Long-chain-fatty-acid--CoA ligase ACSBG2

Overview
NameLong-chain-fatty-acid--CoA ligase ACSBG2
Smed IDSMED30031947
Length (bp)2727
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Long-chain-fatty-acid--CoA ligase ACSBG2 (SMED30031947) t-SNE clustered cells

Violin plots show distribution of expression levels for Long-chain-fatty-acid--CoA ligase ACSBG2 (SMED30031947) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Long-chain-fatty-acid--CoA ligase ACSBG2 (SMED30031947) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Long-chain-fatty-acid--CoA ligase ACSBG2 (SMED30031947) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031947

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30031947SMESG000027217.1 SmedASXL_010677SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30031947SMESG000027217.1 dd_Smed_v4_2414_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30031947SMESG000027217.1 dd_Smed_v4_2414_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30031947SMESG000027217.1 dd_Smed_v4_2414_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
goblet cellSMED30031947SMESG000027217.1 dd_Smed_v6_2414_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Human
Match: ACSBG2 (acyl-CoA synthetase bubblegum family member 2 [Source:HGNC Symbol;Acc:HGNC:24174])

HSP 1 Score: 485.723 bits (1249), Expect = 8.282e-161
Identity = 266/627 (42.42%), Postives = 376/627 (59.97%), Query Frame = 3
Query:  834 TIINRLKENVESQPNHVVLKHKSDPKKDYDLSLTMKEYLEQITKAATGFITLGLEPKAAICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKILSILPGVPQ-----VKAIIKYTGEVQEEAKKKSKIPIYTWSQFLSIDSTNATDELHNRQENVKPKDCAVLIYTSGTTGLPKGVMLSHDNILFTLKMVQIHLELKKFQNIIISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKTLKEVRPTVFLGVPRVYEKIQEQLE--------------------NLKASTNKKLDSV---------------KVKQNLGLDRCEYIASGAAPISQQTLEFFQDIDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDENLIGEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIEAKEVEDLLNSNFAVLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMY 2594
            TI    +E+V     +  L  K+  K +    L   +Y E   KAA   I LGLE    + ILGFN   WFI+ +G I AGG+  GIY +N+AE+C+Y++   K  IL++END QL KILSI    PQ     +KAII+Y   +++         +Y+W  F+ +  +    +L    E+ K   CAVLIYTSGTTG+PKGVMLSHDNI +    V    +L      ++SYLPLSH+AA M+DI   + +G+  YFAQ DALKG+L  TLKEV+PTVF+GVP+++EKI E ++                      K ++ K L                  KVK +LGLD C    SG AP++Q+T EFF  +DI I ++YG+SESSGPHTI  ++  +L   G ++ G +  +   +++ IGEIC+ GRH+F+GY  +  +T EA+D + WLHSGDLG++DG G+L VTG IKE+LITAGGENV P+P+E  +K ++P ISN MLVGDK KF+S LLTLK +++  +  P +KL+  AI      G +A  V +++     ++   I   +N VN ++++ A  ++KW IL +DFS+ GGELGP +K+KR FV +KY+  I  MY
Sbjct:    2 TIPEFFRESVNRFGTYPALASKNGKKWEI---LNFNQYYEACRKAAKSLIKLGLERFHGVGILGFNSAEWFITAVGAILAGGLCVGIYATNSAEVCQYVITHAKVNILLVENDQQLQKILSI----PQSSLEPLKAIIQYRLPMKKNNN------LYSWDDFMELGRSIPDTQLEQVIESQKANQCAVLIYTSGTTGIPKGVMLSHDNITWIAGAVTKDFKLTDKHETVVSYLPLSHIAAQMMDIWVPIKIGALTYFAQADALKGTLVSTLKEVKPTVFIGVPQIWEKIHEMVKKNSAKSMGLKKKAFVWARNIGFKVNSKKMLGKYNTPVSYRMAKTLVFSKVKTSLGLDHCHSFISGTAPLNQETAEFFLSLDIPIGELYGLSESSGPHTISNQNNYRLLSCGKILTGCKNMLFQQNKDGIGEICLWGRHIFMGYLESETETTEAIDDEGWLHSGDLGQLDGLGFLYVTGHIKEILITAGGENVPPIPVETLVKKKIPIISNAMLVGDKLKFLSMLLTLKCEMNQMSGEPLDKLNFEAINFCRGLGSQASTVTEIVKQQDPLVYKAIQQGINAVNQEAMNNAQRIEKWVILEKDFSIYGGELGPMMKLKRHFVAQKYKKQIDHMY 615          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Human
Match: ACSBG2 (acyl-CoA synthetase bubblegum family member 2 [Source:HGNC Symbol;Acc:HGNC:24174])

HSP 1 Score: 484.952 bits (1247), Expect = 7.335e-160
Identity = 266/627 (42.42%), Postives = 375/627 (59.81%), Query Frame = 3
Query:  834 TIINRLKENVESQPNHVVLKHKSDPKKDYDLSLTMKEYLEQITKAATGFITLGLEPKAAICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKILSILPGVPQ-----VKAIIKYTGEVQEEAKKKSKIPIYTWSQFLSIDSTNATDELHNRQENVKPKDCAVLIYTSGTTGLPKGVMLSHDNILFTLKMVQIHLELKKFQNIIISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKTLKEVRPTVFLGVPRVYEKIQEQLENLKAST-----------------------------------NKKLDSVKVKQNLGLDRCEYIASGAAPISQQTLEFFQDIDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDENLIGEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIEAKEVEDLLNSNFAVLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMY 2594
            TI    +E+V     +  L  K+  K +    L   +Y E   KAA   I LGLE    + ILGFN   WFI+ +G I AGG+  GIY +N+AE+C+Y++   K  IL++END QL KILSI    PQ     +KAII+Y   +++         +Y+W  F+ +  +    +L    E+ K   CAVLIYTSGTTG+PKGVMLSHDNI +    V    +L      ++SYLPLSH+AA M+DI   + +G+  YFAQ DALKG+L  TLKEV+PTVF+GVP+++EKI E ++   A +                                    K L   KVK +LGLD C    SG AP++Q+T EFF  +DI I ++YG+SESSGPHTI  ++  +L   G ++ G +  +   +++ IGEIC+ GRH+F+GY  +  +T EA+D + WLHSGDLG++DG G+L VTG IKE+LITAGGENV P+P+E  +K ++P ISN MLVGDK KF+S LLTLK +++  +  P +KL+  AI      G +A  V +++     ++   I   +N VN ++++ A  ++KW IL +DFS+ GGELGP +K+KR FV +KY+  I  MY
Sbjct:   52 TIPEFFRESVNRFGTYPALASKNGKKWEI---LNFNQYYEACRKAAKSLIKLGLERFHGVGILGFNSAEWFITAVGAILAGGLCVGIYATNSAEVCQYVITHAKVNILLVENDQQLQKILSI----PQSSLEPLKAIIQYRLPMKKNNN------LYSWDDFMELGRSIPDTQLEQVIESQKANQCAVLIYTSGTTGIPKGVMLSHDNITWIAGAVTKDFKLTDKHETVVSYLPLSHIAAQMMDIWVPIKIGALTYFAQADALKGTLVSTLKEVKPTVFIGVPQIWEKIHEMVKKNSAKSMGLKKKAFVWARNIGFKVNSKKMLGKYNTPVSYRMAKTLVFSKVKTSLGLDHCHSFISGTAPLNQETAEFFLSLDIPIGELYGLSESSGPHTISNQNNYRLLSCGKILTGCKNMLFQQNKDGIGEICLWGRHIFMGYLESETETTEAIDDEGWLHSGDLGQLDGLGFLYVTGHIKEILITAGGENVPPIPVETLVKKKIPIISNAMLVGDKLKFLSMLLTLKCEMNQMSGEPLDKLNFEAINFCRGLGSQASTVTEIVKQQDPLVYKAIQQGINAVNQEAMNNAQRIEKWVILEKDFSIYGGELGPMMKLKRHFVAQKYKKQIDHMY 665          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Human
Match: ACSBG2 (acyl-CoA synthetase bubblegum family member 2 [Source:HGNC Symbol;Acc:HGNC:24174])

HSP 1 Score: 484.952 bits (1247), Expect = 7.335e-160
Identity = 266/627 (42.42%), Postives = 375/627 (59.81%), Query Frame = 3
Query:  834 TIINRLKENVESQPNHVVLKHKSDPKKDYDLSLTMKEYLEQITKAATGFITLGLEPKAAICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKILSILPGVPQ-----VKAIIKYTGEVQEEAKKKSKIPIYTWSQFLSIDSTNATDELHNRQENVKPKDCAVLIYTSGTTGLPKGVMLSHDNILFTLKMVQIHLELKKFQNIIISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKTLKEVRPTVFLGVPRVYEKIQEQLENLKAST-----------------------------------NKKLDSVKVKQNLGLDRCEYIASGAAPISQQTLEFFQDIDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDENLIGEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIEAKEVEDLLNSNFAVLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMY 2594
            TI    +E+V     +  L  K+  K +    L   +Y E   KAA   I LGLE    + ILGFN   WFI+ +G I AGG+  GIY +N+AE+C+Y++   K  IL++END QL KILSI    PQ     +KAII+Y   +++         +Y+W  F+ +  +    +L    E+ K   CAVLIYTSGTTG+PKGVMLSHDNI +    V    +L      ++SYLPLSH+AA M+DI   + +G+  YFAQ DALKG+L  TLKEV+PTVF+GVP+++EKI E ++   A +                                    K L   KVK +LGLD C    SG AP++Q+T EFF  +DI I ++YG+SESSGPHTI  ++  +L   G ++ G +  +   +++ IGEIC+ GRH+F+GY  +  +T EA+D + WLHSGDLG++DG G+L VTG IKE+LITAGGENV P+P+E  +K ++P ISN MLVGDK KF+S LLTLK +++  +  P +KL+  AI      G +A  V +++     ++   I   +N VN ++++ A  ++KW IL +DFS+ GGELGP +K+KR FV +KY+  I  MY
Sbjct:   52 TIPEFFRESVNRFGTYPALASKNGKKWEI---LNFNQYYEACRKAAKSLIKLGLERFHGVGILGFNSAEWFITAVGAILAGGLCVGIYATNSAEVCQYVITHAKVNILLVENDQQLQKILSI----PQSSLEPLKAIIQYRLPMKKNNN------LYSWDDFMELGRSIPDTQLEQVIESQKANQCAVLIYTSGTTGIPKGVMLSHDNITWIAGAVTKDFKLTDKHETVVSYLPLSHIAAQMMDIWVPIKIGALTYFAQADALKGTLVSTLKEVKPTVFIGVPQIWEKIHEMVKKNSAKSMGLKKKAFVWARNIGFKVNSKKMLGKYNTPVSYRMAKTLVFSKVKTSLGLDHCHSFISGTAPLNQETAEFFLSLDIPIGELYGLSESSGPHTISNQNNYRLLSCGKILTGCKNMLFQQNKDGIGEICLWGRHIFMGYLESETETTEAIDDEGWLHSGDLGQLDGLGFLYVTGHIKEILITAGGENVPPIPVETLVKKKIPIISNAMLVGDKLKFLSMLLTLKCEMNQMSGEPLDKLNFEAINFCRGLGSQASTVTEIVKQQDPLVYKAIQQGINAVNQEAMNNAQRIEKWVILEKDFSIYGGELGPMMKLKRHFVAQKYKKQIDHMY 665          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Human
Match: ACSBG1 (acyl-CoA synthetase bubblegum family member 1 [Source:HGNC Symbol;Acc:HGNC:29567])

