Intraflagellar transport protein 52

Overview
NameIntraflagellar transport protein 52
Smed IDSMED30031955
Length (bp)1628
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Intraflagellar transport protein 52 (SMED30031955) t-SNE clustered cells

Violin plots show distribution of expression levels for Intraflagellar transport protein 52 (SMED30031955) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Intraflagellar transport protein 52 (SMED30031955) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Intraflagellar transport protein 52 (SMED30031955) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031955

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30031955SMESG000043987.1 SmedASXL_019646SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30031955SMESG000043987.1 dd_Smed_v4_5043_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30031955SMESG000043987.1 dd_Smed_v4_5043_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30031955SMESG000043987.1 dd_Smed_v4_5043_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30031955SMESG000043987.1 dd_Smed_v6_5043_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30031955SMESG000043987.1 OX_Smed_1.0.07045ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30031955SMESG000043987.1 dd_Smed_v4_5043_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30031955SMESG000043987.1 dd_Smed_v4_5043_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30031955SMESG000043987.1 dd_Smed_v4_5043_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Intraflagellar transport protein 52 vs. Ensembl Human
Match: IFT52 (intraflagellar transport 52 [Source:HGNC Symbol;Acc:HGNC:15901])

HSP 1 Score: 427.943 bits (1099), Expect = 8.673e-146
Identity = 227/415 (54.70%), Postives = 321/415 (77.35%), Query Frame = 2
Query:  107 IVFNISKNEIFNINSNYKEFHKRLKSSWKVITNEDEITAENLSLSKLMIIACPKDKFSIAEFNAMKCYIESGGSILVLMEENGEAKYNNNINYFLEQYGISVNNDAVIRTCYYKYFHPKEALIPNGVLNRALGEAAGKAPLVVMEDDSS--HKQSLQFLYPYGCTVNIVKPAIALLSSGSVSFPQNRPVCGYFRSKEDNGGRLMVIGSGHMFSDAYIVKEENIKLLEVIMQILTTDEITLNSIDATDPDISDYFQSPDIASLADELKCCLQESEEVPRDFDSLFDNSLYIMDTNLVPKALESYDSLKVKHEALTLITPQFEXXXXXXXXXXXXXXXKXXXXXXXXXXXXXXXXSTEKVRLAQLTNKCTENDLEYYVRECGEILGVSNRIAEEKRSAKSILEYIFHQLVEFKKVNR 1345
            I+FN  K EIF  N+ YK   K+L+S+WK+ + +DEIT+E L+  KL I A P++KF+ AEF  +K Y+++GG + V++ E GE++++ NIN+ LE+YGI VNNDAV+R  Y+KYFHPKEAL+ +GVLNR +  AAGKA   +++++SS  + Q+L F+YP+G T++++KPA+A+LS+GSV FP NRP+  ++ SK + GG+L V+GS HMFSD Y+ KEEN K+++V+ Q LTT +I LN IDA DP+ISDY   P  A+L+   + CLQES+E+PRDF +LFD S++ +DT      +E+++ L VKHE L LI PQFETPLP LQPAVFPP+F+EL  P L+LFDLDE FS+EK RLAQ+TNKCTE DLE+YVR+CG+ILGV++++ ++++ AK ILE++F Q+VEFKK+N+
Sbjct:    9 ILFNAYKKEIFTTNNGYKSMQKKLRSNWKIQSLKDEITSEKLNGVKLWITAGPREKFTAAEFEILKKYLDTGGDVFVMLGEGGESRFDTNINFLLEEYGIMVNNDAVVRNVYHKYFHPKEALVSSGVLNREISRAAGKAVPGIIDEESSGNNAQALTFVYPFGATLSVMKPAVAVLSTGSVCFPLNRPILAFYHSK-NQGGKLAVLGSCHMFSDQYLDKEENSKIMDVVFQWLTTGDIHLNQIDAEDPEISDYMMLPYTATLSKRNRECLQESDEIPRDFTTLFDLSIFQLDTTSFHSVIEAHEQLNVKHEPLQLIQPQFETPLPTLQPAVFPPSFRELPPPPLELFDLDETFSSEKARLAQITNKCTEEDLEFYVRKCGDILGVTSKLPKDQQDAKHILEHVFFQVVEFKKLNQ 422          
BLAST of Intraflagellar transport protein 52 vs. Ensembl Human
Match: IFT52 (intraflagellar transport 52 [Source:HGNC Symbol;Acc:HGNC:15901])

HSP 1 Score: 427.943 bits (1099), Expect = 8.673e-146
Identity = 227/415 (54.70%), Postives = 321/415 (77.35%), Query Frame = 2
Query:  107 IVFNISKNEIFNINSNYKEFHKRLKSSWKVITNEDEITAENLSLSKLMIIACPKDKFSIAEFNAMKCYIESGGSILVLMEENGEAKYNNNINYFLEQYGISVNNDAVIRTCYYKYFHPKEALIPNGVLNRALGEAAGKAPLVVMEDDSS--HKQSLQFLYPYGCTVNIVKPAIALLSSGSVSFPQNRPVCGYFRSKEDNGGRLMVIGSGHMFSDAYIVKEENIKLLEVIMQILTTDEITLNSIDATDPDISDYFQSPDIASLADELKCCLQESEEVPRDFDSLFDNSLYIMDTNLVPKALESYDSLKVKHEALTLITPQFEXXXXXXXXXXXXXXXKXXXXXXXXXXXXXXXXSTEKVRLAQLTNKCTENDLEYYVRECGEILGVSNRIAEEKRSAKSILEYIFHQLVEFKKVNR 1345
            I+FN  K EIF  N+ YK   K+L+S+WK+ + +DEIT+E L+  KL I A P++KF+ AEF  +K Y+++GG + V++ E GE++++ NIN+ LE+YGI VNNDAV+R  Y+KYFHPKEAL+ +GVLNR +  AAGKA   +++++SS  + Q+L F+YP+G T++++KPA+A+LS+GSV FP NRP+  ++ SK + GG+L V+GS HMFSD Y+ KEEN K+++V+ Q LTT +I LN IDA DP+ISDY   P  A+L+   + CLQES+E+PRDF +LFD S++ +DT      +E+++ L VKHE L LI PQFETPLP LQPAVFPP+F+EL  P L+LFDLDE FS+EK RLAQ+TNKCTE DLE+YVR+CG+ILGV++++ ++++ AK ILE++F Q+VEFKK+N+
Sbjct:    9 ILFNAYKKEIFTTNNGYKSMQKKLRSNWKIQSLKDEITSEKLNGVKLWITAGPREKFTAAEFEILKKYLDTGGDVFVMLGEGGESRFDTNINFLLEEYGIMVNNDAVVRNVYHKYFHPKEALVSSGVLNREISRAAGKAVPGIIDEESSGNNAQALTFVYPFGATLSVMKPAVAVLSTGSVCFPLNRPILAFYHSK-NQGGKLAVLGSCHMFSDQYLDKEENSKIMDVVFQWLTTGDIHLNQIDAEDPEISDYMMLPYTATLSKRNRECLQESDEIPRDFTTLFDLSIFQLDTTSFHSVIEAHEQLNVKHEPLQLIQPQFETPLPTLQPAVFPPSFRELPPPPLELFDLDETFSSEKARLAQITNKCTEEDLEFYVRKCGDILGVTSKLPKDQQDAKHILEHVFFQVVEFKKLNQ 422          
BLAST of Intraflagellar transport protein 52 vs. Ensembl Celegans
Match: osm-6 (Osm-6 protein [Source:UniProtKB/TrEMBL;Acc:G5EDF6])

HSP 1 Score: 256.529 bits (654), Expect = 4.395e-79
Identity = 167/426 (39.20%), Postives = 262/426 (61.50%), Query Frame = 2
Query:   80 IKNFSVGKNIVFNISKNEIFNINSNYKEFHKRLKSSWKVITNEDEITAENLSLSKLMIIACPKDKFSIAEFNAMKCYIESGGSILVLMEENGEAKYNNNINYFLEQYGISVNNDAVIRTCYYKYFHPKEALIPNGVLNRALGEAAGKAPLVVMEDDSSHKQSLQFLYPYGCTVNI-VKPAIALLSSGSVSFPQNRPVCGYFRSKED---NGGRLMVIGSGHMFSDAYIVKEENIKLLEVIMQILTTDEITLNSIDATDPDISDYFQSPDIASLADELKCCLQESE---EVPRDFDSLFDNSLYIMDTNLVPKALESYDSLKVKHEALTLITPQFEXXXXXXXXXXXXXXXKXXXXXXXXXXXXXXXXSTEKVRLAQLTNKCTENDLEYYVRECGEILGVSNRIAEEKRSAKSILEYIFHQLVEFKK 1336
            + N S+G+ ++ + SK +  ++ S ++   + LKS   V  N + I    L   +++II  PK  F   E  A+  ++E GGS+++L  E GE +   ++N  + +YGI+VN D+VIRT + KYF PKEAL+ NGV+NRA+  AA K    V  +   + Q+L F+YPYGCT+++  + +  +LSSGS SFP +RPV  +  +K +     GR+ V+GS  MF D YI KEEN K+ +  ++ L  + + LN+IDA +P+I+DY   PD   ++ ++K C+ E E    +  DF  + D SL+  +    P  +  Y++L +    LTL+ PQFE P+PP QPAVFPPTF+EL  P L+LFDLDE+FS+ +++L+QL N+  E DL +++ + GEI G+S  +   +R+ K I+E    +L+ FK+
Sbjct:    9 MTNRSIGRKVLIDQSKQQQISLISGFRGVARHLKSVLTVEINTEPINLNGLEDVRMLIIPQPKTSFGTGEIEAIWKFVEEGGSLMILSGEGGERQ---SLNEMIAKYGITVNKDSVIRTVFLKYFDPKEALVANGVINRAIAVAAKKN---VSTEQKHNSQALSFIYPYGCTLDVNNRMSNVVLSSGSTSFPTSRPVAAFHETKLNEMKKKGRVCVVGSVSMFHDTYIDKEENGKIFDTFVEFL-VNGLELNTIDAAEPEINDYTNIPDHIHMSQQIKVCMYEGELDQAISSDFMKIMDTSLHSFNLKHWPMTIRLYEALNLSPPPLTLVEPQFELPMPPFQPAVFPPTFQELPMPPLELFDLDEQFSSPEIQLSQLANRSEEEDLIFFIEKAGEITGISAELTRSERTPKKIIELAVSKLMLFKR 427          
BLAST of Intraflagellar transport protein 52 vs. Ensembl Fly
Match: IFT52 (gene:FBgn0031829 transcript:FBtr0079333)

