migration and invasion enhancer 1-like

Overview
Namemigration and invasion enhancer 1-like
Smed IDSMED30031966
Length (bp)865
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of migration and invasion enhancer 1-like (SMED30031966) t-SNE clustered cells

Violin plots show distribution of expression levels for migration and invasion enhancer 1-like (SMED30031966) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of migration and invasion enhancer 1-like vs. Ensembl Human
Match: MIEN1 (migration and invasion enhancer 1 [Source:HGNC Symbol;Acc:HGNC:28230])

HSP 1 Score: 64.6994 bits (156), Expect = 1.316e-12
Identity = 37/94 (39.36%), Postives = 49/94 (52.13%), Query Frame = 2
Query:   38 GDTVDIVMHVEYCGS*GYSTTYNNLKQDVQRAMNNIHFTFEIGRKGSFEVMLNGVLIFSKLELGGFPKIEQVIDVIKLVQAGEKPHKLTQFVAP 319
            G  V IV  VEYC   G+  TY  L   V+     I     +G  G+FE+ +NG L+FSKLE GGFP  + +I+ I+    GE   K+T    P
Sbjct:   20 GSGVRIV--VEYCEPCGFEATYLELASAVKEQYPGIEIESRLGGTGAFEIEINGQLVFSKLENGGFPYEKDLIEAIRRASNGETLEKITNSRPP 111          
BLAST of migration and invasion enhancer 1-like vs. Ensembl Human
Match: MIEN1 (migration and invasion enhancer 1 [Source:HGNC Symbol;Acc:HGNC:28230])

HSP 1 Score: 55.0694 bits (131), Expect = 3.796e-9
Identity = 30/69 (43.48%), Postives = 38/69 (55.07%), Query Frame = 2
Query:   32 KMGDTVDIVMHVEYCGS*GYSTTYNNLKQDVQRAMNNIHFTFEIGRKGSFEVMLNGVLIFSKLELGGFP 238
            + G  V IV  VEYC   G+  TY  L   V+     I     +G  G+FE+ +NG L+FSKLE GGFP
Sbjct:   18 EPGSGVRIV--VEYCEPCGFEATYLELASAVKEQYPGIEIESRLGGTGAFEIEINGQLVFSKLENGGFP 84          
BLAST of migration and invasion enhancer 1-like vs. Ensembl Fly
Match: CG15456 (gene:FBgn0040650 transcript:FBtr0077323)

HSP 1 Score: 47.7506 bits (112), Expect = 4.882e-7
Identity = 25/85 (29.41%), Postives = 47/85 (55.29%), Query Frame = 2
Query:   53 IVMHVEYCGS*GYSTTYNNLKQDVQRAMNNIHFTFEIGRKGSFEVMLNGVLIFSKLELGGFPKIEQVIDVIKLVQAGEKPHKLTQ 307
            + + VEYCG   +S   + L++ +  +  ++  +   GR+GSFEV ++G L+ SKL    FP+   V+  ++  + GE   K+ +
Sbjct:    2 VKVEVEYCGICNFSGQCHLLREFLLASSPDLDISCRTGRRGSFEVSIDGQLVHSKLSCLAFPQHASVLAQVQKAERGEPVEKVLE 86          
BLAST of migration and invasion enhancer 1-like vs. Ensembl Fly
Match: CG15456 (gene:FBgn0040650 transcript:FBtr0340402)

HSP 1 Score: 47.7506 bits (112), Expect = 4.882e-7
Identity = 25/85 (29.41%), Postives = 47/85 (55.29%), Query Frame = 2
Query:   53 IVMHVEYCGS*GYSTTYNNLKQDVQRAMNNIHFTFEIGRKGSFEVMLNGVLIFSKLELGGFPKIEQVIDVIKLVQAGEKPHKLTQ 307
            + + VEYCG   +S   + L++ +  +  ++  +   GR+GSFEV ++G L+ SKL    FP+   V+  ++  + GE   K+ +
Sbjct:    2 VKVEVEYCGICNFSGQCHLLREFLLASSPDLDISCRTGRRGSFEVSIDGQLVHSKLSCLAFPQHASVLAQVQKAERGEPVEKVLE 86          
BLAST of migration and invasion enhancer 1-like vs. Ensembl Zebrafish
Match: selenow2a (selenoprotein W, 2a [Source:ZFIN;Acc:ZDB-GENE-030428-1])