HSP 1 Score: 459.914 bits (1182), Expect = 2.237e-149
Identity = 247/635 (38.90%), Postives = 374/635 (58.90%), Query Frame = 3
Query:  801 VDDETKNVPEETIINRLKENVESQPNHVVLKHKSDPKKDYDLSLTMKEYLEQITKAATGFITLGLEPKAAICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKILSILPGVPQVKAIIKYTGEVQEEAKKKSKIPIYTWSQFLSIDSTNATDELHNRQENVKPKDCAVLIYTSGTTGLPKGVMLSHDNILFTLKMVQIHLELKKF---QNIIISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKTLKEVRPTVFLGVPRVYEKIQEQLE-------------------------------NLKASTNKKLDSV---KVKQNLGLDRCEYIASGAAPISQQTLEFFQDIDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDENLIGEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIEAKEVEDLLNSNFAVLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMY 2594
            +D     +P  T+     E ++   + + L  K   K ++   ++  +Y     +AA GF+ LGL+   ++ ILGFN P WF S +G ++AGG+  GIYT+++ E C+YI  DC   +++++   QL KIL I   +P +KA++ Y     +E        +YT  +F+ + +    + L    +  +P  C VL+YTSGTTG PKGVMLS DNI +T +      +++     Q +++SYLPLSH+AA + D+ + +  G+ + FA+PDALKGSL  TL+EV PT  +GVPRV+EKI E+++                               +LK  T +  D +   KV+Q LG  +C+    GAAP+  +T  FF  ++I ++  YG+SE+SGPH +      +L   G L+ G  +K+ N D   IGEIC+ GR +F+GY N  +KT EA+D + WLH+GD G++D +G+L +TGR+KEL+ITAGGENV PVPIE+ +K ELP ISN ML+GD++KF+S LLTLK  LD  T   T+ L+  A+   +  G  A  V +++      +   I+  + RVN  + ++  ++QKW IL RDFS+ GGELGPT+K+KR+ V+EKY+ +I S Y
Sbjct:   94 IDPSCPQLPY-TVHRMFYEALDKYGDLIALGFKRQDKWEH---ISYSQYYLLARRAAKGFLKLGLKQAHSVAILGFNSPEWFFSAVGTVFAGGIVTGIYTTSSPEACQYIAYDCCANVIMVDTQKQLEKILKIWKQLPHLKAVVIY-----KEPPPNKMANVYTMEEFMELGNEVPEEALDAIIDTQQPNQCCVLVYTSGTTGNPKGVMLSQDNITWTARYGSQAGDIRPAEVQQEVVVSYLPLSHIAAQIYDLWTGIQWGAQVCFAEPDALKGSLVNTLREVEPTSHMGVPRVWEKIMERIQEVAAQSGFIRRKMLLWAMSVTLEQNLTCPGSDLKPFTTRLADYLVLAKVRQALGFAKCQKNFYGAAPMMAETQHFFLGLNIRLYAGYGLSETSGPHFMSSPYNYRLYSSGKLVPGCRVKLVNQDAEGIGEICLWGRTIFMGYLNMEDKTCEAIDEEGWLHTGDAGRLDADGFLYITGRLKELIITAGGENVPPVPIEEAVKMELPIISNAMLIGDQRKFLSMLLTLKCTLDPDTSDQTDNLTEQAMEFCQRVGSRATTVSEIIEKKDEAVYQAIEEGIRRVNMNAAARPYHIQKWAILERDFSISGGELGPTMKLKRLTVLEKYKGIIDSFY 719          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Human
Match: ACSBG2 (acyl-CoA synthetase bubblegum family member 2 [Source:HGNC Symbol;Acc:HGNC:24174])

HSP 1 Score: 398.282 bits (1022), Expect = 5.726e-129
Identity = 207/472 (43.86%), Postives = 294/472 (62.29%), Query Frame = 3
Query: 1284 IYTWSQFLSIDSTNATDELHNRQENVKPKDCAVLIYTSGTTGLPKGVMLSHDNILFTLKMVQIHLELKKFQNIIISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKTLKEVRPTVFLGVPRVYEKIQEQLE--------------------NLKASTNKKLDSV---------------KVKQNLGLDRCEYIASGAAPISQQTLEFFQDIDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDENLIGEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIEAKEVEDLLNSNFAVLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMY 2594
            +Y+W  F+ +  +    +L    E+ K   CAVLIYTSGTTG+PKGVMLSHDNI +    V    +L      ++SYLPLSH+AA M+DI   + +G+  YFAQ DALKG+L  TLKEV+PTVF+GVP+++EKI E ++                      K ++ K L                  KVK +LGLD C    SG AP++Q+T EFF  +DI I ++YG+SESSGPHTI  ++  +L   G ++ G +  +   +++ IGEIC+ GRH+F+GY  +  +T EA+D + WLHSGDLG++DG G+L VTG IKE+LITAGGENV P+P+E  +K ++P ISN MLVGDK KF+S LLTLK +++  +  P +KL+  AI      G +A  V +++     ++   I   +N VN ++++ A  ++KW IL +DFS+ GGELGP +K+KR FV +KY+  I  MY
Sbjct:    7 LYSWDDFMELGRSIPDTQLEQVIESQKANQCAVLIYTSGTTGIPKGVMLSHDNITWIAGAVTKDFKLTDKHETVVSYLPLSHIAAQMMDIWVPIKIGALTYFAQADALKGTLVSTLKEVKPTVFIGVPQIWEKIHEMVKKNSAKSMGLKKKAFVWARNIGFKVNSKKMLGKYNTPVSYRMAKTLVFSKVKTSLGLDHCHSFISGTAPLNQETAEFFLSLDIPIGELYGLSESSGPHTISNQNNYRLLSCGKILTGCKNMLFQQNKDGIGEICLWGRHIFMGYLESETETTEAIDDEGWLHSGDLGQLDGLGFLYVTGHIKEILITAGGENVPPIPVETLVKKKIPIISNAMLVGDKLKFLSMLLTLKCEMNQMSGEPLDKLNFEAINFCRGLGSQASTVTEIVKQQDPLVYKAIQQGINAVNQEAMNNAQRIEKWVILEKDFSIYGGELGPMMKLKRHFVAQKYKKQIDHMY 478          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Celegans
Match: acs-13 (Fatty Acid CoA Synthetase family [Source:UniProtKB/TrEMBL;Acc:V6CLI5])

HSP 1 Score: 139.813 bits (351), Expect = 5.780e-34
Identity = 146/595 (24.54%), Postives = 266/595 (44.71%), Query Frame = 3
Query:  948 LEQITKAATGFITLGLEPKAA--ICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKILSILPGVPQVKAII---KYTGEVQEEAKKKSKIPIYTWSQFLSIDSTNATDELHNRQENVKPKDCAVLIYTSGTTGLPKGVMLSHDNILFTLKMVQIHLELKKFQNI-----IISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKTLKEVRPTVFLG----VPRVYEKIQEQ---------------------LENLKASTNKKLDSV---KVKQNLGLDRCEYIASGAAPISQQTLEFFQD-IDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELK-IENPDENLI-----GEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIEAKEVEDLLNSNFAVLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMYT 2597
            LE+    +  F  LG+    A  I I   N   W I+E        V   IY +  +E   +I+   + +I++ ++  +   +L      P +  ++     T E++  A     + + T+     I     T   H       P+D A + YTSGTTG PKGVML+H N++       + ++  K   I     +IS+LPL+H+   +++ +    +G+ + F + D     L + +KE++PTV       + R+Y+K+  +                     + N     +   D++   K+++  G  R   + +G+AP+S   L F +  +  ++ + YG +E     T+  + +   G VG ++   ++K ++ P+ N       GE+C++G  +F GY+   ++TKE +D   WLH+GD+G+   EG L +  R K +   + GE VAP  IE NI     +++   + G+  K  +C             +P  ++ V A   +   GI+    E+L N N AV K+ +D+ +       +     V+  ++    FS++   L PTLK KR  +   Y   + +MY+
Sbjct:  107 LERADNVSVAFRELGVPTGNAENIGIYSKNRAEWIITEFATYNYSNVIVPIYETLGSEASIFILNQAEIKIVVCDDISKATGLLKFKEQCPSLSTLVVMEPVTDELKTTASSLG-VEVLTFEDLEKIGKNAKTRPAHIPP---TPEDLATICYTSGTTGTPKGVMLTHANVIAD----GVCMDFFKHSGIAATDSMISFLPLAHMLERVIE-SVCFCVGAKVGFYRGDIR--VLAEDIKELKPTVVPVVPRVLNRLYDKVMSEVNKSTLKKMLFDFAISYKARDMANFNIRNDGFFDNLVFKKIREGFG-GRVRLMITGSAPLSTNVLTFVRAAMGCVVVEGYGQTECVAACTVSMEGDSLAGHVGMVIPSCQIKLVDVPELNYYAKDQAGEVCVKGHIIFKGYYKNEQQTKETIDEDGWLHTGDIGRWTPEGTLKIVDRKKHIFKLSQGEYVAPEKIE-NIYVRSKYVAQSFVHGESLK--TC--------LIAIVVPDAEVLVPA---MADQGIKGT-FEELCN-NDAVKKAILDDMVAVGKKAGLFSFEQVRDISLSAEQFSVENDLLTPTLKSKRPKLKAHYSKQLDAMYS 673          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Celegans
Match: acs-13 (Fatty Acid CoA Synthetase family [Source:UniProtKB/TrEMBL;Acc:V6CLI5])

