTCGTACCCCAGAAGCAACCTCAATGCAAGTGCCATGGCTTTCAATAAT
GTGCTTATGGATTCTTTGATAAATACGAATCCATATTAGATGAATATAAG
TTTGTTGCTAACTGCTTACATAACGTTGACGAAACAGGACTGTCCGCTGT
TCACAAACCATCCAAAATAATTGCTTAGAAAGGCAAACATCAAGTTGGTT
AAATGGGTTTGACCACTACAGGCGTATGCTGTATGAATACTGCAGGTGAA
TTCATACTTGAACTCATGTTAATATTTAAACGGACGAGGATGAACGATTG
TTTAAAGAAATGAGCACCACTGGGTACTATATTTGGATGTTCCAAAAATG
GATGGATAAACGTCAGAAATCTACCTATACAAAACATATTGAAGCCATAC
ACTAACGTGCGATTATGGCATTGTAATGTTATCCATTCTTGCTCATACAA
CCCACCGTCTCAAAACTTTGCGTGGATCTTTTGTCAAATATCTGAAAACC
AATTCTAACGAACCATTATTTTCTTGGTTAAAAACAAATTCCGAAACACA
ATTATATAAATTACTGTGTCAGAACTATTAAGATTTGCATAGTCAAAATC
AGTACCTGTTGATATAGCTTGGAATGGTTTAAACCTACCGGTATTTGACC
ATGCAATCGGTATAAATTTTATGATAATGGTTTTTGCACTTCTACTCTTT
ATGCACTCCTCCGTTGGACATCAATAAGGAGTTTTCTGCAGTGGTTACAC
AAGAAAGTAGAGAAGTTCATGGGCAACAAACGGACGCGCTTATAAACTAA
ATAAAACAGCAACTAAATGTTTTAGTTCCTGTACAATAATAAAACAAATA
TAGAGTTCCGTTGATGCTACAGCTCAAAATAACGTCAATGCAGAATAGAG
AAAACATAAAAAATGCGACAAATACAAGAAAAACAATAATTAATAAAAAA
TTGACATTAAAAATAAAAATAAATCGACTTGCGGAGATCGGGAGGAAAAC
ATGAGTCATTGCTGGAAAATGCAAATCATGGCTGCCCGATATATGTGCTT
TAGTTGACAAAAGAACAAATAATTGGTATTTGATATTTGTACTAAGTGAA
TACCTATTTGCCACGTAAACAAATTAATAATTACTATTGTTGCCTAATTG
AATTCTTAGGTACAACTAAGGTTGTAGATGGTAAGGCTTAAACATTATGA
ATTAAACATTTAATTTCCATTTATTTGATAAATCCTAAGTTTTATACGAT
TATTTTCGTAAGGGGTATTTTAGTAAGCAACCTAACCCTATTTTAATATT
TTTGTAAATACATACAATAAAAACCATGTAAAAAGATATTGGATAACCTT
TATTCTTGACTTGCATCACAAATCATAGAATTATATGTCAAGTTACTACA
GAAAGTACATATGTATGTTTATTGCGTAATGTGTGATGTAATCAGGAATT
AATTCCAATTACATATTTGTCTGCATTAGACAATCAGTCCATCGATCAAA
ATGTTTATATCCGTTACAAAAGTATGGAATTTTCTGATAAAGATTGTAGG
TCACAAAAGTCGATGTAACACATTCAATAGTTTCTCACAGCCGATAGTTT
TCATTGGAAATTTAACAATTTTTCTCGTCCCCTCTAGGTTAATAACCACT
GGTCCGTTAAATTACAAATTATCGTGTGATTGATAGGGGTCTGCGTATGG
AGCACGAGCCATAGTTAATGCTGTCTAAAAGTTCTAAAACATGTGAAAGG
GCACCCAAATACCCACTGGCAGTACGAGTTAGTGTTTGTTTAATTGTGTT
TTGACTGAAACCAACAAATATATCAGTATCGGGTTAACATTGTAACCTCA
ATGGGTACCCAGTCGCTTATTGTATTACCTGAATCAGGTACCGGTAACCA
TTGACGGTATTAGCGTGTGTTGGGCACTACTGATAAACACTATGATACTA
TGATTGGCTAGAAAATTTTAAAGATTATACGGGAAAGTAAAGAAAATGGA
TATTTGTTTGCGGGTCGGGCATTGTACCTCAAGGGTTCACATTATATCAT
TTTTAAGCATTAACAATATTTAAATAATGAATGTAAATTATAGAAATCAC
GACGGGACATGATTTGTTAGATATGGATGTCAAAGTTGCTAATGAGAGCT
CTTCACTAGAATTTTTTACTAAAAATTCAATTTGTAAACTTCAGGTAATC
AAATTACTTTTGATAGCTGTTTAATACATAAATAAGTTTCATTGCCTAAT
GCTATACAAGACTAATATTGTTGGATATAGATGGTTAAGATATTAAGATT
TGCAAAAAATTAACAGAAAATGAATTAAAATCCCGGTAGGATAATTTAAT
GAAAGGATATAGTTAAAAAATATAGTTGTGTTCAAACTATTTAGAAAAAT
ATCGCCGAGATTCAGACATTTTAATTGACTCTTGAGAAATGCAAAAACTT
GATAATGATTAATAGAATCTGGAACTATCTTTCCTTCGCCTGAATAAGAA
TTTGACGATTTGTAAATCGGGCTACGTTTTTTAATTTCACTACACTTGTT
TTTGATAGTTTTATATTTTTCATCAAATTCGAAATTATTATTCAATTCTG
ATCGAACTGTCAATTCATAAATACAAAATTTCTCACACAATTTTAACAAA
GCAGTTCCAAGATCTAATTTCATAAAACCATTTCTCTCAATTTTAATAGT
CATTTCGAAAAAGTACTAAAAGA
back to top