HSP 1 Score: 70.8626 bits (172), Expect = 2.719e-15
Identity = 37/95 (38.95%), Postives = 55/95 (57.89%), Query Frame = 2
Query:   53 IVMHVEYCGS*GYSTTYNNLKQDVQRAMNNIHFTFEIGRKGSFEVMLNGVLIFSKLELGGFPKIEQVIDVIKLVQAGEKPHKLTQFVAPPACELL 337
            + + VEYCG  GY   Y  LK+ V     +   +  +GR+GSFE+ +NG LIFSKLE  GFP  + ++ VI+    G+   K+T+  + P C +L
Sbjct:    3 VQIKVEYCGGUGYEPRYQELKRVVTAEFTDADVSGFVGRQGSFEIEINGQLIFSKLETSGFPYEDDIMGVIQRAYDGQPVEKITK--SQPPCVIL 95          
BLAST of migration and invasion enhancer 1-like vs. Ensembl Zebrafish
Match: selenow2b (selenoprotein W, 2b [Source:ZFIN;Acc:ZDB-GENE-030428-2])

HSP 1 Score: 67.0106 bits (162), Expect = 7.768e-14
Identity = 31/85 (36.47%), Postives = 52/85 (61.18%), Query Frame = 2
Query:   53 IVMHVEYCGS*GYSTTYNNLKQDVQRAMNNIHFTFEIGRKGSFEVMLNGVLIFSKLELGGFPKIEQVIDVIKLVQAGEKPHKLTQ 307
            + + +EYCG+ GY   +  LK+++     +   +  +GR+G FE+ +N  L+FSKLE GGFP  E +I+ +   + G KP K+T+
Sbjct:    3 VKVKIEYCGAUGYEPRFQELKREICGNCPDAEVSGFVGRRGCFEIQINDFLVFSKLESGGFPYSEDIIEAVVKAKDG-KPEKITR 86          
BLAST of migration and invasion enhancer 1-like vs. Ensembl Zebrafish
Match: selenow2b (selenoprotein W, 2b [Source:ZFIN;Acc:ZDB-GENE-030428-2])

HSP 1 Score: 56.6102 bits (135), Expect = 3.973e-10
Identity = 29/85 (34.12%), Postives = 49/85 (57.65%), Query Frame = 2
Query:   53 IVMHVEYCGS*GYSTTYNNLKQDVQRAMNNIHFTFEIGRKGSFEVMLNGVLIFSKLELGGFPKIEQVIDVIKLVQAGEKPHKLTQ 307
            + + +EYCG       +  LK+++     +   +  +GR+G FE+ +N  L+FSKLE GGFP  E +I+ +   + G KP K+T+
Sbjct:    3 VKVKIEYCGP-----RFQELKREICGNCPDAEVSGFVGRRGCFEIQINDFLVFSKLESGGFPYSEDIIEAVVKAKDG-KPEKITR 81          
BLAST of migration and invasion enhancer 1-like vs. Ensembl Zebrafish
Match: selenow2a (selenoprotein W, 2a [Source:ZFIN;Acc:ZDB-GENE-030428-1])

HSP 1 Score: 56.225 bits (134), Expect = 4.623e-10
Identity = 30/79 (37.97%), Postives = 46/79 (58.23%), Query Frame = 2
Query:  101 YNNLKQDVQRAMNNIHFTFEIGRKGSFEVMLNGVLIFSKLELGGFPKIEQVIDVIKLVQAGEKPHKLTQFVAPPACELL 337
            Y  LK+ V     +   +  +GR+GSFE+ +NG LIFSKLE  GFP  + ++ VI+    G+   K+T+  + P C +L
Sbjct:    9 YQELKRVVTAEFTDADVSGFVGRQGSFEIEINGQLIFSKLETSGFPYEDDIMGVIQRAYDGQPVEKITK--SQPPCVIL 85          
BLAST of migration and invasion enhancer 1-like vs. Ensembl Xenopus
Match: mien1 (migration and invasion enhancer 1 [Source:NCBI gene;Acc:548750])