HSP 1 Score: 139.813 bits (351), Expect = 6.656e-34
Identity = 146/595 (24.54%), Postives = 266/595 (44.71%), Query Frame = 3
Query:  948 LEQITKAATGFITLGLEPKAA--ICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKILSILPGVPQVKAII---KYTGEVQEEAKKKSKIPIYTWSQFLSIDSTNATDELHNRQENVKPKDCAVLIYTSGTTGLPKGVMLSHDNILFTLKMVQIHLELKKFQNI-----IISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKTLKEVRPTVFLG----VPRVYEKIQEQ---------------------LENLKASTNKKLDSV---KVKQNLGLDRCEYIASGAAPISQQTLEFFQD-IDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELK-IENPDENLI-----GEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIEAKEVEDLLNSNFAVLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMYT 2597
            LE+    +  F  LG+    A  I I   N   W I+E        V   IY +  +E   +I+   + +I++ ++  +   +L      P +  ++     T E++  A     + + T+     I     T   H       P+D A + YTSGTTG PKGVML+H N++       + ++  K   I     +IS+LPL+H+   +++ +    +G+ + F + D     L + +KE++PTV       + R+Y+K+  +                     + N     +   D++   K+++  G  R   + +G+AP+S   L F +  +  ++ + YG +E     T+  + +   G VG ++   ++K ++ P+ N       GE+C++G  +F GY+   ++TKE +D   WLH+GD+G+   EG L +  R K +   + GE VAP  IE NI     +++   + G+  K  +C             +P  ++ V A   +   GI+    E+L N N AV K+ +D+ +       +     V+  ++    FS++   L PTLK KR  +   Y   + +MY+
Sbjct:  150 LERADNVSVAFRELGVPTGNAENIGIYSKNRAEWIITEFATYNYSNVIVPIYETLGSEASIFILNQAEIKIVVCDDISKATGLLKFKEQCPSLSTLVVMEPVTDELKTTASSLG-VEVLTFEDLEKIGKNAKTRPAHIPP---TPEDLATICYTSGTTGTPKGVMLTHANVIAD----GVCMDFFKHSGIAATDSMISFLPLAHMLERVIE-SVCFCVGAKVGFYRGDIR--VLAEDIKELKPTVVPVVPRVLNRLYDKVMSEVNKSTLKKMLFDFAISYKARDMANFNIRNDGFFDNLVFKKIREGFG-GRVRLMITGSAPLSTNVLTFVRAAMGCVVVEGYGQTECVAACTVSMEGDSLAGHVGMVIPSCQIKLVDVPELNYYAKDQAGEVCVKGHIIFKGYYKNEQQTKETIDEDGWLHTGDIGRWTPEGTLKIVDRKKHIFKLSQGEYVAPEKIE-NIYVRSKYVAQSFVHGESLK--TC--------LIAIVVPDAEVLVPA---MADQGIKGT-FEELCN-NDAVKKAILDDMVAVGKKAGLFSFEQVRDISLSAEQFSVENDLLTPTLKSKRPKLKAHYSKQLDAMYS 716          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Celegans
Match: acs-13 (Fatty Acid CoA Synthetase family [Source:UniProtKB/TrEMBL;Acc:V6CLI5])

HSP 1 Score: 139.813 bits (351), Expect = 7.600e-34
Identity = 146/595 (24.54%), Postives = 266/595 (44.71%), Query Frame = 3
Query:  948 LEQITKAATGFITLGLEPKAA--ICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKILSILPGVPQVKAII---KYTGEVQEEAKKKSKIPIYTWSQFLSIDSTNATDELHNRQENVKPKDCAVLIYTSGTTGLPKGVMLSHDNILFTLKMVQIHLELKKFQNI-----IISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKTLKEVRPTVFLG----VPRVYEKIQEQ---------------------LENLKASTNKKLDSV---KVKQNLGLDRCEYIASGAAPISQQTLEFFQD-IDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELK-IENPDENLI-----GEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIEAKEVEDLLNSNFAVLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMYT 2597
            LE+    +  F  LG+    A  I I   N   W I+E        V   IY +  +E   +I+   + +I++ ++  +   +L      P +  ++     T E++  A     + + T+     I     T   H       P+D A + YTSGTTG PKGVML+H N++       + ++  K   I     +IS+LPL+H+   +++ +    +G+ + F + D     L + +KE++PTV       + R+Y+K+  +                     + N     +   D++   K+++  G  R   + +G+AP+S   L F +  +  ++ + YG +E     T+  + +   G VG ++   ++K ++ P+ N       GE+C++G  +F GY+   ++TKE +D   WLH+GD+G+   EG L +  R K +   + GE VAP  IE NI     +++   + G+  K  +C             +P  ++ V A   +   GI+    E+L N N AV K+ +D+ +       +     V+  ++    FS++   L PTLK KR  +   Y   + +MY+
Sbjct:  157 LERADNVSVAFRELGVPTGNAENIGIYSKNRAEWIITEFATYNYSNVIVPIYETLGSEASIFILNQAEIKIVVCDDISKATGLLKFKEQCPSLSTLVVMEPVTDELKTTASSLG-VEVLTFEDLEKIGKNAKTRPAHIPP---TPEDLATICYTSGTTGTPKGVMLTHANVIAD----GVCMDFFKHSGIAATDSMISFLPLAHMLERVIE-SVCFCVGAKVGFYRGDIR--VLAEDIKELKPTVVPVVPRVLNRLYDKVMSEVNKSTLKKMLFDFAISYKARDMANFNIRNDGFFDNLVFKKIREGFG-GRVRLMITGSAPLSTNVLTFVRAAMGCVVVEGYGQTECVAACTVSMEGDSLAGHVGMVIPSCQIKLVDVPELNYYAKDQAGEVCVKGHIIFKGYYKNEQQTKETIDEDGWLHTGDIGRWTPEGTLKIVDRKKHIFKLSQGEYVAPEKIE-NIYVRSKYVAQSFVHGESLK--TC--------LIAIVVPDAEVLVPA---MADQGIKGT-FEELCN-NDAVKKAILDDMVAVGKKAGLFSFEQVRDISLSAEQFSVENDLLTPTLKSKRPKLKAHYSKQLDAMYS 723          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Celegans
Match: acs-5 (Fatty Acid CoA Synthetase family [Source:UniProtKB/TrEMBL;Acc:Q9XWD1])

HSP 1 Score: 135.576 bits (340), Expect = 1.247e-32
Identity = 165/617 (26.74%), Postives = 271/617 (43.92%), Query Frame = 3
Query:  897 KSDPKKDYDLSLTMKEYLEQITKAATGFI-TLGLEPKAA--ICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKILSILPGVPQVKAII--KYTGEVQEEAKKKSKIPIYTWSQFLSIDSTNA-TDELHNRQENVKPKDCAVLIYTSGTTGLPKGVMLSHDNIL-----FTLKMVQIHLELKKFQNIIISYLPLSHVAANMLDIASTVGMGSTI-YFAQPDALKGSLGKTLKEVRPTVFLGVPR--------VYEKIQEQLENLKASTN----KKLDSVK-----------------VKQNLGLDRCEYIASGAAPISQQTLEFFQ-DIDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIEN-PDENLI-----GEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGD--KKKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIEAKEVEDLLNSNFAVLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRD-FSLKGGELGPTLKMKRMFVMEKYEDVIKSMY 2594
            +S    DY+  LT  +  EQ    +   +   GL P     I I   N P W +S +  +    V   +Y +  AE   +I+   +  ++I+++  +   ++     +P +K II      E+++       I + + +  L++ S    T+ L       KP D  ++ YTSGTTG PKGVML+H NI+     F   +      +     + ISYLPLSH+    L   + +G GS I YF    +++G L   +K ++PTVF  VPR        +  K+Q+Q    K   N    +KL  VK                 ++Q +G  + + + +G+APIS   LE  +  +   I + YG +E +   T     +   G  G       +K+ + PD N       GEI ++G  V  GY+   E+T E  D + +L +GD+G++   G + +  R K +   A GE VAP  IE  +    P +  V + GD  ++  I+ ++     L             S  R +E    + K  E +L+   A+ K+   N++ +V            K  IL  D F+++ G L PTLK KR  +  KY+D +  +Y
Sbjct:   95 RSSGDADYEF-LTYDDVHEQAKNLSMTLVHEFGLTPANTTNIGIYARNSPQWLVSAVACVEQSMVVVPLYDTLGAEAATFIISQAEISVVIVDSFKKAESLIKNRENMPTLKNIIVIDSADELKDGTAIIDTIRVESLTNALNLGSRYPFTNNLP------KPDDNYIICYTSGTTGTPKGVMLTHSNIVANISGFLKILFAFQPSMIDATQVHISYLPLSHMM-EQLTHWTLLGFGSKIGYFR--GSIQG-LTDDIKTLKPTVFPVVPRLLNRLYDAITSKVQQQGFMAKLVYNFAFARKLSLVKAGKVGRDTIWDRLVFNKIQQQIG-GKVDLMVTGSAPISSTVLETCRVTLGTTIVEGYGQTECTALATFTWMGDPSTGHCGAPAPCALVKLGDVPDLNYFAKDGKGEIRIKGPCVTKGYYKDPERTAELFDEEGFLQTGDIGEMLPNGTIRIIDRKKHIFKLAQGEYVAPEKIE-QVYIRTPVVQQVYVDGDSLERWLIAVVVPEPDVLKEWNDK-----QGSGSRKIEEICNDEKAKEFVLSELHAIGKANKLNSIEQV------------KKVILTSDTFTVENGLLTPTLKAKRPQLRLKYKDGMAKVY 681          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Celegans
Match: acs-21 (Fatty Acid CoA Synthetase family [Source:UniProtKB/TrEMBL;Acc:O16481])