HSP 1 Score: 248.825 bits (634), Expect = 7.729e-77
Identity = 154/407 (37.84%), Postives = 245/407 (60.20%), Query Frame = 2
Query:  167 HKRLKSSWKVITNEDEITAENLSLSKLMIIACPKDKFSIAEFNAMKCYIE-SGGSILVLMEENGEAKYNNNINYFLEQYGISVNNDAVIRTCYYKYFHPKEALIPNGVLNRALGEAAGKAPL-VVMEDDSSHKQSLQFLYPYGCTVNIVKPAIALLSSGSVSFPQNRPVCGYFRSKEDNGGRLMVIGSGHMFSDAYIVKEENIKLLEVIMQILTTDEITLNSIDATDPDISDYFQSPDIASLADELKCCLQES--EEVPRDFDSLFDNSLYIMDTNLVPKALESYDSLKVKHEALTLITPQFEXXXXXXXXXXXXXXXKXXXXXXXXXXXXXXXXSTEKVRLAQLTNKC--------------TENDLEYYVRECGEILGVSNRIAEEKRSAKSILEYIFHQLVEFK 1333
            H++LK +W V  N+ E+  E L+  K+ ++A P+D+F+  EF+ +K Y+E  GGS++VL+ E GE ++N N+N+FLEQYGI +N D V+R  YYK FHPKE ++  GV+  ++     K  +  V  D S  K  + F YPYG T+N+ +PA  LL++G V +P NRP+ GYF + +  GG+++ +GSG+++ D Y+  + N  + E ++++L  DEIT + +D  D ++SD     DI  LAD  K CL +S   ++P DF  +FD  L  +   L+   +++Y+ L VK+E L +I PQFE PLP +Q A FPP F E  AP L+L+DLDE FS  + +LA +T +                + +LE Y++EC  I  + +    +  +A+ IL  +  Q++ ++
Sbjct:    3 HRKLKVNWNVEQNDAELRMERLARVKIFVLAGPQDRFTEDEFDVLKHYVEVQGGSLVVLLGEGGEPEFNTNVNFFLEQYGIYINGDTVVRPHYYKNFHPKECIVGGGVVCESMWRHLLKLDIEKVYYDFSDEKYKIHFQYPYGATLNVSEPANVLLTTGPVVYPFNRPLVGYFTNGK--GGKILAVGSGYIWHDKYLQDKTNDAMFEYLIKLLGGDEITYSHLDFNDVELSDNKHFTDIGFLADMPKACLIDSIGTDMPTDFKQMFDMRLCRLSNRLLKDVMDTYEQLHVKYEPLKIIKPQFEIPLPNVQLATFPPIFSEPSAPPLELYDLDETFSGARSQLAHMTGQVLQALQSKEPQRRALNQRELENYIKECARITAIVDE--RQDMAAREILNIVARQIISYR 405          
BLAST of Intraflagellar transport protein 52 vs. Ensembl Zebrafish
Match: ift52 (intraflagellar transport 52 homolog (Chlamydomonas) [Source:ZFIN;Acc:ZDB-GENE-040614-3])

HSP 1 Score: 445.277 bits (1144), Expect = 7.786e-153
Identity = 238/414 (57.49%), Postives = 316/414 (76.33%), Query Frame = 2
Query:  107 IVFNISKNEIFNINSNYKEFHKRLKSSWKVITNEDEITAENLSLSKLMIIACPKDKFSIAEFNAMKCYIESGGSILVLMEENGEAKYNNNINYFLEQYGISVNNDAVIRTCYYKYFHPKEALIPNGVLNRALGEAAGKAPLVVMEDDSS--HKQSLQFLYPYGCTVNIVKPAIALLSSGSVSFPQNRPVCGYFRSKEDNGGRLMVIGSGHMFSDAYIVKEENIKLLEVIMQILTTDEITLNSIDATDPDISDYFQSPDIASLADELKCCLQESEEVPRDFDSLFDNSLYIMDTNLVPKALESYDSLKVKHEALTLITPQFEXXXXXXXXXXXXXXXKXXXXXXXXXXXXXXXXSTEKVRLAQLTNKCTENDLEYYVRECGEILGVSNRIAEEKRSAKSILEYIFHQLVEFKKVN 1342
            +VFN SK E+F  +S YK   K+L++ WK+ + ++E+T E L   KL I A P++KF+ AE   +K Y++SGG++LV++ E GE KY+ NIN+ LE++GI VNNDAVIR  YYKYFHPKEAL+ NGVLNR +  AAGK    V++++++  + Q+L F+YPYG T+N++KPA+A+LS+GSV FP NRPV  +  SK  N G+L V+GS HMFSD Y+ KEEN ++++V+ Q LTTD I LN IDA DP+I+DY   PD  SL++ L+ CLQE +E PRDF SLFD SL  + TN +P  L++Y  L VKHEAL LITPQFETPLPPLQPAVF P F++L  P LDLFDLDE FS+EKVRLAQL+NKCT++DLE+YVR+CG+ILGV+  + ++KR AK ILE++F Q+VEFKK+N
Sbjct:    9 VVFNASKRELFTSSSGYKSLQKKLRAQWKIQSIKEELTLEKLQGVKLWITAGPREKFTAAELEVLKQYLDSGGALLVMLGEGGELKYDTNINFLLEEFGIMVNNDAVIRNVYYKYFHPKEALVSNGVLNREISRAAGKVVTGVIDEENTGNNSQALTFVYPYGATLNVMKPAVAILSTGSVCFPLNRPVLAFHHSK--NAGKLAVLGSCHMFSDQYLDKEENSRIMDVVFQWLTTDSIHLNQIDAEDPEITDYMMLPDTGSLSERLRVCLQEGDENPRDFTSLFDMSLLKLHTNTLPSVLDAYKQLNVKHEALQLITPQFETPLPPLQPAVFQPAFRDLPPPMLDLFDLDETFSSEKVRLAQLSNKCTDDDLEFYVRKCGDILGVTGNLDKDKRDAKHILEHVFFQVVEFKKLN 420          
BLAST of Intraflagellar transport protein 52 vs. Ensembl Xenopus
Match: ascl2 (achaete-scute family bHLH transcription factor 2 [Source:Xenbase;Acc:XB-GENE-6458615])

HSP 1 Score: 440.654 bits (1132), Expect = 1.242e-150
Identity = 238/419 (56.80%), Postives = 326/419 (77.80%), Query Frame = 2
Query:   95 VGKNIVFNISKNEIFNINSNYKEFHKRLKSSWKVITNEDEITAENLSLSKLMIIACPKDKFSIAEFNAMKCYIESGGSILVLMEENGEAKYNNNINYFLEQYGISVNNDAVIRTCYYKYFHPKEALIPNGVLNRALGEAAGKAPLVVMEDDSS--HKQSLQFLYPYGCTVNIVKPAIALLSSGSVSFPQNRPVCGYFRSKEDNGGRLMVIGSGHMFSDAYIVKEENIKLLEVIMQILTTDEITLNSIDATDPDISDYFQSPDIASLADELKCCLQESEEVPRDFDSLFDNSLYIMDTNLVPKALESYDSLKVKHEALTLITPQFEXXXXXXXXXXXXXXXKXXXXXXXXXXXXXXXXSTEKVRLAQLTNKCTENDLEYYVRECGEILGVSNRIAEEKRSAKSILEYIFHQLVEFKKVNR 1345
            + K IV + SK E F + S YK   KRL+ +WK+ + +DEITAE L   KL I A P++KF+ AEF  +K ++E GG ILV++ E GE++++ NIN+ LE+YGI VNND+V+R  YYKYFHPKEAL+ NGVLNR +  AAGK   ++++DDS+  + ++L F+YP+G T+N++KPA+A+LS+GSV FP NRP+  +++SK  + G+L V+GS HMFSD Y+ KEEN K+L+V+MQ LTT +ITLN IDA DP+ISDY   P+   L+  ++ CLQE +E+PRDF +LFD S++ +DT+ + K ++SY+ L VKHE L LI PQFETPLP LQPAVFPP+F+EL APALDLFDLDE FS+EK RLAQ+TN+CTE+DLE+YVR+CG+ILGV++ + +E++ AK ILEYIF Q+VEFKK+N+
Sbjct:   22 IRKTIVLSASKRE-FTVTSGYKSLQKRLRGNWKIQSIKDEITAEKLVGVKLWITAGPREKFTAAEFEVLKQFLEGGGDILVMLGEGGESRHDTNINFLLEEYGIMVNNDSVVRNVYYKYFHPKEALVSNGVLNREISRAAGKDVSMIIDDDSTGNNSKALTFVYPFGATLNVMKPAMAVLSTGSVCFPLNRPIMAFYQSKM-HSGKLAVLGSCHMFSDHYLDKEENTKILDVLMQWLTTTDITLNQIDAEDPEISDYTMLPNTNKLSQRVRVCLQEGDEIPRDFTTLFDMSIFQLDTSSLAKVIKSYEQLNVKHETLQLIQPQFETPLPALQPAVFPPSFRELPAPALDLFDLDENFSSEKARLAQITNRCTEDDLEFYVRKCGDILGVTSNLPKEEQDAKHILEYIFFQVVEFKKLNQ 438          
BLAST of Intraflagellar transport protein 52 vs. Ensembl Xenopus
Match: ascl2 (achaete-scute family bHLH transcription factor 2 [Source:Xenbase;Acc:XB-GENE-6458615])