HSP 1 Score: 65.0846 bits (157), Expect = 4.801e-13
Identity = 36/92 (39.13%), Postives = 50/92 (54.35%), Query Frame = 2
Query:   44 TVDIVMHVEYCGS*GYSTTYNNLKQDVQRAMNNIHFTFEIGRKGSFEVMLNGVLIFSKLELGGFPKIEQVIDVIKLVQAGEKPHKLTQFVAP 319
            +V IV  VEYC   G+ + Y  L   V     ++      G  G+FE+ +NG L+FSKLELGGFP  + +I+ I+    GE   K+T   AP
Sbjct:    2 SVSIV--VEYCEPCGFKSHYEELASAVLEEFPDVTIDSRPGGTGAFEIEINGQLVFSKLELGGFPYAKDLIEAIRKASNGEPVEKITNSQAP 91          
BLAST of migration and invasion enhancer 1-like vs. Ensembl Mouse
Match: Mien1 (migration and invasion enhancer 1 [Source:MGI Symbol;Acc:MGI:1913678])

HSP 1 Score: 64.3142 bits (155), Expect = 1.174e-12
Identity = 38/102 (37.25%), Postives = 54/102 (52.94%), Query Frame = 2
Query:   32 KMGDTVDIVMHVEYCGS*GYSTTYNNLKQDVQRAMNNIHFTFEIGRKGSFEVMLNGVLIFSKLELGGFPKIEQVIDVIKLVQAGEKPHKLTQFVAPPACELL 337
            + G  V IV  VEYC   G+  TY  L   V+     I     +G  G+FE+ +NG L+FSKLE GGFP  + +++ I+    GE   K+T   + P C +L
Sbjct:   18 EAGSGVHIV--VEYCKPCGFEATYLELASAVKEEYPGIEIESRLGGTGAFEIEINGQLVFSKLENGGFPYEKDLMEAIRRASNGEPVEKITN--SRPPCVIL 115          
BLAST of migration and invasion enhancer 1-like vs. UniProt/SwissProt
Match: sp|Q9BRT3|MIEN1_HUMAN (Migration and invasion enhancer 1 OS=Homo sapiens OX=9606 GN=MIEN1 PE=1 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 6.320e-12
Identity = 37/94 (39.36%), Postives = 49/94 (52.13%), Query Frame = 2
Query:   38 GDTVDIVMHVEYCGS*GYSTTYNNLKQDVQRAMNNIHFTFEIGRKGSFEVMLNGVLIFSKLELGGFPKIEQVIDVIKLVQAGEKPHKLTQFVAP 319
            G  V IV  VEYC   G+  TY  L   V+     I     +G  G+FE+ +NG L+FSKLE GGFP  + +I+ I+    GE   K+T    P
Sbjct:   20 GSGVRIV--VEYCEPCGFEATYLELASAVKEQYPGIEIESRLGGTGAFEIEINGQLVFSKLENGGFPYEKDLIEAIRRASNGETLEKITNSRPP 111          
BLAST of migration and invasion enhancer 1-like vs. UniProt/SwissProt
Match: sp|Q148C8|MIEN1_BOVIN (Migration and invasion enhancer 1 OS=Bos taurus OX=9913 GN=MIEN1 PE=3 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 6.991e-12
Identity = 37/97 (38.14%), Postives = 51/97 (52.58%), Query Frame = 2
Query:   29 SKMGDTVDIVMHVEYCGS*GYSTTYNNLKQDVQRAMNNIHFTFEIGRKGSFEVMLNGVLIFSKLELGGFPKIEQVIDVIKLVQAGEKPHKLTQFVAP 319
            ++ G  V IV  VEYC   G+  TY  L   V+     I     +G  G+FE+ +NG L+FSKLE GGFP  + +I+ I+    GE   K+T    P
Sbjct:   17 TEPGHGVRIV--VEYCEPCGFEATYLELASAVKEQYPGIEIESRLGGTGAFEIEINGQLVFSKLENGGFPYEKDLIEAIRRASNGEPLEKITNSRPP 111          
BLAST of migration and invasion enhancer 1-like vs. UniProt/SwissProt
Match: sp|Q9CQ86|MIEN1_MOUSE (Migration and invasion enhancer 1 OS=Mus musculus OX=10090 GN=Mien1 PE=1 SV=1)