HSP 1 Score: 123.635 bits (309), Expect = 2.733e-29
Identity = 95/287 (33.10%), Postives = 149/287 (51.92%), Query Frame = 3
Query: 1353 ENVKPKDCAVLIYTSGTTGLPKGVMLSHDNILF-TLKMVQIHLELKKFQNII-ISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKTLKEVRPTVFLGVPRVYEKIQEQLENLKASTNKKLDSVKVKQNLGLDRCEYIASGAAPISQQTLEFFQD-IDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDENLIGEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKS 2204
            E+V+  + A + +TSGTTG PKG +LSH  +   T  +VQ   E    +N + +  LP+ H       +  ++   S++ + +P+       K LK    TVF+GVP  Y +       L A+ N   +S         ++     SG+AP+S  TLE F+     +I + YGM+E+    +   K ++K G VG  +KGV+ ++    EN  GEI ++   +F  Y+   EKTKE      W  +GD+G +D +GYL + GR K+++I+ GGEN+ P  IED I S
Sbjct:  172 EHVEKSNAATICFTSGTTGAPKGAVLSHGALTNNTNALVQ---EWGFTENDVNLHCLPIFHAHGLYFSLHCSLFSHSSVIW-RPNFDAEDCSKHLKNA--TVFMGVPTFYSR-------LLATNNFNKES--------FEKIRLFISGSAPLSVPTLEEFEKRTGQVILERYGMTEAGVIASNPLKGKRKAGTVGQALKGVQCRVT---EN--GEIEIKSDSIFSEYWKNPEKTKEEFTEDGWFKTGDVGSLDKDGYLTIGGRSKDMIIS-GGENIYPKEIEDAIDS 431          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Fly
Match: bgm (gene:FBgn0027348 transcript:FBtr0080590)

HSP 1 Score: 450.284 bits (1157), Expect = 8.764e-147
Identity = 259/620 (41.77%), Postives = 379/620 (61.13%), Query Frame = 3
Query:  849 LKENVESQPNHVVLKHKSDPKKDYDLSLTMKEYLEQITKAATGFITLGLEPKAAICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKILSILPGVPQVKAIIKYTGEVQEEAKKKSKIPIYTWSQFLSIDSTNATDELHNRQENVKPKDCAVLIYTSGTTGLPKGVMLSHDNILFTLK-MVQIHLELKKFQNIIISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKTLKEVRPTVFLGVPRVYEKIQEQLENLKASTN----------------------------------KKLDSVKVKQNLGLDRCEYIASGAAPISQQTLEFFQDIDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDENLIGEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIEAKEVEDLLNSNFA--VLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMYT 2597
            LK  V +  ++  L+ K + K  Y  ++T K+Y +++ + A  FI LGLE   ++ +L FN   WF S +G I+A G+  GIYT+N+A+  ++++     QI+++++  Q++KI +I   +P++KA I+         KK+     Y WS+  S++ ++  D+   R ENV   +C  L+YTSGT G+PKGVMLSHDNI F ++ +V+    +      I+SYLPLSHVAA  +DI +   +   I+FA  DALKG+L K+L++ RPT F+GVPRVYEK QE++  + +S+                                   K L   KVKQ LG DR   +AS AAP+S +T ++F  +D+ I   +GMSE++G HTI   D   L  +G  + G E K  N D N  GE+C+RGRHVF+GY +  EKT+E+LD   WLHSGDLG VD +GY+ +TGR KE++ITAGGEN+ PV IE+ IK EL  ISN  LVG+++K+++ L+TLKT++D  +  P ++LS  +   ++S G+E K V D+L +     V KS I++A+ R N QS+S A  VQK+TILP DFS+  GELGPTLK+KR  V + Y D I+ +Y 
Sbjct:   52 LKRTVNNYGDYPALRTK-NGKNGYH-TVTYKQYEQKVHQVAKAFIKLGLEEHHSVGVLAFNCAEWFYSAMGAIHARGIIAGIYTTNSADAVQHVLESSHAQIVVVDDAKQMDKIHAIRDKLPKLKAAIQIQEPYSPYLKKEDGY--YRWSEIESMNVSDVEDQYMTRLENVAINECCCLVYTSGTVGMPKGVMLSHDNITFDVRGIVKAMDRVVVGAESIVSYLPLSHVAAQTVDIYTCAFVAGCIWFADKDALKGTLVKSLQDARPTRFMGVPRVYEKFQERMVAVASSSGSLKKMLASWAKGITLKHYMVSQGKSSGGFRYKIAKSLIMSKVKQALGFDRVLTLASAAAPMSPETKKYFLSLDLKIVDAFGMSETAGCHTICLPDSVGLNTIGKTLPGCESKFINKDANGHGELCIRGRHVFMGYIDNKEKTEESLDDDCWLHSGDLGFVDDKGYVSLTGRSKEIIITAGGENIPPVHIENTIKKELDAISNAFLVGEQRKYLTVLITLKTEVDKDSGEPLDELSHESSVWVKSLGVEHKTVSDILAAGPCPKVWKS-IEDAIKRANKQSISNAQKVQKFTILPHDFSIPTGELGPTLKVKRNVVSKMYADEIEKLYA 666          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Fly
Match: bgm (gene:FBgn0027348 transcript:FBtr0346624)

HSP 1 Score: 450.284 bits (1157), Expect = 8.764e-147
Identity = 259/620 (41.77%), Postives = 379/620 (61.13%), Query Frame = 3
Query:  849 LKENVESQPNHVVLKHKSDPKKDYDLSLTMKEYLEQITKAATGFITLGLEPKAAICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKILSILPGVPQVKAIIKYTGEVQEEAKKKSKIPIYTWSQFLSIDSTNATDELHNRQENVKPKDCAVLIYTSGTTGLPKGVMLSHDNILFTLK-MVQIHLELKKFQNIIISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKTLKEVRPTVFLGVPRVYEKIQEQLENLKASTN----------------------------------KKLDSVKVKQNLGLDRCEYIASGAAPISQQTLEFFQDIDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDENLIGEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIEAKEVEDLLNSNFA--VLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMYT 2597
            LK  V +  ++  L+ K + K  Y  ++T K+Y +++ + A  FI LGLE   ++ +L FN   WF S +G I+A G+  GIYT+N+A+  ++++     QI+++++  Q++KI +I   +P++KA I+         KK+     Y WS+  S++ ++  D+   R ENV   +C  L+YTSGT G+PKGVMLSHDNI F ++ +V+    +      I+SYLPLSHVAA  +DI +   +   I+FA  DALKG+L K+L++ RPT F+GVPRVYEK QE++  + +S+                                   K L   KVKQ LG DR   +AS AAP+S +T ++F  +D+ I   +GMSE++G HTI   D   L  +G  + G E K  N D N  GE+C+RGRHVF+GY +  EKT+E+LD   WLHSGDLG VD +GY+ +TGR KE++ITAGGEN+ PV IE+ IK EL  ISN  LVG+++K+++ L+TLKT++D  +  P ++LS  +   ++S G+E K V D+L +     V KS I++A+ R N QS+S A  VQK+TILP DFS+  GELGPTLK+KR  V + Y D I+ +Y 
Sbjct:   52 LKRTVNNYGDYPALRTK-NGKNGYH-TVTYKQYEQKVHQVAKAFIKLGLEEHHSVGVLAFNCAEWFYSAMGAIHARGIIAGIYTTNSADAVQHVLESSHAQIVVVDDAKQMDKIHAIRDKLPKLKAAIQIQEPYSPYLKKEDGY--YRWSEIESMNVSDVEDQYMTRLENVAINECCCLVYTSGTVGMPKGVMLSHDNITFDVRGIVKAMDRVVVGAESIVSYLPLSHVAAQTVDIYTCAFVAGCIWFADKDALKGTLVKSLQDARPTRFMGVPRVYEKFQERMVAVASSSGSLKKMLASWAKGITLKHYMVSQGKSSGGFRYKIAKSLIMSKVKQALGFDRVLTLASAAAPMSPETKKYFLSLDLKIVDAFGMSETAGCHTICLPDSVGLNTIGKTLPGCESKFINKDANGHGELCIRGRHVFMGYIDNKEKTEESLDDDCWLHSGDLGFVDDKGYVSLTGRSKEIIITAGGENIPPVHIENTIKKELDAISNAFLVGEQRKYLTVLITLKTEVDKDSGEPLDELSHESSVWVKSLGVEHKTVSDILAAGPCPKVWKS-IEDAIKRANKQSISNAQKVQKFTILPHDFSIPTGELGPTLKVKRNVVSKMYADEIEKLYA 666          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Fly
Match: hll (gene:FBgn0286723 transcript:FBtr0080591)

HSP 1 Score: 395.971 bits (1016), Expect = 8.845e-126
Identity = 237/655 (36.18%), Postives = 367/655 (56.03%), Query Frame = 3
Query:  813 TKNVPEETIINRLKENVESQPNHVVLKHKSDPKKDYD--LSLTMKEYLEQITKAATGFITLGLEPKAAICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKILSILPGVPQVKAIIKYTGEVQEEAKKKSKIPIYTWSQFL-SIDSTNATDELHNRQENVKPKDCAVLIYTSGTTGLPKGVMLSHDNILFTLKMVQIHLE-LKKFQNIIISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKTLKEVRPTVFLGVPRVYEKIQEQLENLKASTNK-----------------------KLDSV--------------KVKQNLGLDRCEYIASGAAPISQQTLEFFQDIDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDENLIGEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIEAKEVEDLLN--------SNFAVLKST------------IDNAMNRVNAQSVSKAAYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMY 2594
            ++ VP +TI    KE+ E   +   L  ++ P    D   +LT  EY E++ +AA   +++G+E ++++ IL FN P WF +E G + AG V  G+Y SN+AE   +++   +  + ++++  Q+ K+ +I   +P++KA+I+  G    EA    +   ++W +      S+   +EL  R+  ++  +CA+LI+TSGT G+PK VMLSHDN++F  K    H++ ++  +   +SYLPLSHVAA + D+   +     + FA  DALKG+L KT ++ RPT   GVPRV+EK+QE+L   +A                           K  S+               +++ +G+D C    +G AP S++  +FF  +DI + + YGMSE+SG  T+   D   L   G   +GV LKI  PD N  GEI MRGR VF+GY    +KT+E +    WLHSGDLG +D +G L+++GR+KEL+ITAGGEN+ PV IE+ IK ELP +SNV+L+GD +K+++ LL+LKT  D+KT +P + L    I  L    I    + +LLN        ++ A L +T            I+  + R N  ++S A  VQK+ ++  +FS+  GELGPTLK++R  V  KY  VI+ +Y
Sbjct:   30 SQTVPPQTIPEFFKESCEKYSDLPALVWET-PGSGNDGWTTLTFGEYQERVEQAALMLLSVGVEERSSVGILAFNCPEWFFAEFGALRAGAVVAGVYPSNSAEAVHHVLATGESSVCVVDDAQQMAKLRAIKERLPRLKAVIQLHGPF--EAFVDHEPGYFSWQKLQEQTFSSELKEELLARESRIRANECAMLIFTSGTVGMPKAVMLSHDNLVFDTKSAAAHMQDIQVGKESFVSYLPLSHVAAQIFDVFLGLSHAGCVTFADKDALKGTLIKTFRKARPTKMFGVPRVFEKLQERLVAAEAKARPYSRLLLARARAAVAEHQTTLMAGKSPSIYGNAKYWLACRVVKPIREMIGVDNCRVFFTGGAPTSEELKQFFLGLDIALGECYGMSETSGAITL-NVDISNLYSAGQACEGVTLKIHEPDCNGQGEILMRGRLVFMGYLGLPDKTEETVKEDGWLHSGDLGYIDPKGNLIISGRLKELIITAGGENIPPVHIEELIKKELPCVSNVLLIGDHRKYLTVLLSLKTKCDAKTGIPLDALREETIEWLRDLDIHETRLSELLNIPADLQLPNDTAALAATLEITAKPKLLEAIEEGIKRANKYAISNAQKVQKFALIAHEFSVATGELGPTLKIRRNIVHAKYAKVIERLY 680          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Fly
Match: CG3961 (gene:FBgn0036821 transcript:FBtr0302322)