HSP 1 Score: 431.024 bits (1107), Expect = 2.970e-147
Identity = 233/410 (56.83%), Postives = 319/410 (77.80%), Query Frame = 2
Query:  122 SKNEIFNINSNYKEFHKRLKSSWKVITNEDEITAENLSLSKLMIIACPKDKFSIAEFNAMKCYIESGGSILVLMEENGEAKYNNNINYFLEQYGISVNNDAVIRTCYYKYFHPKEALIPNGVLNRALGEAAGKAPLVVMEDDSS--HKQSLQFLYPYGCTVNIVKPAIALLSSGSVSFPQNRPVCGYFRSKEDNGGRLMVIGSGHMFSDAYIVKEENIKLLEVIMQILTTDEITLNSIDATDPDISDYFQSPDIASLADELKCCLQESEEVPRDFDSLFDNSLYIMDTNLVPKALESYDSLKVKHEALTLITPQFEXXXXXXXXXXXXXXXKXXXXXXXXXXXXXXXXSTEKVRLAQLTNKCTENDLEYYVRECGEILGVSNRIAEEKRSAKSILEYIFHQLVEFKKVNR 1345
            S N+I      YK   KRL+ +WK+ + +DEITAE L   KL I A P++KF+ AEF  +K ++E GG ILV++ E GE++++ NIN+ LE+YGI VNND+V+R  YYKYFHPKEAL+ NGVLNR +  AAGK   ++++DDS+  + ++L F+YP+G T+N++KPA+A+LS+GSV FP NRP+  +++SK  + G+L V+GS HMFSD Y+ KEEN K+L+V+MQ LTT +ITLN IDA DP+ISDY   P+   L+  ++ CLQE +E+PRDF +LFD S++ +DT+ + K ++SY+ L VKHE L LI PQFETPLP LQPAVFPP+F+EL APALDLFDLDE FS+EK RLAQ+TN+CTE+DLE+YVR+CG+ILGV++ + +E++ AK ILEYIF Q+VEFKK+N+
Sbjct:    2 SDNDIRKTIVGYKSLQKRLRGNWKIQSIKDEITAEKLVGVKLWITAGPREKFTAAEFEVLKQFLEGGGDILVMLGEGGESRHDTNINFLLEEYGIMVNNDSVVRNVYYKYFHPKEALVSNGVLNREISRAAGKDVSMIIDDDSTGNNSKALTFVYPFGATLNVMKPAMAVLSTGSVCFPLNRPIMAFYQSKM-HSGKLAVLGSCHMFSDHYLDKEENTKILDVLMQWLTTTDITLNQIDAEDPEISDYTMLPNTNKLSQRVRVCLQEGDEIPRDFTTLFDMSIFQLDTSSLAKVIKSYEQLNVKHETLQLIQPQFETPLPALQPAVFPPSFRELPAPALDLFDLDENFSSEKARLAQITNRCTEDDLEFYVRKCGDILGVTSNLPKEEQDAKHILEYIFFQVVEFKKLNQ 410          
BLAST of Intraflagellar transport protein 52 vs. Ensembl Xenopus
Match: ascl2 (achaete-scute family bHLH transcription factor 2 [Source:Xenbase;Acc:XB-GENE-6458615])

HSP 1 Score: 389.037 bits (998), Expect = 5.084e-131
Identity = 212/420 (50.48%), Postives = 295/420 (70.24%), Query Frame = 2
Query:  122 SKNEIFNINSNYKEFHKRLKSSWKVITNEDEITAENLSLSKLMIIACPKDKFSIAEFNAMKCYIESGGSILVLMEENGEAKYNNNINYFLEQYGISVNNDAVIRTCYYKYFHPKEALIPNGVLNRALGEAAGKAPLVVMEDDSS--HKQSLQFLYPYGCTVNIVKPAIALLSSGSVSFPQNRPVCGYFRSKEDNGGRLMVIGSGHMFSDAYIVKEENIKLLEVIMQILTTDEITLNSIDATDPDISDYFQSPDIASLADELKCCLQESEEVPRDFDSLFDNSLYIMDTNLVP----------KALESYDSLKVKHEALTLITPQFEXXXXXXXXXXXXXXXKXXXXXXXXXXXXXXXXSTEKVRLAQLTNKCTENDLEYYVRECGEILGVSNRIAEEKRSAKSILEYIFHQLVEFKKVNR 1345
            S N+I      YK   KRL+ +WK+ + +DEITAE L   KL I A P++KF+ AEF  +K ++E GG ILV++ E GE++++ NIN+ LE+YGI VNND+V+R  YYKYFHPKEAL+ NGVLNR +  AAGK   ++++DDS+  + ++L F+YP+G T+N++KPA+A+LS+GSV FP NRP+  +++SK  + G+L V+GS HMFSD Y+ KEEN K+L+V+MQ LTT +ITLN IDA DP+ISDY   P+   L+  ++ CLQE +E+PRDF +LFD S++   T+ +P             E  D+  V   AL +  P F                +EL APALDLFDLDE FS+EK RLAQ+TN+CTE+DLE+YVR+CG+ILGV++ + +E++ AK ILEYIF Q+VEFKK+N+
Sbjct:    1 SDNDIRKTIVGYKSLQKRLRGNWKIQSIKDEITAEKLVGVKLWITAGPREKFTAAEFEVLKQFLEGGGDILVMLGEGGESRHDTNINFLLEEYGIMVNNDSVVRNVYYKYFHPKEALVSNGVLNREISRAAGKDVSMIIDDDSTGNNSKALTFVYPFGATLNVMKPAMAVLSTGSVCFPLNRPIMAFYQSKM-HSGKLAVLGSCHMFSDHYLDKEENTKILDVLMQWLTTTDITLNQIDAEDPEISDYTMLPNTNKLSQRVRVCLQEGDEIPRDFTTLFDMSIF--QTHRLPFWPGAEWQIFLLSEPTDTFFV---ALQVFPPSF----------------RELPAPALDLFDLDENFSSEKARLAQITNRCTEDDLEFYVRKCGDILGVTSNLPKEEQDAKHILEYIFFQVVEFKKLNQ 398          
BLAST of Intraflagellar transport protein 52 vs. Ensembl Mouse
Match: Ift52 (intraflagellar transport 52 [Source:MGI Symbol;Acc:MGI:2387217])

HSP 1 Score: 444.506 bits (1142), Expect = 1.124e-152
Identity = 233/416 (56.01%), Postives = 323/416 (77.64%), Query Frame = 2
Query:  104 NIVFNISKNEIFNINSNYKEFHKRLKSSWKVITNEDEITAENLSLSKLMIIACPKDKFSIAEFNAMKCYIESGGSILVLMEENGEAKYNNNINYFLEQYGISVNNDAVIRTCYYKYFHPKEALIPNGVLNRALGEAAGKA-PLVVMEDDSSH-KQSLQFLYPYGCTVNIVKPAIALLSSGSVSFPQNRPVCGYFRSKEDNGGRLMVIGSGHMFSDAYIVKEENIKLLEVIMQILTTDEITLNSIDATDPDISDYFQSPDIASLADELKCCLQESEEVPRDFDSLFDNSLYIMDTNLVPKALESYDSLKVKHEALTLITPQFEXXXXXXXXXXXXXXXKXXXXXXXXXXXXXXXXSTEKVRLAQLTNKCTENDLEYYVRECGEILGVSNRIAEEKRSAKSILEYIFHQLVEFKKVNR 1345
             I+FN  K E+F  N+ YK   KRL+S+WK+ + +DEIT+E L   KL I A P++KF+ AEF  +K Y++SGG ILV++ E GE++++ NIN+ LE+YGI VNNDAV+R  YYKYFHPKEAL+ +GVLNR +  AAGKA P V+ E++S +  Q+L F+YP+G T++++KPA+A+LS+GSV FP NRP+  ++ SK    G+L V+GS HMFSD Y+ KEEN K+++V+ Q LTT +I LN IDA DP+ISDY   PD A+L+++L+ CLQE +E PRDF +LFD S+Y +DT  +PK +++++ L VKHE L L+ PQFE PLP LQPAVFPP+F+EL  P L+LFDLDE FS+EK RLAQ+TNKCT+ DLE+YVR+CG+ILGV++++ ++++ AK ILE+IF Q+VEFKK+N+
Sbjct:    8 TILFNAYKKEVFTTNTGYKSLQKRLRSNWKIQSLKDEITSEKLIGVKLWITAGPREKFTAAEFEVLKKYLDSGGDILVMLGEGGESRFDTNINFLLEEYGIMVNNDAVVRNVYYKYFHPKEALVSDGVLNREISRAAGKAVPGVIDEENSGNNAQALTFVYPFGATLSVMKPAVAVLSTGSVCFPLNRPILAFYHSKNQGFGKLAVLGSCHMFSDQYLDKEENSKIMDVVFQWLTTGDIHLNQIDAEDPEISDYTMVPDTATLSEQLRVCLQEGDENPRDFTTLFDLSIYQLDTTCLPKVIKAHEELNVKHEPLQLVQPQFEMPLPALQPAVFPPSFRELPPPPLELFDLDETFSSEKARLAQITNKCTDEDLEFYVRKCGDILGVTSKLPKDQQDAKHILEHIFFQVVEFKKLNQ 423          
BLAST of Intraflagellar transport protein 52 vs. Ensembl Mouse
Match: Ift52 (intraflagellar transport 52 [Source:MGI Symbol;Acc:MGI:2387217])