protein sequence of SMED30031978-orf-1

>SMED30031978-orf-1 ID=SMED30031978-orf-1|Name=SMED30031978-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=227bp
MEKDGTQHLIVKCELYKISLVGNITFRSNGPWRCPVNVSDYNSMIGSTGE
FDNKIRISPQCQAAKNFSWMTSPHTCLSVLNLDDISGTFPISQIITYIKD
INSYFCWLVVVKRNESVLYDMHLFETPQCQYILKTNEGITIIKSQAWASM
TLQIGQPPFQTLSAKLTQTSIKTITLSESIKNWTPVDPLNSGQTTAESNA
EQYGNIVHPSFLMIILMGIITNYATP*
back to top

protein sequence of SMED30031978-orf-2

>SMED30031978-orf-2 ID=SMED30031978-orf-2|Name=SMED30031978-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=137bp
MTIKIERNGFMKLDLGTALLKLCEKFCIYELTVRSELNNNFEFDEKYKTI
KNKCSEIKKRSPIYKSSNSYSGEGKIVPDSINHYQVFAFLKSQLKCLNLG
DIFLNSLNTTIFFNYILSLNYPTGILIHFLLIFCKS*
back to top

protein sequence of SMED30031978-orf-3

>SMED30031978-orf-3 ID=SMED30031978-orf-3|Name=SMED30031978-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=192bp
MNSVKQNKFYIVRADMKNCYESLRHQDLRSIFSDLISKTKDPEIKSKKFS
LKSEFYDFLENIYVKFGSNYYHQICGIPQGSQLSSYLCGIYMLHIKRKAF
SDFSTKDNALLLQYVDDVLFISLSQTEAECFLKRLLTVYPKYGLELNNSK
IICSWKNPESPSVIPWLGYNLNDSCEVTLKVNNQLKSEIWE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0003677DNA binding
GO:0003721telomerase RNA reverse transcriptase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0000204ovary
PLANA:0000208testis
PLANA:0000418head
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0002056medial muscle cell
PLANA:0002109X1 cell
PLANA:0003104enteric muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR043128Rev_trsase/Diguanyl_cyclase
IPR003545Telomerase_RT
IPR000477RT_dom
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.10.10.10coord: 76..91
e-value: 5.3E-8
score: 34.3
NoneNo IPR availableCDDcd01648TERTcoord: 85..187
e-value: 1.96393E-20
score: 80.7714
NoneNo IPR availableSUPERFAMILYSSF56672DNA/RNA polymerasescoord: 10..171
IPR043128Reverse transcriptase/Diguanylate cyclase domainGENE3DG3DSA:3.30.70.270coord: 92..167
e-value: 5.3E-8
score: 34.3
IPR000477Reverse transcriptase domainPFAMPF00078RVT_1coord: 73..185
e-value: 4.1E-12
score: 46.1
IPR000477Reverse transcriptase domainPROSITEPS50878RT_POLcoord: 1..186
score: 29.129
IPR003545Telomerase reverse transcriptasePANTHERPTHR12066TELOMERASE REVERSE TRANSCRIPTASEcoord: 74..189