HSP 1 Score: 64.3142 bits (155), Expect = 8.215e-12
Identity = 38/102 (37.25%), Postives = 54/102 (52.94%), Query Frame = 2
Query:   32 KMGDTVDIVMHVEYCGS*GYSTTYNNLKQDVQRAMNNIHFTFEIGRKGSFEVMLNGVLIFSKLELGGFPKIEQVIDVIKLVQAGEKPHKLTQFVAPPACELL 337
            + G  V IV  VEYC   G+  TY  L   V+     I     +G  G+FE+ +NG L+FSKLE GGFP  + +++ I+    GE   K+T   + P C +L
Sbjct:   18 EAGSGVHIV--VEYCKPCGFEATYLELASAVKEEYPGIEIESRLGGTGAFEIEINGQLVFSKLENGGFPYEKDLMEAIRRASNGEPVEKITN--SRPPCVIL 115          
BLAST of migration and invasion enhancer 1-like vs. TrEMBL
Match: A7L483 (Selenoprotein W2 OS=Artemia franciscana OX=6661 PE=2 SV=2)

HSP 1 Score: 75.485 bits (184), Expect = 1.133e-13
Identity = 32/85 (37.65%), Postives = 53/85 (62.35%), Query Frame = 2
Query:   53 IVMHVEYCGS*GYSTTYNNLKQDVQRAMNNIHFTFEIGRKGSFEVMLNGVLIFSKLELGGFPKIEQVIDVIKLVQAGEKPHKLTQ 307
            + +HVEYCG+ GY+  Y  L   +++A  +   +  +GR+ SFEV +NG LI SKL   GFP  ++V++++  V  G+KP  + +
Sbjct:    2 VKIHVEYCGAUGYAPRYQELAAKIRKAAPDAEVSGNVGRRSSFEVTVNGELIHSKLSTNGFPDFDEVVEIVISVTKGDKPRTVEK 86          
BLAST of migration and invasion enhancer 1-like vs. TrEMBL
Match: Q3ZLC7 (Selenoprotein W2a OS=Oreochromis mossambicus OX=8127 PE=2 SV=2)

HSP 1 Score: 72.4034 bits (176), Expect = 1.404e-12
Identity = 37/89 (41.57%), Postives = 52/89 (58.43%), Query Frame = 2
Query:   53 IVMHVEYCGS*GYSTTYNNLKQDVQRAMNNIHFTFEIGRKGSFEVMLNGVLIFSKLELGGFPKIEQVIDVIKLVQAGEKPHKLTQFVAP 319
            + + VEYCG  GY   Y  L + V+   ++   T  +GR GSFE+ +NG L+FSKLE GGFP  + V+D I     G+   K+T+  AP
Sbjct:    3 VKVRVEYCGGUGYEPRYRELARVVKGEFSDADVTGVVGRTGSFEIEINGQLVFSKLETGGFPYEDDVMDAIHNAYDGKPLQKITKSRAP 91          
BLAST of migration and invasion enhancer 1-like vs. TrEMBL
Match: A0A4S2KHA8 (Migration and invasion enhancer 1 OS=Temnothorax longispinosus OX=300112 GN=DBV15_08132 PE=4 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 2.620e-12
Identity = 35/101 (34.65%), Postives = 58/101 (57.43%), Query Frame = 2
Query:    5 NLQILIFSSKMGDTVDIVMHVEYCGS*GYSTTYNNLKQDVQRAMNNIHFTFEIGRKGSFEVMLNGVLIFSKLELGGFPKIEQVIDVIKLVQAGEKPHKLTQ 307
            N  I+    +  + +D+ + VEYCGS G+   +  L ++++R + N+H     GR+ SFEV +N  L++SKL+   FP    + D+IK V AG+   K+ Q
Sbjct:   16 NYTIISKCDEKAEEMDVKIDVEYCGSCGHKKQFLQLAEEIKRNVPNVHVAGTAGRQASFEVQVNDELVYSKLQTLAFPDFVAIADMIKDVSAGKPVRKVDQ 116          
BLAST of migration and invasion enhancer 1-like vs. TrEMBL
Match: F6NX26 (Selenoprotein W, 2a OS=Danio rerio OX=7955 GN=selenow2a PE=1 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 6.084e-12
Identity = 37/95 (38.95%), Postives = 55/95 (57.89%), Query Frame = 2
Query:   53 IVMHVEYCGS*GYSTTYNNLKQDVQRAMNNIHFTFEIGRKGSFEVMLNGVLIFSKLELGGFPKIEQVIDVIKLVQAGEKPHKLTQFVAPPACELL 337
            + + VEYCG  GY   Y  LK+ V     +   +  +GR+GSFE+ +NG LIFSKLE  GFP  + ++ VI+    G+   K+T+  + P C +L
Sbjct:    3 VQIKVEYCGGCGYEPRYQELKRVVTAEFTDADVSGFVGRQGSFEIEINGQLIFSKLETSGFPYEDDIMGVIQRAYDGQPVEKITK--SQPPCVIL 95          
BLAST of migration and invasion enhancer 1-like vs. TrEMBL
Match: Q802F5 (Selenoprotein W, 2a OS=Danio rerio OX=7955 GN=selenow2a PE=2 SV=2)