HSP 1 Score: 261.151 bits (666), Expect = 1.001e-83
Identity = 121/226 (53.54%), Postives = 170/226 (75.22%), Query Frame = 2
Query:  107 IVFNISKNEIFNINSNYKEFHKRLKSSWKVITNEDEITAENLSLSKLMIIACPKDKFSIAEFNAMKCYIESGGSILVLMEENGEAKYNNNINYFLEQYGISVNNDAVIRTCYYKYFHPKEALIPNGVLNRALGEAAGKA-PLVVMEDDSS-HKQSLQFLYPYGCTVNIVKPAIALLSSGSVSFPQNRPVCGYFRSKEDNGGRLMVIGSGHMFSDAYIVKEENIKLL 778
            I+FN  K E+F  N+ YK   KRL+S+WK+ + +DEIT+E L   KL I A P++KF+ AEF  +K Y++SGG ILV++ E GE++++ NIN+ LE+YGI VNNDAV+R  YYKYFHPKEAL+ +GVLNR +  AAGKA P V+ E++S  + Q+L F+YP+G T++++KPA+A+LS+GSV FP NRP+  ++ SK    G+L V+GS HMFSD Y+ KEEN K++
Sbjct:    9 ILFNAYKKEVFTTNTGYKSLQKRLRSNWKIQSLKDEITSEKLIGVKLWITAGPREKFTAAEFEVLKKYLDSGGDILVMLGEGGESRFDTNINFLLEEYGIMVNNDAVVRNVYYKYFHPKEALVSDGVLNREISRAAGKAVPGVIDEENSGNNAQALTFVYPFGATLSVMKPAVAVLSTGSVCFPLNRPILAFYHSKNQGFGKLAVLGSCHMFSDQYLDKEENSKIM 234          
BLAST of Intraflagellar transport protein 52 vs. UniProt/SwissProt
Match: sp|Q62559|IFT52_MOUSE (Intraflagellar transport protein 52 homolog OS=Mus musculus OX=10090 GN=Ift52 PE=1 SV=2)

HSP 1 Score: 444.506 bits (1142), Expect = 7.863e-152
Identity = 233/416 (56.01%), Postives = 323/416 (77.64%), Query Frame = 2
Query:  104 NIVFNISKNEIFNINSNYKEFHKRLKSSWKVITNEDEITAENLSLSKLMIIACPKDKFSIAEFNAMKCYIESGGSILVLMEENGEAKYNNNINYFLEQYGISVNNDAVIRTCYYKYFHPKEALIPNGVLNRALGEAAGKA-PLVVMEDDSSH-KQSLQFLYPYGCTVNIVKPAIALLSSGSVSFPQNRPVCGYFRSKEDNGGRLMVIGSGHMFSDAYIVKEENIKLLEVIMQILTTDEITLNSIDATDPDISDYFQSPDIASLADELKCCLQESEEVPRDFDSLFDNSLYIMDTNLVPKALESYDSLKVKHEALTLITPQFEXXXXXXXXXXXXXXXKXXXXXXXXXXXXXXXXSTEKVRLAQLTNKCTENDLEYYVRECGEILGVSNRIAEEKRSAKSILEYIFHQLVEFKKVNR 1345
             I+FN  K E+F  N+ YK   KRL+S+WK+ + +DEIT+E L   KL I A P++KF+ AEF  +K Y++SGG ILV++ E GE++++ NIN+ LE+YGI VNNDAV+R  YYKYFHPKEAL+ +GVLNR +  AAGKA P V+ E++S +  Q+L F+YP+G T++++KPA+A+LS+GSV FP NRP+  ++ SK    G+L V+GS HMFSD Y+ KEEN K+++V+ Q LTT +I LN IDA DP+ISDY   PD A+L+++L+ CLQE +E PRDF +LFD S+Y +DT  +PK +++++ L VKHE L L+ PQFE PLP LQPAVFPP+F+EL  P L+LFDLDE FS+EK RLAQ+TNKCT+ DLE+YVR+CG+ILGV++++ ++++ AK ILE+IF Q+VEFKK+N+
Sbjct:    8 TILFNAYKKEVFTTNTGYKSLQKRLRSNWKIQSLKDEITSEKLIGVKLWITAGPREKFTAAEFEVLKKYLDSGGDILVMLGEGGESRFDTNINFLLEEYGIMVNNDAVVRNVYYKYFHPKEALVSDGVLNREISRAAGKAVPGVIDEENSGNNAQALTFVYPFGATLSVMKPAVAVLSTGSVCFPLNRPILAFYHSKNQGFGKLAVLGSCHMFSDQYLDKEENSKIMDVVFQWLTTGDIHLNQIDAEDPEISDYTMVPDTATLSEQLRVCLQEGDENPRDFTTLFDLSIYQLDTTCLPKVIKAHEELNVKHEPLQLVQPQFEMPLPALQPAVFPPSFRELPPPPLELFDLDETFSSEKARLAQITNKCTDEDLEFYVRKCGDILGVTSKLPKDQQDAKHILEHIFFQVVEFKKLNQ 423          
BLAST of Intraflagellar transport protein 52 vs. UniProt/SwissProt
Match: sp|Q9Y366|IFT52_HUMAN (Intraflagellar transport protein 52 homolog OS=Homo sapiens OX=9606 GN=IFT52 PE=1 SV=3)

HSP 1 Score: 427.943 bits (1099), Expect = 4.165e-145
Identity = 227/415 (54.70%), Postives = 321/415 (77.35%), Query Frame = 2
Query:  107 IVFNISKNEIFNINSNYKEFHKRLKSSWKVITNEDEITAENLSLSKLMIIACPKDKFSIAEFNAMKCYIESGGSILVLMEENGEAKYNNNINYFLEQYGISVNNDAVIRTCYYKYFHPKEALIPNGVLNRALGEAAGKAPLVVMEDDSS--HKQSLQFLYPYGCTVNIVKPAIALLSSGSVSFPQNRPVCGYFRSKEDNGGRLMVIGSGHMFSDAYIVKEENIKLLEVIMQILTTDEITLNSIDATDPDISDYFQSPDIASLADELKCCLQESEEVPRDFDSLFDNSLYIMDTNLVPKALESYDSLKVKHEALTLITPQFEXXXXXXXXXXXXXXXKXXXXXXXXXXXXXXXXSTEKVRLAQLTNKCTENDLEYYVRECGEILGVSNRIAEEKRSAKSILEYIFHQLVEFKKVNR 1345
            I+FN  K EIF  N+ YK   K+L+S+WK+ + +DEIT+E L+  KL I A P++KF+ AEF  +K Y+++GG + V++ E GE++++ NIN+ LE+YGI VNNDAV+R  Y+KYFHPKEAL+ +GVLNR +  AAGKA   +++++SS  + Q+L F+YP+G T++++KPA+A+LS+GSV FP NRP+  ++ SK + GG+L V+GS HMFSD Y+ KEEN K+++V+ Q LTT +I LN IDA DP+ISDY   P  A+L+   + CLQES+E+PRDF +LFD S++ +DT      +E+++ L VKHE L LI PQFETPLP LQPAVFPP+F+EL  P L+LFDLDE FS+EK RLAQ+TNKCTE DLE+YVR+CG+ILGV++++ ++++ AK ILE++F Q+VEFKK+N+
Sbjct:    9 ILFNAYKKEIFTTNNGYKSMQKKLRSNWKIQSLKDEITSEKLNGVKLWITAGPREKFTAAEFEILKKYLDTGGDVFVMLGEGGESRFDTNINFLLEEYGIMVNNDAVVRNVYHKYFHPKEALVSSGVLNREISRAAGKAVPGIIDEESSGNNAQALTFVYPFGATLSVMKPAVAVLSTGSVCFPLNRPILAFYHSK-NQGGKLAVLGSCHMFSDQYLDKEENSKIMDVVFQWLTTGDIHLNQIDAEDPEISDYMMLPYTATLSKRNRECLQESDEIPRDFTTLFDLSIFQLDTTSFHSVIEAHEQLNVKHEPLQLIQPQFETPLPTLQPAVFPPSFRELPPPPLELFDLDETFSSEKARLAQITNKCTEEDLEFYVRKCGDILGVTSKLPKDQQDAKHILEHVFFQVVEFKKLNQ 422          
BLAST of Intraflagellar transport protein 52 vs. TrEMBL
Match: A0A4E0RN13 (Intraflagellar transport protein 52 OS=Fasciola hepatica OX=6192 GN=D915_006544 PE=4 SV=1)

HSP 1 Score: 491.886 bits (1265), Expect = 9.862e-168
Identity = 253/413 (61.26%), Postives = 332/413 (80.39%), Query Frame = 2
Query:  107 IVFNISKNEIFNINSNYKEFHKRLKSSWKVITNEDEITAENLSLSKLMIIACPKDKFSIAEFNAMKCYIESGGSILVLMEENGEAKYNNNINYFLEQYGISVNNDAVIRTCYYKYFHPKEALIPNGVLNRALGEAAGKAPLVVMEDDSSHKQSLQFLYPYGCTVNIVKPAIALLSSGSVSFPQNRPVCGYFRSKEDNGGRLMVIGSGHMFSDAYIVKEENIKLLEVIMQILTTDEITLNSIDATDPDISDYFQSPDIASLADELKCCLQESEEVPRDFDSLFDNSLYIMDTNLVPKALESYDSLKVKHEALTLITPQFEXXXXXXXXXXXXXXXKXXXXXXXXXXXXXXXXSTEKVRLAQLTNKCTENDLEYYVRECGEILGVSNRIAEEKRSAKSILEYIFHQLVEFKKVNR 1345
            IVFN +K E F +  ++KE  +RLK+SWK   N+++IT E L+ +K+ +I  P +KFS+AEFN +  Y+E+GG++LVLM ENGE+KY +NIN+ LEQYGI VN+DAV+RT Y+KYFHPKEALIPNG+LNRA+ EA GK+      +D  HKQ+LQF+YPYG T+N+ KPA A+LS+GSV+FP NRPVC   +S E  GG L V+GS  MF+D YIVKE+N+K+ EVI+  LT++ I LNSIDA DP+I  Y+Q PD+ SLA+ LK CLQES+E+P++   LFD +L+ MDTNLVP+AL++Y+ L+VKHEAL+LITPQFETPLPP+QPAVFPP F+E   PAL+LFDLDE+FST K RLAQ+TNKCTE+DLEY+VRECG+IL VS ++  EKR+A+ ILE +F++LVEFKK+N+
Sbjct:   16 IVFNQTKREAFTLTQHFKEVSRRLKTSWKFAINKEDITQEKLAAAKVFVICGPTEKFSVAEFNIINRYLENGGALLVLMGENGESKYTSNINFLLEQYGIMVNSDAVVRTSYFKYFHPKEALIPNGILNRAIVEATGKSTSGFSPEDVPHKQALQFVYPYGATLNVAKPATAILSTGSVAFPLNRPVCAVHKSHEFKGGSLAVVGSAAMFTDPYIVKEDNLKIFEVILNYLTSNTIKLNSIDAEDPEIETYYQVPDVTSLANSLKSCLQESDEIPQNVTQLFDQTLFTMDTNLVPRALDAYEKLRVKHEALSLITPQFETPLPPVQPAVFPPNFREPGPPALELFDLDEQFSTSKSRLAQVTNKCTEDDLEYFVRECGDILAVSRKLPAEKRTARVILEVVFNELVEFKKLNQ 428          
BLAST of Intraflagellar transport protein 52 vs. TrEMBL
Match: A0A2C9JHN6 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106065945 PE=4 SV=1)