HSP 1 Score: 160.229 bits (404), Expect = 1.267e-40
Identity = 160/638 (25.08%), Postives = 276/638 (43.26%), Query Frame = 3
Query:  813 TKNVPEETIINRLKENVESQPNHVVLKHKSDPKKDYDLSLTMKEYLEQITKAATGFITLGLEPKAAICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKILSILPGVPQVKAIIKYTGEVQEEAKKKSKIPIYTWSQFLSIDSTNATDELHNRQENVKP--KDCAVLIYTSGTTGLPKGVMLSHDNILFTLKMVQIHLELKKFQ--NIIISYLPLSHVAANMLDIASTVGM---GSTIYFAQPDALKGSLGKTLKEVRPTVFLGVPRVYEKIQEQLEN-LKASTNK---------------------------KLDSVKVKQNLGLDRCEYIASGAAPISQQTLEFFQ-DIDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDE------NLIGEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIE--AKEVEDLLNSNFAVLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMY 2594
            T+NV   T+    +E   +  N   L  +      Y   +   E L +      G + LG  PK  I I   N P W + E G      V   +Y +   + C +I+     Q++I+E+D +   +L   P   ++   IK   +   E  +   I I++   F+ ++   A          V P  +D   + YTSGTTG PKGVML+H N++  +  V + +   + +  ++++S+LPL+H    M +     GM   G  + F   D  +  L   LK ++PTV   VPR+  ++ ++++N + AS  K                           KL   KV Q  G      +  G+AP++   L F +  +  L+ + YG +E +G  T+  + +     VG  +    +K+ +  E         GE+C+RG +VF GY+   EKT EA+DS+ W H+GD+G     G L +  R K +   + GE + P  IE NI +   +++ V + G+  K  SC++                + V     L+ +  E   +    +L +N  V +  +++ +N      +     V+   + P  FS++ G L PT K KR  +   ++  ++ MY
Sbjct:   48 TENV--RTLYQTFREGAYASNNGPCLGWRETLTSPYQW-INYDEALLRAKNFGAGMLALGARPKQLIGIYSQNRPEWILYEQGCYSFSLVVVPLYDTLGPDACAFIIRQTDMQVVIVEDDGKAAMLLEKAPRSLKIIVAIKPIRQTTLERARSRGIQIFS---FIDVEKLGAK----GNHPEVPPTAEDLCTVCYTSGTTGNPKGVMLTHGNVVAGVCSVILQMGDHRIRAGDVMVSFLPLAH----MFERCCENGMYYVGGCVGFYSGDIKE--LTNDLKMLKPTVMPAVPRLLNRVYDKIQNDISASGLKRGLFNMAMRAKEKEIARGVLRRNGCWDKLVFKKVHQAFG-GNLRLMVVGSAPLAGNVLTFMRCALGCLVLEGYGQTECTGAITLTVQGDHVPNHVGPPVSCNAVKLVDVPEMEYFANQNTGEVCVRGSNVFHGYYKDPEKTAEAIDSEGWHHTGDVGMWLPNGTLRIIDRRKHIFKLSQGEYIVPEKIE-NIYTLSQYVNQVYVYGESLK--SCIIA---------------VVVPDTDVLKQWATENNVRGTLSVLCNNKNVKELIMNDMLNWGKQSGLKSFEQVKDIYLHPDPFSVQNGLLTPTFKAKRPQLKSYFKPQLEDMY 650          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Fly
Match: CG3961 (gene:FBgn0036821 transcript:FBtr0333712)

HSP 1 Score: 160.229 bits (404), Expect = 1.693e-40
Identity = 160/638 (25.08%), Postives = 276/638 (43.26%), Query Frame = 3
Query:  813 TKNVPEETIINRLKENVESQPNHVVLKHKSDPKKDYDLSLTMKEYLEQITKAATGFITLGLEPKAAICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKILSILPGVPQVKAIIKYTGEVQEEAKKKSKIPIYTWSQFLSIDSTNATDELHNRQENVKP--KDCAVLIYTSGTTGLPKGVMLSHDNILFTLKMVQIHLELKKFQ--NIIISYLPLSHVAANMLDIASTVGM---GSTIYFAQPDALKGSLGKTLKEVRPTVFLGVPRVYEKIQEQLEN-LKASTNK---------------------------KLDSVKVKQNLGLDRCEYIASGAAPISQQTLEFFQ-DIDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDE------NLIGEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIE--AKEVEDLLNSNFAVLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMY 2594
            T+NV   T+    +E   +  N   L  +      Y   +   E L +      G + LG  PK  I I   N P W + E G      V   +Y +   + C +I+     Q++I+E+D +   +L   P   ++   IK   +   E  +   I I++   F+ ++   A          V P  +D   + YTSGTTG PKGVML+H N++  +  V + +   + +  ++++S+LPL+H    M +     GM   G  + F   D  +  L   LK ++PTV   VPR+  ++ ++++N + AS  K                           KL   KV Q  G      +  G+AP++   L F +  +  L+ + YG +E +G  T+  + +     VG  +    +K+ +  E         GE+C+RG +VF GY+   EKT EA+DS+ W H+GD+G     G L +  R K +   + GE + P  IE NI +   +++ V + G+  K  SC++                + V     L+ +  E   +    +L +N  V +  +++ +N      +     V+   + P  FS++ G L PT K KR  +   ++  ++ MY
Sbjct:   60 TENV--RTLYQTFREGAYASNNGPCLGWRETLTSPYQW-INYDEALLRAKNFGAGMLALGARPKQLIGIYSQNRPEWILYEQGCYSFSLVVVPLYDTLGPDACAFIIRQTDMQVVIVEDDGKAAMLLEKAPRSLKIIVAIKPIRQTTLERARSRGIQIFS---FIDVEKLGAK----GNHPEVPPTAEDLCTVCYTSGTTGNPKGVMLTHGNVVAGVCSVILQMGDHRIRAGDVMVSFLPLAH----MFERCCENGMYYVGGCVGFYSGDIKE--LTNDLKMLKPTVMPAVPRLLNRVYDKIQNDISASGLKRGLFNMAMRAKEKEIARGVLRRNGCWDKLVFKKVHQAFG-GNLRLMVVGSAPLAGNVLTFMRCALGCLVLEGYGQTECTGAITLTVQGDHVPNHVGPPVSCNAVKLVDVPEMEYFANQNTGEVCVRGSNVFHGYYKDPEKTAEAIDSEGWHHTGDVGMWLPNGTLRIIDRRKHIFKLSQGEYIVPEKIE-NIYTLSQYVNQVYVYGESLK--SCIIA---------------VVVPDTDVLKQWATENNVRGTLSVLCNNKNVKELIMNDMLNWGKQSGLKSFEQVKDIYLHPDPFSVQNGLLTPTFKAKRPQLKSYFKPQLEDMY 662          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Zebrafish
Match: acsbg2 (acyl-CoA synthetase bubblegum family member 2 [Source:ZFIN;Acc:ZDB-GENE-030131-7099])