HSP 1 Score: 70.8626 bits (172), Expect = 6.084e-12
Identity = 37/95 (38.95%), Postives = 55/95 (57.89%), Query Frame = 2
Query:   53 IVMHVEYCGS*GYSTTYNNLKQDVQRAMNNIHFTFEIGRKGSFEVMLNGVLIFSKLELGGFPKIEQVIDVIKLVQAGEKPHKLTQFVAPPACELL 337
            + + VEYCG  GY   Y  LK+ V     +   +  +GR+GSFE+ +NG LIFSKLE  GFP  + ++ VI+    G+   K+T+  + P C +L
Sbjct:    3 VQIKVEYCGGUGYEPRYQELKRVVTAEFTDADVSGFVGRQGSFEIEINGQLIFSKLETSGFPYEDDIMGVIQRAYDGQPVEKITK--SQPPCVIL 95          
BLAST of migration and invasion enhancer 1-like vs. Ensembl Cavefish
Match: selenow2a (selenoprotein W, 2a [Source:ZFIN;Acc:ZDB-GENE-030428-1])

HSP 1 Score: 57.3806 bits (137), Expect = 1.312e-10
Identity = 32/84 (38.10%), Postives = 46/84 (54.76%), Query Frame = 2
Query:   86 GYSTTYNNLKQDVQRAMNNIHFTFEIGRKGSFEVMLNGVLIFSKLELGGFPKIEQVIDVIKLVQAGEKPHKLTQFVAPPACELL 337
            GY   Y  LK+ V         +  +GR GSFE+ +NG L+FSKLE  GFP  + V+D I+    G+   K+T+  + P C +L
Sbjct:    1 GYEPRYQELKRVVVAEFPEAAVSGFVGRLGSFEIEINGQLVFSKLETSGFPYEDDVMDAIQKAHDGKPVEKITK--SQPRCVIL 82          
BLAST of migration and invasion enhancer 1-like vs. Ensembl Nematostella
Match: EDO45053 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUC6])

HSP 1 Score: 46.9802 bits (110), Expect = 5.805e-7
Identity = 23/63 (36.51%), Postives = 38/63 (60.32%), Query Frame = 2
Query:  110 LKQDVQRAMNNIHFTFEIGRKGSFEVMLNGVLIFSKLELGGFPKIEQVID-VIKLVQAGEKPH 295
            L+ ++           ++GR GSFEV +NG  +FSKL+ GGFP  ++V++ VI+  +  + PH
Sbjct:   38 LRDEILAECPEAQVEGKVGRSGSFEVTINGKEVFSKLKQGGFPVCDEVVNSVIEACKGLDPPH 100          
BLAST of migration and invasion enhancer 1-like vs. Ensembl Medaka
Match: selenow2a (migration and invasion enhancer 1 [Source:NCBI gene;Acc:101155515])