HSP 1 Score: 488.804 bits (1257), Expect = 1.473e-166
Identity = 248/413 (60.05%), Postives = 346/413 (83.78%), Query Frame = 2
Query:  107 IVFNISKNEIFNINSNYKEFHKRLKSSWKVITNEDEITAENLSLSKLMIIACPKDKFSIAEFNAMKCYIESGGSILVLMEENGEAKYNNNINYFLEQYGISVNNDAVIRTCYYKYFHPKEALIPNGVLNRALGEAAGKAPLVVMEDDSSHKQSLQFLYPYGCTVNIVKPAIALLSSGSVSFPQNRPVCGYFRSKEDNGGRLMVIGSGHMFSDAYIVKEENIKLLEVIMQILTTDEITLNSIDATDPDISDYFQSPDIASLADELKCCLQESEEVPRDFDSLFDNSLYIMDTNLVPKALESYDSLKVKHEALTLITPQFEXXXXXXXXXXXXXXXKXXXXXXXXXXXXXXXXSTEKVRLAQLTNKCTENDLEYYVRECGEILGVSNRIAEEKRSAKSILEYIFHQLVEFKKVNR 1345
            I+F+ SK E+FN+N+  K  +++L+SSW+++ N+D+I+ + L+ ++L +I  P++KF+ AEF+A+K Y+ESGGS+LVL+ E GEA++  NIN+FLE++GI +NND+V+RT YYKYFHPKEAL+ NGVLNRA+ +AAGK      ++D ++ Q+L FLYPYG T+N+ KP++A+LS+G+V FP NRPVC  + S++   G+L V+GS HMFSD Y+ KEEN K+L+V++Q LTTD+I LN+IDA DP+I DY Q PDIA L+++LK CLQES+++PRD  +LFDNS++ +DT+LVPKA++SY+ LKVKHE LTLITPQFETPLPPL PAVFPP+F+EL APAL+LFDLDE+FS+EKVR+AQ+TNKC+++DLEYYVRECG+ILGV++ + +E R+AK ILE+IF Q+VEFKK+N+
Sbjct:   17 IIFSSSKKELFNVNNGLKTLNRKLRSSWRLVLNKDDISPDKLNQARLFVIPGPREKFTAAEFSALKAYVESGGSVLVLLGEGGEARFETNINFFLEEFGIMINNDSVVRTSYYKYFHPKEALVTNGVLNRAISQAAGKVSFGSGDEDGNNAQALSFLYPYGATLNVAKPSVAVLSTGTVCFPLNRPVCALYSSRQ-GKGKLAVLGSIHMFSDQYLEKEENSKILDVLIQFLTTDDIKLNAIDAEDPEIYDYCQLPDIARLSEQLKTCLQESDDIPRDITTLFDNSMFKLDTSLVPKAIKSYEELKVKHEPLTLITPQFETPLPPLTPAVFPPSFRELPAPALELFDLDEQFSSEKVRIAQITNKCSDDDLEYYVRECGDILGVTHNLPQESRTAKHILEHIFTQIVEFKKLNQ 428          
BLAST of Intraflagellar transport protein 52 vs. TrEMBL
Match: D2ILS6 (IFT52-like protein (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 480.715 bits (1236), Expect = 1.731e-166
Identity = 231/233 (99.14%), Postives = 232/233 (99.57%), Query Frame = 2
Query:  311 IESGGSILVLMEENGEAKYNNNINYFLEQYGISVNNDAVIRTCYYKYFHPKEALIPNGVLNRALGEAAGKAPLVVMEDDSSHKQSLQFLYPYGCTVNIVKPAIALLSSGSVSFPQNRPVCGYFRSKEDNGGRLMVIGSGHMFSDAYIVKEENIKLLEVIMQILTTDEITLNSIDATDPDISDYFQSPDIASLADELKCCLQESEEVPRDFDSLFDNSLYIMDTNLVPKALESY 1009
            IESGGSILVLMEENGEAKYNNNINYFLEQYGISVNNDAVIRTCYYKYFHPKEALIPNGVLNRALGEAAGK+PL VMEDDSSHKQSLQFLYPYGCTVNIVKPAIALLSSGSVSFPQNRPVCGYFRSKEDNGGRLMVIGSGHMFSDAYIVKEENIKLLEVIMQILTTDEITLNSIDATDPDISDYFQSPDIASLADELKCCLQESEEVPRDFDSLFDNSLYIMDTNLVPKALESY
Sbjct:    2 IESGGSILVLMEENGEAKYNNNINYFLEQYGISVNNDAVIRTCYYKYFHPKEALIPNGVLNRALGEAAGKSPLAVMEDDSSHKQSLQFLYPYGCTVNIVKPAIALLSSGSVSFPQNRPVCGYFRSKEDNGGRLMVIGSGHMFSDAYIVKEENIKLLEVIMQILTTDEITLNSIDATDPDISDYFQSPDIASLADELKCCLQESEEVPRDFDSLFDNSLYIMDTNLVPKALESY 234          
BLAST of Intraflagellar transport protein 52 vs. TrEMBL
Match: A0A2C9JHN7 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106065945 PE=4 SV=1)

HSP 1 Score: 488.804 bits (1257), Expect = 1.922e-166
Identity = 248/413 (60.05%), Postives = 346/413 (83.78%), Query Frame = 2
Query:  107 IVFNISKNEIFNINSNYKEFHKRLKSSWKVITNEDEITAENLSLSKLMIIACPKDKFSIAEFNAMKCYIESGGSILVLMEENGEAKYNNNINYFLEQYGISVNNDAVIRTCYYKYFHPKEALIPNGVLNRALGEAAGKAPLVVMEDDSSHKQSLQFLYPYGCTVNIVKPAIALLSSGSVSFPQNRPVCGYFRSKEDNGGRLMVIGSGHMFSDAYIVKEENIKLLEVIMQILTTDEITLNSIDATDPDISDYFQSPDIASLADELKCCLQESEEVPRDFDSLFDNSLYIMDTNLVPKALESYDSLKVKHEALTLITPQFEXXXXXXXXXXXXXXXKXXXXXXXXXXXXXXXXSTEKVRLAQLTNKCTENDLEYYVRECGEILGVSNRIAEEKRSAKSILEYIFHQLVEFKKVNR 1345
            I+F+ SK E+FN+N+  K  +++L+SSW+++ N+D+I+ + L+ ++L +I  P++KF+ AEF+A+K Y+ESGGS+LVL+ E GEA++  NIN+FLE++GI +NND+V+RT YYKYFHPKEAL+ NGVLNRA+ +AAGK      ++D ++ Q+L FLYPYG T+N+ KP++A+LS+G+V FP NRPVC  + S++   G+L V+GS HMFSD Y+ KEEN K+L+V++Q LTTD+I LN+IDA DP+I DY Q PDIA L+++LK CLQES+++PRD  +LFDNS++ +DT+LVPKA++SY+ LKVKHE LTLITPQFETPLPPL PAVFPP+F+EL APAL+LFDLDE+FS+EKVR+AQ+TNKC+++DLEYYVRECG+ILGV++ + +E R+AK ILE+IF Q+VEFKK+N+
Sbjct:   19 IIFSSSKKELFNVNNGLKTLNRKLRSSWRLVLNKDDISPDKLNQARLFVIPGPREKFTAAEFSALKAYVESGGSVLVLLGEGGEARFETNINFFLEEFGIMINNDSVVRTSYYKYFHPKEALVTNGVLNRAISQAAGKVSFGSGDEDGNNAQALSFLYPYGATLNVAKPSVAVLSTGTVCFPLNRPVCALYSSRQ-GKGKLAVLGSIHMFSDQYLEKEENSKILDVLIQFLTTDDIKLNAIDAEDPEIYDYCQLPDIARLSEQLKTCLQESDDIPRDITTLFDNSMFKLDTSLVPKAIKSYEELKVKHEPLTLITPQFETPLPPLTPAVFPPSFRELPAPALELFDLDEQFSSEKVRIAQITNKCSDDDLEYYVRECGDILGVTHNLPQESRTAKHILEHIFTQIVEFKKLNQ 430          
BLAST of Intraflagellar transport protein 52 vs. TrEMBL
Match: A0A4S2JBL0 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_011425 PE=4 SV=1)