HSP 1 Score: 534.643 bits (1376), Expect = 2.600e-178
Identity = 269/596 (45.13%), Postives = 380/596 (63.76%), Query Frame = 3
Query:  927 SLTMKEYLEQITKAATGFITLGLEPKAAICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKILSILPGVPQVKAIIKYTGEVQEEAKKKSKIPIYTWSQFLSIDSTNATDELHNRQENVKPKDCAVLIYTSGTTGLPKGVMLSHDNILFTLKMVQIHLELK---KFQNIIISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKTLKEVRPTVFLGVPRVYEKIQEQLENLKASTN-------------------------------------KKLDSVKVKQNLGLDRCEYIASGAAPISQQTLEFFQDIDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDENLIGEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIEAKEVEDLLNSNFAVLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMY 2594
            ++T  EY +    AA  F+ LGLE    + ILGFN   WFI+++  I AGG + GIYT+N+ E C+Y+  +C+  IL++EN  QL KIL I   +P +KAII+Y  E++E+     K  +YTW++F+ +       +L +   + KP  C  LIYTSGTTG PKGVMLSHDN+ +T      H+ L    K Q +++SYLPLSH+AA M+DI   +  G   YFAQPDALKGSL  TL+E+RPT FLGVPRV+EK+QE+++++ A ++                                     K L   KV++ LGLDRC    +GAAPI++ TLEFF  +DI + ++YGMSESSGPHTI + +  +L   G ++ G + K+ NPD+   GEIC  GRHVF+GY N  +KT+EALD++ WLHSGDLGK+D   +L +TGRIKEL+ITAGGEN+ PVPIED +K  +P ISN ML+GDK+KF+S LLT+K  ++ +T +P ++L+  A+      G     V ++       +++ I + +NRVN ++ S A  +QKWT+L +DFS+ GGELGPT+K+KR  VM+ Y++ I+S Y
Sbjct:  136 TMTYSEYYKSCRTAAKSFLKLGLERYHGVGILGFNSTEWFIADIAAILAGGFAVGIYTTNSPEACQYVAENCQANILVVENHKQLQKILQIQDKLPHLKAIIQYKDELKEK-----KPNLYTWAEFMELGRDEPDTQLDDIISSQKPNQCCTLIYTSGTTGQPKGVMLSHDNLTWTAVATSQHVSLNDADKLQEVVVSYLPLSHIAAQMIDIWLPMKAGGVTYFAQPDALKGSLANTLREIRPTAFLGVPRVWEKMQEKMKSIGAKSSTVRRKVASWAKDVGLQTNLNKMELGSNSRKPLNYRLAKHLVFRKVRKALGLDRCTRCYTGAAPITKDTLEFFLSLDIPLFELYGMSESSGPHTITQANAFRLTSCGKVIPGCKTKLSNPDDEKNGEICFWGRHVFMGYLNMPDKTEEALDAEGWLHSGDLGKLDENNFLFITGRIKELIITAGGENIPPVPIEDAVKEAIPLISNAMLIGDKRKFLSMLLTVKCQINGETGVPEDELTPEAVEFCRKLGSSCTRVTEIAGGRDRAVQAAIQDGINRVNEKATSNAQRIQKWTVLDQDFSIPGGELGPTMKLKRPVVMKMYKEQIESFY 726          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Zebrafish
Match: acsbg2 (acyl-CoA synthetase bubblegum family member 2 [Source:ZFIN;Acc:ZDB-GENE-030131-7099])

HSP 1 Score: 535.413 bits (1378), Expect = 6.549e-178
Identity = 269/596 (45.13%), Postives = 380/596 (63.76%), Query Frame = 3
Query:  927 SLTMKEYLEQITKAATGFITLGLEPKAAICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKILSILPGVPQVKAIIKYTGEVQEEAKKKSKIPIYTWSQFLSIDSTNATDELHNRQENVKPKDCAVLIYTSGTTGLPKGVMLSHDNILFTLKMVQIHLELK---KFQNIIISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKTLKEVRPTVFLGVPRVYEKIQEQLENLKASTN-------------------------------------KKLDSVKVKQNLGLDRCEYIASGAAPISQQTLEFFQDIDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDENLIGEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIEAKEVEDLLNSNFAVLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMY 2594
            ++T  EY +    AA  F+ LGLE    + ILGFN   WFI+++  I AGG + GIYT+N+ E C+Y+  +C+  IL++EN  QL KIL I   +P +KAII+Y  E++E+     K  +YTW++F+ +       +L +   + KP  C  LIYTSGTTG PKGVMLSHDN+ +T      H+ L    K Q +++SYLPLSH+AA M+DI   +  G   YFAQPDALKGSL  TL+E+RPT FLGVPRV+EK+QE+++++ A ++                                     K L   KV++ LGLDRC    +GAAPI++ TLEFF  +DI + ++YGMSESSGPHTI + +  +L   G ++ G + K+ NPD+   GEIC  GRHVF+GY N  +KT+EALD++ WLHSGDLGK+D   +L +TGRIKEL+ITAGGEN+ PVPIED +K  +P ISN ML+GDK+KF+S LLT+K  ++ +T +P ++L+  A+      G     V ++       +++ I + +NRVN ++ S A  +QKWT+L +DFS+ GGELGPT+K+KR  VM+ Y++ I+S Y
Sbjct:  188 TMTYSEYYKSCRTAAKSFLKLGLERYHGVGILGFNSTEWFIADIAAILAGGFAVGIYTTNSPEACQYVAENCQANILVVENHKQLQKILQIQDKLPHLKAIIQYKDELKEK-----KPNLYTWAEFMELGRDEPDTQLDDIISSQKPNQCCTLIYTSGTTGQPKGVMLSHDNLTWTAVATSQHVSLNDADKLQEVVVSYLPLSHIAAQMIDIWLPMKAGGVTYFAQPDALKGSLANTLREIRPTAFLGVPRVWEKMQEKMKSIGAKSSTVRRKVASWAKDVGLQTNLNKMELGSNSRKPLNYRLAKHLVFRKVRKALGLDRCTRCYTGAAPITKDTLEFFLSLDIPLFELYGMSESSGPHTITQANAFRLTSCGKVIPGCKTKLSNPDDEKNGEICFWGRHVFMGYLNMPDKTEEALDAEGWLHSGDLGKLDENNFLFITGRIKELIITAGGENIPPVPIEDAVKEAIPLISNAMLIGDKRKFLSMLLTVKCQINGETGVPEDELTPEAVEFCRKLGSSCTRVTEIAGGRDRAVQAAIQDGINRVNEKATSNAQRIQKWTVLDQDFSIPGGELGPTMKLKRPVVMKMYKEQIESFY 778          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Zebrafish
Match: acsbg1 (acyl-CoA synthetase bubblegum family member 1 [Source:ZFIN;Acc:ZDB-GENE-110914-219])

HSP 1 Score: 460.299 bits (1183), Expect = 1.906e-150
Identity = 247/632 (39.08%), Postives = 378/632 (59.81%), Query Frame = 3
Query:  816 KNVPEE--TIINRLKENVESQPNHVVLKHKSDPKKDYDLSLTMKEYLEQITKAATGFITLGLEPKAAICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKILSILPGVPQVKAIIKYTGEVQEEAKKKSKIPIYTWSQFLSIDSTNATDELHNRQENVKPKDCAVLIYTSGTTGLPKGVMLSHDNILFTLKMVQIHLELKKF---QNIIISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKTLKEVRPTVFLGVPRVYEKIQEQL--------------------------ENLKASTNK--------KLDSVKVKQNLGLDRCEYIASGAAPISQQTLEFFQDIDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDENLIGEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIEAKEVEDLLNSNFAVLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMY 2594
            ++ PE+  T+      +V+   N   L  K   K +     T  EY      AA GF+ LGLE    + ILGFN   WFI+ +G ++AGG+  GIYT+N+ + C ++  D +  ++++EN  QL+KI+ +   +P +KAI++Y+G ++E+        +Y+W +F+ +    +  EL       +   C VLIYTSGTTG PKGVMLSHDNI +T        +++     Q  ++SYLPLSH+AA + D+ + +  G  I FAQPDALKG+L  +L+EV PT  +GVPRV+EKI E++                          + LK    K        KL   K++  LG   C    SGAAPI ++TL+FF  ++I +++ YGMSE+SGPH +   +  +    G ++ G + K+ N + +  GE+C  GR+VF+G+ N  +KTKEALD   WL SGDLGKVD +G++ + GRIKEL+ITAGGEN+ P+PIED +K EL  ISN ML+GD++KF+S LLTLK  ++ +T  PT+ LS+ A+   +  G ++ ++ D+      ++  +I++ + +VN+++ S A  +QKWTIL +DFS+ GGELGPT+K++R  V++ Y + I++ Y
Sbjct:   49 EHCPEQPITVHQMFYNSVQKYGNLTALASKRGNKWE---KATFLEYYHLCRMAAKGFLKLGLEQFHGVAILGFNSAEWFIAAVGTVFAGGIMAGIYTTNSPDACLHVANDSRANVIVVENQKQLDKIMQVKDKLPHLKAIVQYSGSLKEKLAN-----LYSWEEFMELGLEVSDHELDEVISKQRANQCCVLIYTSGTTGSPKGVMLSHDNITWTAHHASRAGDMQPAEIRQESLVSYLPLSHIAAQIYDLWTGIKWGEQISFAQPDALKGTLVDSLREVTPTAHMGVPRVWEKIMEKIKEGISRCGYMKRKMVTWAMSVSLDANQRLKKDEEKSFLFTLAEKLILQKLRAELGFSSCVKFFSGAAPIGRETLQFFLGLNIRLYEAYGMSETSGPHFMSGPEAYQFLSCGKVVPGCQYKLININADGSGEVCFWGRNVFMGFLNLEDKTKEALDEDGWLRSGDLGKVDEDGFIYINGRIKELIITAGGENIPPLPIEDAVKQELSIISNAMLIGDERKFLSMLLTLKCTVNPETTEPTDILSLEAVEFCQRIGSQSTKLSDITGGKDKLVYKSIEDGIGQVNSKATSNAQRIQKWTILDKDFSVAGGELGPTMKLRRPVVLQMYHNEIENFY 672          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Zebrafish
Match: acsl5 (acyl-CoA synthetase long chain family member 5 [Source:ZFIN;Acc:ZDB-GENE-040912-169])