HSP 1 Score: 56.6102 bits (135), Expect = 2.721e-10
Identity = 25/53 (47.17%), Postives = 37/53 (69.81%), Query Frame = 2
Query:  161 IGRKGSFEVMLNGVLIFSKLELGGFPKIEQVIDVIKLVQAGEKPHKLTQFVAP 319
            +GR GSFE+ +NG L+FSKLELGGFP  + V++ ++    G+   K+T+  AP
Sbjct:   25 VGRSGSFEIQINGQLVFSKLELGGFPYEDDVLNAVQNAHDGKPVQKITKSRAP 77          
BLAST of migration and invasion enhancer 1-like vs. Ensembl Medaka
Match: selenow2a (migration and invasion enhancer 1 [Source:NCBI gene;Acc:101155515])

HSP 1 Score: 55.8398 bits (133), Expect = 5.636e-10
Identity = 29/78 (37.18%), Postives = 44/78 (56.41%), Query Frame = 2
Query:   86 GYSTTYNNLKQDVQRAMNNIHFTFEIGRKGSFEVMLNGVLIFSKLELGGFPKIEQVIDVIKLVQAGEKPHKLTQFVAP 319
            GY   Y +L   V+        +  +GR  SFE+ +NG L+FSKLELGGFP  + V++ ++    G+   K+T+  AP
Sbjct:    3 GYEPRYQDLASTVKDEFPEAEVSGFVGRS-SFEIQINGQLVFSKLELGGFPYEDDVLNAVQNAHDGKPVQKITKSRAP 79          
The following BLAST results are available for this feature:
BLAST of migration and invasion enhancer 1-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
MIEN11.316e-1239.36migration and invasion enhancer 1 [Source:HGNC Sym... [more]
MIEN13.796e-943.48migration and invasion enhancer 1 [Source:HGNC Sym... [more]
back to top
BLAST of migration and invasion enhancer 1-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of migration and invasion enhancer 1-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG154564.882e-729.41gene:FBgn0040650 transcript:FBtr0077323[more]
CG154564.882e-729.41gene:FBgn0040650 transcript:FBtr0340402[more]
back to top
BLAST of migration and invasion enhancer 1-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
selenow2a2.719e-1538.95selenoprotein W, 2a [Source:ZFIN;Acc:ZDB-GENE-0304... [more]
selenow2b7.768e-1436.47selenoprotein W, 2b [Source:ZFIN;Acc:ZDB-GENE-0304... [more]
selenow2b3.973e-1034.12selenoprotein W, 2b [Source:ZFIN;Acc:ZDB-GENE-0304... [more]
selenow2a4.623e-1037.97selenoprotein W, 2a [Source:ZFIN;Acc:ZDB-GENE-0304... [more]
back to top
BLAST of migration and invasion enhancer 1-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mien14.801e-1339.13migration and invasion enhancer 1 [Source:NCBI gen... [more]
back to top
BLAST of migration and invasion enhancer 1-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Mien11.174e-1237.25migration and invasion enhancer 1 [Source:MGI Symb... [more]
back to top
BLAST of migration and invasion enhancer 1-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q9BRT3|MIEN1_HUMAN6.320e-1239.36Migration and invasion enhancer 1 OS=Homo sapiens ... [more]
sp|Q148C8|MIEN1_BOVIN6.991e-1238.14Migration and invasion enhancer 1 OS=Bos taurus OX... [more]
sp|Q9CQ86|MIEN1_MOUSE8.215e-1237.25Migration and invasion enhancer 1 OS=Mus musculus ... [more]
back to top
BLAST of migration and invasion enhancer 1-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A7L4831.133e-1337.65Selenoprotein W2 OS=Artemia franciscana OX=6661 PE... [more]
Q3ZLC71.404e-1241.57Selenoprotein W2a OS=Oreochromis mossambicus OX=81... [more]
A0A4S2KHA82.620e-1234.65Migration and invasion enhancer 1 OS=Temnothorax l... [more]