HSP 1 Score: 485.723 bits (1249), Expect = 2.220e-165
Identity = 253/413 (61.26%), Postives = 328/413 (79.42%), Query Frame = 2
Query:  107 IVFNISKNEIFNINSNYKEFHKRLKSSWKVITNEDEITAENLSLSKLMIIACPKDKFSIAEFNAMKCYIESGGSILVLMEENGEAKYNNNINYFLEQYGISVNNDAVIRTCYYKYFHPKEALIPNGVLNRALGEAAGKAPLVVMEDDSSHKQSLQFLYPYGCTVNIVKPAIALLSSGSVSFPQNRPVCGYFRSKEDNGGRLMVIGSGHMFSDAYIVKEENIKLLEVIMQILTTDEITLNSIDATDPDISDYFQSPDIASLADELKCCLQESEEVPRDFDSLFDNSLYIMDTNLVPKALESYDSLKVKHEALTLITPQFEXXXXXXXXXXXXXXXKXXXXXXXXXXXXXXXXSTEKVRLAQLTNKCTENDLEYYVRECGEILGVSNRIAEEKRSAKSILEYIFHQLVEFKKVNR 1345
            +VFN +K E F +++N+KE  KR K+ WK I N+DEIT E L+++ + + A P +KFS AEF+ MK YIE+GGSILVLM ENGE KY  NIN+ LEQYGI VN+DAV+RT Y+KYFHPKEALIPNG+LNRA+ EAA ++      +D  HK ++QF+YPYG T+N+ KPAIALLS+GSV+FP NRPVC  ++++ D GG L V+GS  MFSDAY+ KE+N+K+LE+++  L+ D I LN IDA DP+I  Y Q PDI SLA+ LK CLQES+E+P++F  LF+  L+ MD +LVP+ALE+Y++L+VKHE L+LITPQFETPLPP+QPAVFPP F+E   P L+LFDLDE+FST K RLAQ+TNKCTE+DLEY+VRECG+IL VS +I  EKR A+ ILE IF++LVEFKK+++
Sbjct:   16 VVFNQTKKESFTLSANFKELSKRFKTFWKFIVNKDEITLERLNMANIFVTAGPTEKFSAAEFSVMKQYIENGGSILVLMGENGECKYPTNINFLLEQYGIMVNSDAVVRTSYFKYFHPKEALIPNGILNRAMAEAANRSIANSAIEDVPHKMAMQFVYPYGSTLNVAKPAIALLSTGSVAFPLNRPVCAVYKTEGDGGGALAVVGSAAMFSDAYVTKEDNLKILEILLNYLSNDAIKLNIIDAEDPEIEPYHQVPDITSLANNLKSCLQESDELPQNFAELFNQGLFNMDLSLVPRALEAYETLRVKHEPLSLITPQFETPLPPVQPAVFPPNFREPGPPPLELFDLDEQFSTSKARLAQVTNKCTEDDLEYFVRECGDILAVSRKIPSEKRCARVILEVIFNELVEFKKLSQ 428          
BLAST of Intraflagellar transport protein 52 vs. Ensembl Cavefish
Match: ift52 (intraflagellar transport 52 [Source:NCBI gene;Acc:103035753])

HSP 1 Score: 431.795 bits (1109), Expect = 1.186e-147
Identity = 232/415 (55.90%), Postives = 310/415 (74.70%), Query Frame = 2
Query:  107 IVFNISKNEIFNINSNYKEFHKRLKSSWKVITNEDEITAENLSLSKLMIIACPKDKFSIAEFNAMKCYIESGGSILVLMEENGEAKYNNNINYFLEQYGISVNNDAVIRTCYYKYFHPKEALIPNGVLNRALGEAAGKAPLVVMEDDS--SHKQSLQFLYPYGCTVNIVKPAIALLSSGSVSFPQNRPVCGYFRSKEDNGGRLMVIGSGHMFSDAYIVKEENIKLLEVIMQILTTDEITLNSIDATDPDISDYFQSPDIASLADELKCCLQESEEVPRDFDSLFDNSLYIMDTNLVPKALESYDSLKVKHEALTLITPQFEXXXXXXXXXXXXXXXKXXXXXXXXXXXXXXXXSTEKVRLAQLTNKCTENDLEYYVRECGEILGVSNRIAEEKRSAKSILEYIFHQLVEFKKVNR 1345
            ++FN SK E+F  NS YK   KRL++ WK+ + ++E+T E L   KL I A P++KF+ AE   +K Y+ SGG+IL ++ E GE KY+ NIN+ LE++GI VN+D V+R  YYKYFHPKEAL+ NGVLNR +  AAGK    +++D+S  ++ Q+L F+YPYG T+N++KPA A+LS+GSV FP NRPV   ++    N G+L V+GS HMFSD Y+ KEEN K+++V+ Q L TD I LN IDA DP+I+DY   PD   L++ L+ CLQE +E PRDF SLFD SL+ + T+ +P  + +Y  L VKHE L LITPQFETPLPPLQPAVF P F++L  P LDLFDLDE FS+EKVRLAQL+NKCT++DLE+YVR+CG+ILG++ ++ +EKR AK ILE+IF Q+VEFKK+N+
Sbjct:    9 VIFNSSKRELFTANSGYKSLQKRLRAQWKIQSIKEELTTEKLHGVKLWITAGPREKFTAAELEVLKQYLNSGGNILAMLGEGGEVKYDTNINFLLEEFGIMVNSDTVVRNVYYKYFHPKEALVSNGVLNREISRAAGKVLTGIIDDESPGNNAQALTFVYPYGATLNVMKPAAAVLSTGSVCFPLNRPVLALYQIP--NAGKLAVMGSCHMFSDQYLDKEENSKIMDVLFQWLMTDNIHLNQIDAEDPEITDYTMLPDTGCLSERLRVCLQEGDENPRDFTSLFDMSLFKLSTDTLPSVIRAYKQLNVKHEPLQLITPQFETPLPPLQPAVFQPAFRDLPPPMLDLFDLDETFSSEKVRLAQLSNKCTDDDLEFYVRKCGDILGINGKLDKEKRDAKHILEHIFFQVVEFKKLNQ 421          
BLAST of Intraflagellar transport protein 52 vs. Ensembl Sea Lamprey
Match: ift52 (intraflagellar transport 52 homolog (Chlamydomonas) [Source:ZFIN;Acc:ZDB-GENE-040614-3])

HSP 1 Score: 439.499 bits (1129), Expect = 3.944e-151
Identity = 232/415 (55.90%), Postives = 321/415 (77.35%), Query Frame = 2
Query:  107 IVFNISKNEIFNINSNYKEFHKRLKSSWKVITNEDEITAENLSLSKLMIIACPKDKFSIAEFNAMKCYIESGGSILVLMEENGEAKYNNNINYFLEQYGISVNNDAVIRTCYYKYFHPKEALIPNGVLNRALGEAAGK-APLVVMEDDSSH-KQSLQFLYPYGCTVNIVKPAIALLSSGSVSFPQNRPVCGYFRSKEDNGGRLMVIGSGHMFSDAYIVKEENIKLLEVIMQILTTDEITLNSIDATDPDISDYFQSPDIASLADELKCCLQESEEVPRDFDSLFDNSLYIMDTNLVPKALESYDSLKVKHEALTLITPQFEXXXXXXXXXXXXXXXKXXXXXXXXXXXXXXXXSTEKVRLAQLTNKCTENDLEYYVRECGEILGVSNRIAEEKRSAKSILEYIFHQLVEFKKVNR 1345
            ++FN SK E+F+ NS YK   KRL+++WK+ T +DE++ E L  +++ I   P++KF+ AE  A+K Y+++GG++LV++ E GEAK++ NIN+ LE++GI VNNDAVIR  YYKY+HPKEALI NGVLNR +  AAGK  P    +++  H  Q L F+YPYG T+N++KPA+A+LS+GSV FP NRPV  +  +K+ +GG+L V+GS HMFSD Y+ KEEN K+ +V+MQ LTT ++ LN IDA DP+ISDY   PD   LA+ L+ CLQES+E+PRDF +LFD + + +D   +PK +E+Y+ L +KHE+L LI PQFETPLPPLQPAVFPP F+EL  P L+LFDLD+ FS+EKVRLAQLTNKCT++DLEYYVR+CG+ILGV++++  E + A+ +L+++F QLVEFKK+N+
Sbjct:   18 VIFNASKRELFSANSGYKTLQKRLRTNWKIQTLKDEVSEEKLLGARVWISGGPREKFTAAEIEALKRYLDNGGTVLVMLGEGGEAKHDTNINFLLEEFGIMVNNDAVIRNVYYKYYHPKEALISNGVLNREINRAAGKPVPGAGDDENGGHISQGLTFVYPYGATLNVMKPAVAVLSTGSVCFPLNRPVLAFHHNKQ-SGGKLAVLGSCHMFSDQYLDKEENNKIQDVLMQWLTTKDVQLNQIDAEDPEISDYNMLPDTGKLAENLRVCLQESDEIPRDFTTLFDINTFSLDMTSLPKVIEAYEQLNIKHESLQLIQPQFETPLPPLQPAVFPPNFRELGPPPLELFDLDDAFSSEKVRLAQLTNKCTDDDLEYYVRKCGDILGVTSKLPREAQDARHVLQHVFFQLVEFKKLNQ 431          
BLAST of Intraflagellar transport protein 52 vs. Ensembl Nematostella
Match: EDO47507 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLY9])