HSP 1 Score: 160.999 bits (406), Expect = 1.330e-40
Identity = 167/599 (27.88%), Postives = 269/599 (44.91%), Query Frame = 3
Query:  930 LTMKEYLEQITKAATGFITLGLEPK--AAICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKIL--SILPGVPQVKAIIKYTGEVQEEAKKKSKIPIYTWSQFLSIDSTNATDEL-HNRQENVKPKDCAVLIYTSGTTGLPKGVMLSHDNILFTLKMVQIHLE---LKKFQNIIISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKTLKEVRPTVFLGVPR----VYEKIQEQLEN------LKASTNKKLDSVK-----------------VKQNLGLDRCEYIASGAAPISQQTLEFFQD-IDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDE------NLIGEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIEAKEVEDLLNSNFAVLKSTIDNAMNRVNAQSVSKA-AYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMYT 2597
            L  K+  ++     +G I  G +P     I I   N P W I+EL       V+  +Y +   E   +I+       +I +  D+   +L  S     P +K II          ++ SKI +      LS+    A  +  H+R    KP+D +++ +TSGTTG PKG ML+H+N++     V    E   +    ++ IS+LPL+H+   ++      G+G  + F Q D     L   +K ++PTVF  VPR    VY+K+Q   +       L  +  KK   VK                 V+++LG  R   + +GAAPIS   L F +  +   I + YG +E +   +     + K G VG  +    +K+ + +E      N  GEIC++G +VF GY    EKT EALD   WLH+GD+GK    G L +  R K +   A GE +AP  IE+      P ++ V + G+  +  S L+ +            EKL +               +E+L  +    LK  I + +N++  ++  K+   V+   + P  F+++ G L PTLK KR  + + +   I+S+Y 
Sbjct:  106 LKYKQVSDRAEFLGSGLIHRGQKPSQDTFIGIFAQNRPEWIIAELACYTYSMVAVPLYDTLGPEALVFIINRANISTVICDKKDKAETLLDNSEKKLTPLLKTIILMDSYDSALTERGSKIGL----DVLSLKDVEALGKNNHHRPVPPKPEDLSIICFTSGTTGDPKGAMLTHENVVADAAGVVRTFESVFVPVPSDVSISFLPLAHMFERVVQTV-LYGVGGRVGFFQGDIR--LLPDDMKALQPTVFPVVPRLLNRVYDKVQSGAKTPFKKWLLNFAIEKKCAEVKQGIIRNDSMWDKLIFHKVQESLG-GRVRVMVTGAAPISPSVLTFLRACLGCQIFEAYGQTECTAACSFTIPGDWKTGHVGAPIPCNTIKLVDVEEMDYFASNGEGEICVKGTNVFRGYLGDPEKTAEALDKDGWLHTGDIGKWLPSGVLKIIDRKKNIFKLAQGEYIAPEKIENVYIRSAP-VAQVFVHGESLQ--SSLVAIVVPDPEVLPGFAEKLGLKG------------SLEELCRNQ--ELKKAIISDLNKLGREAGLKSFEQVKDLYLHPDMFTIENGLLTPTLKAKRADLTKYFRVQIESLYA 679          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Zebrafish
Match: acsl5 (acyl-CoA synthetase long chain family member 5 [Source:ZFIN;Acc:ZDB-GENE-040912-169])

HSP 1 Score: 160.999 bits (406), Expect = 1.330e-40
Identity = 167/599 (27.88%), Postives = 269/599 (44.91%), Query Frame = 3
Query:  930 LTMKEYLEQITKAATGFITLGLEPK--AAICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKIL--SILPGVPQVKAIIKYTGEVQEEAKKKSKIPIYTWSQFLSIDSTNATDEL-HNRQENVKPKDCAVLIYTSGTTGLPKGVMLSHDNILFTLKMVQIHLE---LKKFQNIIISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKTLKEVRPTVFLGVPR----VYEKIQEQLEN------LKASTNKKLDSVK-----------------VKQNLGLDRCEYIASGAAPISQQTLEFFQD-IDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDE------NLIGEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIEAKEVEDLLNSNFAVLKSTIDNAMNRVNAQSVSKA-AYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMYT 2597
            L  K+  ++     +G I  G +P     I I   N P W I+EL       V+  +Y +   E   +I+       +I +  D+   +L  S     P +K II          ++ SKI +      LS+    A  +  H+R    KP+D +++ +TSGTTG PKG ML+H+N++     V    E   +    ++ IS+LPL+H+   ++      G+G  + F Q D     L   +K ++PTVF  VPR    VY+K+Q   +       L  +  KK   VK                 V+++LG  R   + +GAAPIS   L F +  +   I + YG +E +   +     + K G VG  +    +K+ + +E      N  GEIC++G +VF GY    EKT EALD   WLH+GD+GK    G L +  R K +   A GE +AP  IE+      P ++ V + G+  +  S L+ +            EKL +               +E+L  +    LK  I + +N++  ++  K+   V+   + P  F+++ G L PTLK KR  + + +   I+S+Y 
Sbjct:  106 LKYKQVSDRAEFLGSGLIHRGQKPSQDTFIGIFAQNRPEWIIAELACYTYSMVAVPLYDTLGPEALVFIINRANISTVICDKKDKAETLLDNSEKKLTPLLKTIILMDSYDSALTERGSKIGL----DVLSLKDVEALGKNNHHRPVPPKPEDLSIICFTSGTTGDPKGAMLTHENVVADAAGVVRTFESVFVPVPSDVSISFLPLAHMFERVVQTV-LYGVGGRVGFFQGDIR--LLPDDMKALQPTVFPVVPRLLNRVYDKVQSGAKTPFKKWLLNFAIEKKCAEVKQGIIRNDSMWDKLIFHKVQESLG-GRVRVMVTGAAPISPSVLTFLRACLGCQIFEAYGQTECTAACSFTIPGDWKTGHVGAPIPCNTIKLVDVEEMDYFASNGEGEICVKGTNVFRGYLGDPEKTAEALDKDGWLHTGDIGKWLPSGVLKIIDRKKNIFKLAQGEYIAPEKIENVYIRSAP-VAQVFVHGESLQ--SSLVAIVVPDPEVLPGFAEKLGLKG------------SLEELCRNQ--ELKKAIISDLNKLGREAGLKSFEQVKDLYLHPDMFTIENGLLTPTLKAKRADLTKYFRVQIESLYA 679          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Xenopus
Match: acsbg2 (acyl-CoA synthetase bubblegum family member 2 [Source:NCBI gene;Acc:100158533])

HSP 1 Score: 535.028 bits (1377), Expect = 2.251e-179
Identity = 285/635 (44.88%), Postives = 397/635 (62.52%), Query Frame = 3
Query:  804 DDETKNVPEETIINRLKENVESQPNHVVLKHKSDPKKDYDLSLTMKEYLEQITKAATGFITLGLEPKAAICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKILSILPGVPQVKAIIKYTGEVQEEAKKKSKIPIYTWSQFLSIDSTNATDELHNRQENVKPKDCAVLIYTSGTTGLPKGVMLSHDNILFTL----KMVQIHLELKKFQNIIISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKTLKEVRPTVFLGVPRVYEKIQEQLENLKASTN----------------------------------KKLDSVKVKQNLGLDRCEYIASGAAPISQQTLEFFQDIDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDENLIGEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIEAKEVEDLLNSNFAVLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMY 2594
            D    ++P  TI    ++ V+   ++V L  K   + D    +T ++Y EQ   AA GF+ LGLE    + ILGFN   WFI+++G I+AGG + GIYT+N+AE C Y+  +C+  I+++EN  QL KIL I   +P +KAII+Y  E++E+     +  +YTW +F+ +       +L     + KP  C  LIYTSGTTG PKGVMLSHDNI +T     K V++  E    Q I++SYLPLSH+AA M+DI  T+  G   YFAQPDALKGSL  TL+EVRPT F+GVPRV+EK+QE+++ + A ++                                  KKL   KV++ LGLDRC    +GAAPI++ TLEFF  ++I ++++YGMSESSGPHTI   D  ++   G ++ G + KI  PD +  GEI   GRHVF+GY N  +KT+E+LD + WLHSGD+GK D  G+L +TGRIKEL+ITAGGEN+ PVPIED +K ++P ISN M++GDKKKF+S LLTLK ++++ T  P ++L+  AI      G +A  V D++      + + I + +N VN ++ S A  VQKW IL +DFS+ GGELGPT+K+KR  V + Y+D I S Y
Sbjct:   18 DSGVASLPPVTIHQLFQDTVKKYGDYVALASK---QGDQWHKMTYEQYYEQCRIAAKGFLKLGLERYHGVGILGFNSAEWFIADVGAIFAGGFAVGIYTTNSAEACHYVAQNCEANIIVVENQKQLQKILQIQDQLPHLKAIIQYKDELKEK-----RPNLYTWKEFMQLGKDIPDSQLDQIISSQKPNQCCTLIYTSGTTGQPKGVMLSHDNITWTAASAGKTVRLR-EATDMQEIVVSYLPLSHIAAQMIDIWLTMKHGGATYFAQPDALKGSLANTLREVRPTAFMGVPRVWEKMQEKMKAVGAKSSTIKRKVATWAKGVGLETNLKKMNGTHILKRYHVAKKLVFKKVRKALGLDRCTKCYTGAAPITKDTLEFFLSLNIPVYELYGMSESSGPHTISLPDAFRITSCGKVISGCKTKIHQPDNDGSGEILFWGRHVFMGYLNMEDKTQESLDEEGWLHSGDIGKHDENGFLYITGRIKELIITAGGENIPPVPIEDALKEQVPIISNAMVIGDKKKFLSMLLTLKCNVNADTGEPEDELTPEAIEFCRQIGSKATLVSDIVGGKDTAVYAAIQDGVNSVNQKATSNAQKVQKWLILDQDFSIAGGELGPTMKLKRPVVAKMYKDQIDSFY 643          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Xenopus
Match: acsbg2 (acyl-CoA synthetase bubblegum family member 2 [Source:NCBI gene;Acc:100158533])

HSP 1 Score: 534.643 bits (1376), Expect = 2.617e-179
Identity = 285/635 (44.88%), Postives = 397/635 (62.52%), Query Frame = 3
Query:  804 DDETKNVPEETIINRLKENVESQPNHVVLKHKSDPKKDYDLSLTMKEYLEQITKAATGFITLGLEPKAAICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKILSILPGVPQVKAIIKYTGEVQEEAKKKSKIPIYTWSQFLSIDSTNATDELHNRQENVKPKDCAVLIYTSGTTGLPKGVMLSHDNILFTL----KMVQIHLELKKFQNIIISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKTLKEVRPTVFLGVPRVYEKIQEQLENLKASTN----------------------------------KKLDSVKVKQNLGLDRCEYIASGAAPISQQTLEFFQDIDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDENLIGEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIEAKEVEDLLNSNFAVLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMY 2594
            D    ++P  TI    ++ V+   ++V L  K   + D    +T ++Y EQ   AA GF+ LGLE    + ILGFN   WFI+++G I+AGG + GIYT+N+AE C Y+  +C+  I+++EN  QL KIL I   +P +KAII+Y  E++E+     +  +YTW +F+ +       +L     + KP  C  LIYTSGTTG PKGVMLSHDNI +T     K V++  E    Q I++SYLPLSH+AA M+DI  T+  G   YFAQPDALKGSL  TL+EVRPT F+GVPRV+EK+QE+++ + A ++                                  KKL   KV++ LGLDRC    +GAAPI++ TLEFF  ++I ++++YGMSESSGPHTI   D  ++   G ++ G + KI  PD +  GEI   GRHVF+GY N  +KT+E+LD + WLHSGD+GK D  G+L +TGRIKEL+ITAGGEN+ PVPIED +K ++P ISN M++GDKKKF+S LLTLK ++++ T  P ++L+  AI      G +A  V D++      + + I + +N VN ++ S A  VQKW IL +DFS+ GGELGPT+K+KR  V + Y+D I S Y
Sbjct:   17 DSGVASLPPVTIHQLFQDTVKKYGDYVALASK---QGDQWHKMTYEQYYEQCRIAAKGFLKLGLERYHGVGILGFNSAEWFIADVGAIFAGGFAVGIYTTNSAEACHYVAQNCEANIIVVENQKQLQKILQIQDQLPHLKAIIQYKDELKEK-----RPNLYTWKEFMQLGKDIPDSQLDQIISSQKPNQCCTLIYTSGTTGQPKGVMLSHDNITWTAASAGKTVRLR-EATDMQEIVVSYLPLSHIAAQMIDIWLTMKHGGATYFAQPDALKGSLANTLREVRPTAFMGVPRVWEKMQEKMKAVGAKSSTIKRKVATWAKGVGLETNLKKMNGTHILKRYHVAKKLVFKKVRKALGLDRCTKCYTGAAPITKDTLEFFLSLNIPVYELYGMSESSGPHTISLPDAFRITSCGKVISGCKTKIHQPDNDGSGEILFWGRHVFMGYLNMEDKTQESLDEEGWLHSGDIGKHDENGFLYITGRIKELIITAGGENIPPVPIEDALKEQVPIISNAMVIGDKKKFLSMLLTLKCNVNADTGEPEDELTPEAIEFCRQIGSKATLVSDIVGGKDTAVYAAIQDGVNSVNQKATSNAQKVQKWLILDQDFSIAGGELGPTMKLKRPVVAKMYKDQIDSFY 642          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Xenopus
Match: acsbg2 (acyl-CoA synthetase bubblegum family member 2 [Source:NCBI gene;Acc:100158533])