F6NX266.084e-1238.95Selenoprotein W, 2a OS=Danio rerio OX=7955 GN=sele... [more]
Q802F56.084e-1238.95Selenoprotein W, 2a OS=Danio rerio OX=7955 GN=sele... [more]
back to top
BLAST of migration and invasion enhancer 1-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
selenow2a1.312e-1038.10selenoprotein W, 2a [Source:ZFIN;Acc:ZDB-GENE-0304... [more]
back to top
BLAST of migration and invasion enhancer 1-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of migration and invasion enhancer 1-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of migration and invasion enhancer 1-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO450535.805e-736.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of migration and invasion enhancer 1-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
selenow2a2.721e-1047.17migration and invasion enhancer 1 [Source:NCBI gen... [more]
selenow2a5.636e-1037.18migration and invasion enhancer 1 [Source:NCBI gen... [more]
back to top
BLAST of migration and invasion enhancer 1-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031966 ID=SMED30031966|Name=migration and invasion enhancer 1-like|organism=Schmidtea mediterranea sexual|type=transcript|length=865bp
AGATAATCTTCAAATTTTAATTTTTTCATCAAAAATGGGAGATACTGTGG
ATATTGTGATGCATGTCGAATATTGTGGATCATGAGGATACAGTACTACT
TACAATAATCTCAAGCAGGATGTTCAACGTGCCATGAACAACATTCATTT
TACCTTTGAAATTGGTCGCAAAGGTAGTTTTGAAGTGATGCTAAATGGCG
TGTTGATATTTTCTAAACTTGAATTGGGTGGTTTCCCTAAAATTGAACAA
GTTATCGATGTCATAAAGTTAGTTCAAGCTGGTGAAAAACCTCATAAGTT
GACTCAATTTGTTGCGCCTCCTGCTTGTGAACTTTTGTAAATTATGCTCT
CATTTTAGATTTTTTATTTCAATTTTTCATGCTTATGATGTTGATTGTCT
TAAAATGGTCCGCCAACTGACAATTGCCTGATGCTCAATGAAAATATCAT
TATGCCAATGTTTTAGTTGATAAATATTTTTTTTTAAATTGAATAAATAA
TTTTTTCCCTCATAAATTTTAAAAAATATTACTTCATGTCATTAGATTTT
ATTAATTATAATATTTAATTATTTGGTATTATTATTACGAAAATGATGAA
AAATTACCTGATATTTGAGAAATATTTTTTTATCACTAAACGTTAATATT
AAAAAATTTGGTTTGAAATTTAAAACTCGCGAATGAACTTTTAATTATTA
TTTTGAGCATTATTAATACAATTTTATGTTTTTATATAATAATTGATTGA
AAGCTCTAGAATGCTAAACGAACGAAATTAGCTTCACCTTCAGTCTGTCA
TATTAATGATGTAATAGTTATGATATAATTAAAAATTCTCAATAAAAAAA
AAAAAAAAAATGCGA
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000208testis
PLANA:0000231vitelline gland
Vocabulary: INTERPRO
TermDefinition
IPR036249Thioredoxin-like_sf
IPR011893Selenoprotein_Rdx-typ
IPR012336Thioredoxin-like_fold
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005829cytosol
GO:0005886plasma membrane
GO:0016020membrane
GO:0031235intrinsic component of the cytoplasmic side of the plasma membrane
GO:0070062extracellular exosome
Vocabulary: biological process
TermDefinition
GO:0006915apoptotic process
GO:0030335positive regulation of cell migration
GO:0043066negative regulation of apoptotic process
GO:0051491positive regulation of filopodium assembly
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011893Selenoprotein, Rdx-typeTIGRFAMTIGR02174TIGR02174coord: 12..45
e-value: 3.9E-10
score: 37.9
IPR011893Selenoprotein, Rdx-typePFAMPF10262Rdxcoord: 7..45
e-value: 8.9E-7
score: 29.0
IPR036249Thioredoxin-like superfamilyGENE3DG3DSA:3.40.30.10coord: 1..50
e-value: 4.8E-12
score: 47.7
IPR036249Thioredoxin-like superfamilySUPERFAMILYSSF52833Thioredoxin-likecoord: 5..49