HSP 1 Score: 448.743 bits (1153), Expect = 1.228e-154
Identity = 239/414 (57.73%), Postives = 318/414 (76.81%), Query Frame = 2
Query:  107 IVFNISKNEIFNINSNYKEFHKRLKSSWKVITNEDEITAENLSLSKLMIIACPKDKFSIAEFNAMKCYIESGGSILVLMEENGEAKYNNNINYFLEQYGISVNNDAVIRTCYYKYFHPKEALIPNGVLNRALGEAAGK-APLVVMEDDSSHKQSLQFLYPYGCTVNIVKPAIALLSSGSVSFPQNRPVCGYFRSKEDNGGRLMVIGSGHMFSDAYIVKEENIKLLEVIMQILTTDEITLNSIDATDPDISDYFQSPDIASLADELKCCLQESEEVPRDFDSLFDNSLYIMDTNLVPKALESYDSLKVKHEALTLITPQFEXXXXXXXXXXXXXXXKXXXXXXXXXXXXXXXXSTEKVRLAQLTNKCTENDLEYYVRECGEILGVSNRIAEEKRSAKSILEYIFHQLVEFKKVNR 1345
            I+FN SK E+FN N+ +K   ++L+S+WK+I N+DE++ + +S +K+++   P+ KF+  EF+A+K Y+E GG++LVLM E GE +++ NIN+ LE YGI VNND+V+RT YYKYFHPKE L+ NGVLNR +  AAGK  P     D     +SL F+YPYG T+N+V+PA  +LS+GSVSFP NRP+C  F S + + G+L V+GS H+FSD Y+ KEEN K+ +VI Q LTT++I LNSIDA DP+ISDY   PD A +A+ L+ CLQE +E+PRDF  LFD+ L+ +DT++VP  ++S++ L  KHE L LI PQFETPLPPLQPAVFPP FKEL  PALDLFDLDE FS+EK RLAQ+TNKCTE+DLEY+VRECG+ILGV+N++  E R AK IL++IFHQ+ EFKK+N+
Sbjct:   20 IIFNASKAELFNPNNGFKSLVRKLRSNWKIIVNKDELSLDKISSAKVLVFGGPRKKFTAVEFDAIKQYLEGGGNVLVLMGEGGEMRFDTNINFLLEDYGIMVNNDSVVRTVYYKYFHPKEVLVSNGVLNREINRAAGKYVPGTTDADSHDLGKSLSFVYPYGATLNVVRPATCVLSTGSVSFPLNRPICA-FHSPKFSKGKLAVLGSVHIFSDQYLDKEENSKVQDVIFQWLTTNDIQLNSIDAEDPEISDYHFIPDTAKMAERLRVCLQEGDEIPRDFSKLFDDELHKLDTSVVPDVIKSFEELHCKHEPLQLIAPQFETPLPPLQPAVFPPQFKELSTPALDLFDLDEAFSSEKARLAQITNKCTEDDLEYFVRECGDILGVTNKLPAESRDAKHILDHIFHQVAEFKKLNQ 432          
BLAST of Intraflagellar transport protein 52 vs. Ensembl Medaka
Match: ift52 (intraflagellar transport 52 [Source:NCBI gene;Acc:101163244])

HSP 1 Score: 408.683 bits (1049), Expect = 1.714e-138
Identity = 226/415 (54.46%), Postives = 304/415 (73.25%), Query Frame = 2
Query:  107 IVFNISKNEIFNINSNYKEFHKRLKSSWKVITNEDEITAENLSLSKLMIIACPKDKFSIAEFNAMKCYIESGGSILVLMEENGEAKYNNNINYFLEQYGISVNNDAVIRTCYYKYFHPKEALIPNGVLNRALGEAAGKAPLVVMEDD--SSHKQSLQFLYPYGCTVNIVKPAIALLSSGSVSFPQNRPVCGYFRSKEDNGGRLMVIGSGHMFSDAYIVKEENIKLLEVIMQILTTDEITLNSIDATDPDISDYFQSPDIASLADELKCCLQESEEVPRDFDSLFDNSLYIMDTNLVPKALESYDSLKVKHEALTLITPQFEXXXXXXXXXXXXXXXKXXXXXXXXXXXXXXXXSTEKVRLAQLTNKCTENDLEYYVRECGEILGVSNRIAEEKRSAKSILEYIFHQLVEFKKVNR 1345
            I FN SK E+F  N+ YK   KRL+S WK+ + +DE++ E L   KL + A P++KF  +E   +K Y++SGG++LV++ E GE KY+ NIN+ LE++G+ VNNDAV+R  YYKYFHPKEAL+ NGVLNR +  AAGK    V+E++   ++ Q+L F+YPYG T+N++KPA A+LS+GSV FP +RPV  +++ KE   G+L V GS HMFSD YI KEEN K+L+V++Q L TD I LN IDA DP+ISDY   PD   L+  L+ CLQE +E PR++  LF   L+ + T+ +P+ + +Y  L VK E L LI PQFETPLP LQPAVFPP F +L  P LDLFDLDE FS+EKVRLAQLTNKCT++DLE+YVR+CGEILGV+ ++ ++   AK ILE++F Q++EFKK+N+
Sbjct:    9 IAFNASKRELFTSNNGYKSMQKRLRSQWKIQSIKDELSEERLKGVKLWVSAGPREKFLASELEVLKHYLDSGGNMLVMLGEGGETKYDTNINFLLEEFGVVVNNDAVVRNTYYKYFHPKEALVSNGVLNREISRAAGKVVTGVIEEENVGNNSQALTFVYPYGATLNVIKPAAAVLSTGSVCFPLHRPVLAFYQGKE--SGKLAVSGSCHMFSDQYIDKEENSKILDVLLQWLMTDNIHLNQIDAEDPEISDYTMLPDTDWLSKRLRSCLQEGDESPRNYTPLFVMPLFSLSTDTLPEVINAYKQLNVKKEPLQLIAPQFETPLPQLQPAVFPPAFSDLPPPMLDLFDLDEAFSSEKVRLAQLTNKCTDDDLEFYVRKCGEILGVTPKLGKQ-VDAKHILEHVFFQVIEFKKLNQ 420          
BLAST of Intraflagellar transport protein 52 vs. Ensembl Medaka
Match: ift52 (intraflagellar transport 52 [Source:NCBI gene;Acc:101163244])

HSP 1 Score: 408.683 bits (1049), Expect = 1.714e-138
Identity = 226/415 (54.46%), Postives = 304/415 (73.25%), Query Frame = 2
Query:  107 IVFNISKNEIFNINSNYKEFHKRLKSSWKVITNEDEITAENLSLSKLMIIACPKDKFSIAEFNAMKCYIESGGSILVLMEENGEAKYNNNINYFLEQYGISVNNDAVIRTCYYKYFHPKEALIPNGVLNRALGEAAGKAPLVVMEDD--SSHKQSLQFLYPYGCTVNIVKPAIALLSSGSVSFPQNRPVCGYFRSKEDNGGRLMVIGSGHMFSDAYIVKEENIKLLEVIMQILTTDEITLNSIDATDPDISDYFQSPDIASLADELKCCLQESEEVPRDFDSLFDNSLYIMDTNLVPKALESYDSLKVKHEALTLITPQFEXXXXXXXXXXXXXXXKXXXXXXXXXXXXXXXXSTEKVRLAQLTNKCTENDLEYYVRECGEILGVSNRIAEEKRSAKSILEYIFHQLVEFKKVNR 1345
            I FN SK E+F  N+ YK   KRL+S WK+ + +DE++ E L   KL + A P++KF  +E   +K Y++SGG++LV++ E GE KY+ NIN+ LE++G+ VNNDAV+R  YYKYFHPKEAL+ NGVLNR +  AAGK    V+E++   ++ Q+L F+YPYG T+N++KPA A+LS+GSV FP +RPV  +++ KE   G+L V GS HMFSD YI KEEN K+L+V++Q L TD I LN IDA DP+ISDY   PD   L+  L+ CLQE +E PR++  LF   L+ + T+ +P+ + +Y  L VK E L LI PQFETPLP LQPAVFPP F +L  P LDLFDLDE FS+EKVRLAQLTNKCT++DLE+YVR+CGEILGV+ ++ ++   AK ILE++F Q++EFKK+N+
Sbjct:    9 IAFNASKRELFTSNNGYKSMQKRLRSQWKIQSIKDELSEERLKGVKLWVSAGPREKFLASELEVLKHYLDSGGNMLVMLGEGGETKYDTNINFLLEEFGVVVNNDAVVRNTYYKYFHPKEALVSNGVLNREISRAAGKVVTGVIEEENVGNNSQALTFVYPYGATLNVIKPAAAVLSTGSVCFPLHRPVLAFYQGKE--SGKLAVSGSCHMFSDQYIDKEENSKILDVLLQWLMTDNIHLNQIDAEDPEISDYTMLPDTDWLSKRLRSCLQEGDESPRNYTPLFVMPLFSLSTDTLPEVINAYKQLNVKKEPLQLIAPQFETPLPQLQPAVFPPAFSDLPPPMLDLFDLDEAFSSEKVRLAQLTNKCTDDDLEFYVRKCGEILGVTPKLGKQ-VDAKHILEHVFFQVIEFKKLNQ 420          
BLAST of Intraflagellar transport protein 52 vs. Planmine SMEST
Match: SMESG000043987.1 (SMESG000043987.1)

HSP 1 Score: 789.26 bits (2037), Expect = 0.000e+0
Identity = 421/424 (99.29%), Postives = 423/424 (99.76%), Query Frame = 2
Query:   77 MIKNFSVGKNIVFNISKNEIFNINSNYKEFHKRLKSSWKVITNEDEITAENLSLSKLMIIACPKDKFSIAEFNAMKCYIESGGSILVLMEENGEAKYNNNINYFLEQYGISVNNDAVIRTCYYKYFHPKEALIPNGVLNRALGEAAGKAPLVVMEDDSSHKQSLQFLYPYGCTVNIVKPAIALLSSGSVSFPQNRPVCGYFRSKEDNGGRLMVIGSGHMFSDAYIVKEENIKLLEVIMQILTTDEITLNSIDATDPDISDYFQSPDIASLADELKCCLQESEEVPRDFDSLFDNSLYIMDTNLVPKALESYDSLKVKHEALTLITPQFEXXXXXXXXXXXXXXXKXXXXXXXXXXXXXXXXSTEKVRLAQLTNKCTENDLEYYVRECGEILGVSNRIAEEKRSAKSILEYIFHQLVEFKKVNRG 1348
            MIKNFSVGKNIVFNISKNEIFNINSNYKEFHKRLKSSWKVITNEDEITAENLSLSKLMIIACPKDKFSIAEFNAMKCYIESGGSILVLMEENGEAKYNNNINYFLEQYGISVNNDAVIRTCYYKYFHPKEALIPNGVLNRALGEAAGK+PL VMEDDSSHKQSLQFLYPYGCTVNIVKPAIALLSSGSVSFPQNRPVCGYFRSKEDNGGRLMVIGSGHMFSDAYIVKEENIKLLEVIMQILTTDEITLNSIDATDPDISDYFQSPDIASLADELKCCLQESEEVPRDFDSLFDNSLYIMDTNLVPKALESY+SLKVKHEALTLITPQFETPLPPLQPAVFPPTFKELDAPALDLFDLDEEFSTEKVRLAQLTNKCTENDLEYYVRECGEILGVSNRIAEEKRSAKSILEYIFHQLVEFKKVNRG
Sbjct:    1 MIKNFSVGKNIVFNISKNEIFNINSNYKEFHKRLKSSWKVITNEDEITAENLSLSKLMIIACPKDKFSIAEFNAMKCYIESGGSILVLMEENGEAKYNNNINYFLEQYGISVNNDAVIRTCYYKYFHPKEALIPNGVLNRALGEAAGKSPLAVMEDDSSHKQSLQFLYPYGCTVNIVKPAIALLSSGSVSFPQNRPVCGYFRSKEDNGGRLMVIGSGHMFSDAYIVKEENIKLLEVIMQILTTDEITLNSIDATDPDISDYFQSPDIASLADELKCCLQESEEVPRDFDSLFDNSLYIMDTNLVPKALESYESLKVKHEALTLITPQFETPLPPLQPAVFPPTFKELDAPALDLFDLDEEFSTEKVRLAQLTNKCTENDLEYYVRECGEILGVSNRIAEEKRSAKSILEYIFHQLVEFKKVNRG 424          
The following BLAST results are available for this feature:
BLAST of Intraflagellar transport protein 52 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
IFT528.673e-14654.70intraflagellar transport 52 [Source:HGNC Symbol;Ac... [more]
IFT528.673e-14654.70intraflagellar transport 52 [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Intraflagellar transport protein 52 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
osm-64.395e-7939.20Osm-6 protein [Source:UniProtKB/TrEMBL;Acc:G5EDF6... [more]
back to top
BLAST of Intraflagellar transport protein 52 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
IFT527.729e-7737.84gene:FBgn0031829 transcript:FBtr0079333[more]
back to top
BLAST of Intraflagellar transport protein 52 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ift527.786e-15357.49intraflagellar transport 52 homolog (Chlamydomonas... [more]
back to top
BLAST of Intraflagellar transport protein 52 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ascl21.242e-15056.80achaete-scute family bHLH transcription factor 2 [... [more]
ascl22.970e-14756.83achaete-scute family bHLH transcription factor 2 [... [more]
ascl25.084e-13150.48achaete-scute family bHLH transcription factor 2 [... [more]
back to top
BLAST of Intraflagellar transport protein 52 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Ift521.124e-15256.01intraflagellar transport 52 [Source:MGI Symbol;Acc... [more]
Ift521.001e-8353.54intraflagellar transport 52 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of Intraflagellar transport protein 52 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q62559|IFT52_MOUSE7.863e-15256.01Intraflagellar transport protein 52 homolog OS=Mus... [more]
sp|Q9Y366|IFT52_HUMAN4.165e-14554.70Intraflagellar transport protein 52 homolog OS=Hom... [more]
back to top
BLAST of Intraflagellar transport protein 52 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0RN139.862e-16861.26Intraflagellar transport protein 52 OS=Fasciola he... [more]
A0A2C9JHN61.473e-16660.05Uncharacterized protein OS=Biomphalaria glabrata O... [more]
D2ILS61.731e-16699.14IFT52-like protein (Fragment) OS=Schmidtea mediter... [more]
A0A2C9JHN71.922e-16660.05Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A4S2JBL02.220e-16561.26Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of Intraflagellar transport protein 52 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ift521.186e-14755.90intraflagellar transport 52 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Intraflagellar transport protein 52 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ift523.944e-15155.90intraflagellar transport 52 homolog (Chlamydomonas... [more]
back to top
BLAST of Intraflagellar transport protein 52 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Intraflagellar transport protein 52 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO475071.228e-15457.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Intraflagellar transport protein 52 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ift521.714e-13854.46intraflagellar transport 52 [Source:NCBI gene;Acc:... [more]
ift521.714e-13854.46intraflagellar transport 52 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Intraflagellar transport protein 52 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000043987.10.000e+099.29SMESG000043987.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031955 ID=SMED30031955|Name=Intraflagellar transport protein 52|organism=Schmidtea mediterranea sexual|type=transcript|length=1628bp
CTCAAGTTGTTTGAATATCTGAATTAGCAAATCTCTATGGTAAACAAATA
ATATTTGAAAATTAGAATTTAGCATCATGATTAAAAACTTTTCAGTTGGA
AAAAATATAGTTTTTAATATTTCTAAAAATGAAATTTTCAATATAAACTC
TAATTATAAGGAGTTTCATAAACGTTTGAAATCTTCATGGAAAGTCATAA
CCAATGAAGACGAAATCACAGCTGAAAACTTATCTCTTTCTAAATTAATG
ATTATCGCCTGCCCTAAAGACAAATTCAGTATTGCAGAATTTAACGCTAT
GAAATGCTACATTGAGAGTGGAGGATCGATTTTAGTGTTAATGGAAGAAA
ATGGAGAAGCAAAATACAACAACAATATAAATTATTTCTTGGAACAATAT
GGAATTTCAGTGAATAACGATGCGGTAATCCGCACTTGCTATTACAAATA
TTTCCATCCCAAGGAAGCTCTCATACCAAATGGAGTTCTCAATCGGGCTC
TCGGTGAAGCTGCTGGCAAAGCCCCGTTGGTTGTGATGGAAGATGACTCA
AGTCACAAACAATCCTTACAGTTTCTCTATCCGTATGGTTGCACAGTGAA
CATTGTCAAGCCCGCTATAGCGCTGCTGTCCTCTGGCAGTGTTTCATTCC
CCCAAAACCGGCCAGTTTGCGGCTATTTCCGCAGCAAGGAGGACAATGGA
GGCCGCTTGATGGTCATTGGCAGTGGGCATATGTTTTCTGACGCCTACAT
TGTCAAGGAGGAAAATATCAAATTGCTGGAAGTGATAATGCAAATCCTCA
CTACAGATGAAATCACTCTCAATTCAATTGATGCAACCGATCCAGACATT
TCCGATTATTTCCAATCTCCCGACATTGCTAGTCTCGCTGACGAGCTCAA
ATGCTGCTTGCAGGAGAGTGAGGAAGTTCCGAGGGATTTCGACAGTCTTT
TCGATAACTCTCTTTACATCATGGACACAAATCTTGTTCCAAAGGCTCTT
GAGTCGTATGACTCGCTAAAAGTCAAACACGAAGCATTGACTCTGATTAC
GCCACAATTTGAAACCCCACTGCCCCCCCTGCAACCGGCTGTGTTCCCAC
CGACATTTAAAGAACTGGATGCTCCAGCGCTTGACCTTTTTGACCTGGAC
GAGGAATTCTCAACGGAAAAAGTGCGGCTGGCACAGTTGACAAATAAATG
TACTGAGAATGATCTGGAATATTACGTGAGGGAGTGCGGTGAAATCCTCG
GGGTGTCCAATCGGATCGCAGAGGAAAAACGGAGCGCTAAATCGATATTG
GAATACATTTTCCATCAGCTGGTGGAATTCAAAAAGGTCAACCGAGGATG
ACTGAAAATCGATGAGATAAATTGATTTATTGATCCGTTCATCCTCCAAT
GTTGTGTGTGTGTGTGTGTATTTGTCAGTTTTGTAGGGAACGCGATTTCG
GTTTTGTGTTTCTATTGCTTTTATTGATCAATTTTATTGTCCAATCAGGG
CAGCATATTTATTATTAGTCGATTCATTGGTCAGATTTACCCAATAATCA
ATAACATCAACCGAAATGAGTAATTTCTGCTTGCAGATTATTGTCCAATC
AAAACTCAATAAAAATCAAATAAGTGGC
back to top

protein sequence of SMED30031955-orf-1

>SMED30031955-orf-1 ID=SMED30031955-orf-1|Name=SMED30031955-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=425bp
MIKNFSVGKNIVFNISKNEIFNINSNYKEFHKRLKSSWKVITNEDEITAE
NLSLSKLMIIACPKDKFSIAEFNAMKCYIESGGSILVLMEENGEAKYNNN
INYFLEQYGISVNNDAVIRTCYYKYFHPKEALIPNGVLNRALGEAAGKAP
LVVMEDDSSHKQSLQFLYPYGCTVNIVKPAIALLSSGSVSFPQNRPVCGY
FRSKEDNGGRLMVIGSGHMFSDAYIVKEENIKLLEVIMQILTTDEITLNS
IDATDPDISDYFQSPDIASLADELKCCLQESEEVPRDFDSLFDNSLYIMD
TNLVPKALESYDSLKVKHEALTLITPQFETPLPPLQPAVFPPTFKELDAP
ALDLFDLDEEFSTEKVRLAQLTNKCTENDLEYYVRECGEILGVSNRIAEE
KRSAKSILEYIFHQLVEFKKVNRG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0031514motile cilium
GO:0005813centrosome
GO:0005814centriole
GO:0005929cilium
GO:0030992intraciliary transport particle B
GO:0032391photoreceptor connecting cilium
GO:0036064ciliary basal body
GO:0042995cell projection
GO:0044292dendrite terminus
GO:0097542ciliary tip
GO:0097546ciliary base
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR039975IFT52
IPR019196ABC_transp_unknown
Vocabulary: biological process
TermDefinition
GO:0001841neural tube formation
GO:0001947heart looping
GO:0007224smoothened signaling pathway
GO:0007368determination of left/right symmetry
GO:0009953dorsal/ventral pattern formation
GO:0030030cell projection organization
GO:0035720intraciliary anterograde transport
GO:0035735intraciliary transport involved in cilium assembly
GO:0042073intraciliary transport
GO:0042733embryonic digit morphogenesis
GO:0050680negative regulation of epithelial cell proliferation
GO:0060271cilium morphogenesis
GO:0070613regulation of protein processing
GO:1905515non-motile cilium assembly
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR12969:SF7INTRAFLAGELLAR TRANSPORT PROTEIN 52 HOMOLOGcoord: 10..421
IPR039975Intraflagellar transport protein 52 homologPANTHERPTHR12969NGD5/OSM-6/IFT52coord: 10..421