HSP 1 Score: 534.643 bits (1376), Expect = 4.942e-179
Identity = 285/635 (44.88%), Postives = 397/635 (62.52%), Query Frame = 3
Query:  804 DDETKNVPEETIINRLKENVESQPNHVVLKHKSDPKKDYDLSLTMKEYLEQITKAATGFITLGLEPKAAICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKILSILPGVPQVKAIIKYTGEVQEEAKKKSKIPIYTWSQFLSIDSTNATDELHNRQENVKPKDCAVLIYTSGTTGLPKGVMLSHDNILFTL----KMVQIHLELKKFQNIIISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKTLKEVRPTVFLGVPRVYEKIQEQLENLKASTN----------------------------------KKLDSVKVKQNLGLDRCEYIASGAAPISQQTLEFFQDIDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDENLIGEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIEAKEVEDLLNSNFAVLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMY 2594
            D    ++P  TI    ++ V+   ++V L  K   + D    +T ++Y EQ   AA GF+ LGLE    + ILGFN   WFI+++G I+AGG + GIYT+N+AE C Y+  +C+  I+++EN  QL KIL I   +P +KAII+Y  E++E+     +  +YTW +F+ +       +L     + KP  C  LIYTSGTTG PKGVMLSHDNI +T     K V++  E    Q I++SYLPLSH+AA M+DI  T+  G   YFAQPDALKGSL  TL+EVRPT F+GVPRV+EK+QE+++ + A ++                                  KKL   KV++ LGLDRC    +GAAPI++ TLEFF  ++I ++++YGMSESSGPHTI   D  ++   G ++ G + KI  PD +  GEI   GRHVF+GY N  +KT+E+LD + WLHSGD+GK D  G+L +TGRIKEL+ITAGGEN+ PVPIED +K ++P ISN M++GDKKKF+S LLTLK ++++ T  P ++L+  AI      G +A  V D++      + + I + +N VN ++ S A  VQKW IL +DFS+ GGELGPT+K+KR  V + Y+D I S Y
Sbjct:   34 DSGVASLPPVTIHQLFQDTVKKYGDYVALASK---QGDQWHKMTYEQYYEQCRIAAKGFLKLGLERYHGVGILGFNSAEWFIADVGAIFAGGFAVGIYTTNSAEACHYVAQNCEANIIVVENQKQLQKILQIQDQLPHLKAIIQYKDELKEK-----RPNLYTWKEFMQLGKDIPDSQLDQIISSQKPNQCCTLIYTSGTTGQPKGVMLSHDNITWTAASAGKTVRLR-EATDMQEIVVSYLPLSHIAAQMIDIWLTMKHGGATYFAQPDALKGSLANTLREVRPTAFMGVPRVWEKMQEKMKAVGAKSSTIKRKVATWAKGVGLETNLKKMNGTHILKRYHVAKKLVFKKVRKALGLDRCTKCYTGAAPITKDTLEFFLSLNIPVYELYGMSESSGPHTISLPDAFRITSCGKVISGCKTKIHQPDNDGSGEILFWGRHVFMGYLNMEDKTQESLDEEGWLHSGDIGKHDENGFLYITGRIKELIITAGGENIPPVPIEDALKEQVPIISNAMVIGDKKKFLSMLLTLKCNVNADTGEPEDELTPEAIEFCRQIGSKATLVSDIVGGKDTAVYAAIQDGVNSVNQKATSNAQKVQKWLILDQDFSIAGGELGPTMKLKRPVVAKMYKDQIDSFY 659          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Xenopus
Match: acsbg2 (acyl-CoA synthetase bubblegum family member 2 [Source:NCBI gene;Acc:100158533])

HSP 1 Score: 534.258 bits (1375), Expect = 7.198e-179
Identity = 285/636 (44.81%), Postives = 397/636 (62.42%), Query Frame = 3
Query:  804 DDETKNVPEETIINRLKENVESQPNHVVLKHKSDPKKDYDLSLTMKEYLEQITKAATGFITLGLEPKAAICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKILSILPGVPQVKAIIKYTGEVQEEAKKKSKIPIYTWSQFLSIDSTNATDELHNRQENVKPKDCAVLIYTSGTTGLPKGVMLSHDNILFTL----KMVQIHLELKKFQNIIISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKTLKEVRPTVFLGVPRVYEKIQEQLENLKASTN-----------------------------------KKLDSVKVKQNLGLDRCEYIASGAAPISQQTLEFFQDIDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDENLIGEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIEAKEVEDLLNSNFAVLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMY 2594
            D    ++P  TI    ++ V+   ++V L  K   + D    +T ++Y EQ   AA GF+ LGLE    + ILGFN   WFI+++G I+AGG + GIYT+N+AE C Y+  +C+  I+++EN  QL KIL I   +P +KAII+Y  E++E+     +  +YTW +F+ +       +L     + KP  C  LIYTSGTTG PKGVMLSHDNI +T     K V++  E    Q I++SYLPLSH+AA M+DI  T+  G   YFAQPDALKGSL  TL+EVRPT F+GVPRV+EK+QE+++ + A ++                                   KKL   KV++ LGLDRC    +GAAPI++ TLEFF  ++I ++++YGMSESSGPHTI   D  ++   G ++ G + KI  PD +  GEI   GRHVF+GY N  +KT+E+LD + WLHSGD+GK D  G+L +TGRIKEL+ITAGGEN+ PVPIED +K ++P ISN M++GDKKKF+S LLTLK ++++ T  P ++L+  AI      G +A  V D++      + + I + +N VN ++ S A  VQKW IL +DFS+ GGELGPT+K+KR  V + Y+D I S Y
Sbjct:   38 DSGVASLPPVTIHQLFQDTVKKYGDYVALASK---QGDQWHKMTYEQYYEQCRIAAKGFLKLGLERYHGVGILGFNSAEWFIADVGAIFAGGFAVGIYTTNSAEACHYVAQNCEANIIVVENQKQLQKILQIQDQLPHLKAIIQYKDELKEK-----RPNLYTWKEFMQLGKDIPDSQLDQIISSQKPNQCCTLIYTSGTTGQPKGVMLSHDNITWTAASAGKTVRLR-EATDMQEIVVSYLPLSHIAAQMIDIWLTMKHGGATYFAQPDALKGSLANTLREVRPTAFMGVPRVWEKMQEKMKAVGAKSSTIKRKVATWAKGVGLETNLKKMNGSTPHPMKYHVAKKLVFKKVRKALGLDRCTKCYTGAAPITKDTLEFFLSLNIPVYELYGMSESSGPHTISLPDAFRITSCGKVISGCKTKIHQPDNDGSGEILFWGRHVFMGYLNMEDKTQESLDEEGWLHSGDIGKHDENGFLYITGRIKELIITAGGENIPPVPIEDALKEQVPIISNAMVIGDKKKFLSMLLTLKCNVNADTGEPEDELTPEAIEFCRQIGSKATLVSDIVGGKDTAVYAAIQDGVNSVNQKATSNAQKVQKWLILDQDFSIAGGELGPTMKLKRPVVAKMYKDQIDSFY 664          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Xenopus
Match: acsbg2 (acyl-CoA synthetase bubblegum family member 2 [Source:NCBI gene;Acc:100158533])

HSP 1 Score: 534.643 bits (1376), Expect = 1.042e-178
Identity = 285/636 (44.81%), Postives = 397/636 (62.42%), Query Frame = 3
Query:  804 DDETKNVPEETIINRLKENVESQPNHVVLKHKSDPKKDYDLSLTMKEYLEQITKAATGFITLGLEPKAAICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKILSILPGVPQVKAIIKYTGEVQEEAKKKSKIPIYTWSQFLSIDSTNATDELHNRQENVKPKDCAVLIYTSGTTGLPKGVMLSHDNILFTL----KMVQIHLELKKFQNIIISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKTLKEVRPTVFLGVPRVYEKIQEQLENLKASTN-----------------------------------KKLDSVKVKQNLGLDRCEYIASGAAPISQQTLEFFQDIDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDENLIGEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIEAKEVEDLLNSNFAVLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMY 2594
            D    ++P  TI    ++ V+   ++V L  K   + D    +T ++Y EQ   AA GF+ LGLE    + ILGFN   WFI+++G I+AGG + GIYT+N+AE C Y+  +C+  I+++EN  QL KIL I   +P +KAII+Y  E++E+     +  +YTW +F+ +       +L     + KP  C  LIYTSGTTG PKGVMLSHDNI +T     K V++  E    Q I++SYLPLSH+AA M+DI  T+  G   YFAQPDALKGSL  TL+EVRPT F+GVPRV+EK+QE+++ + A ++                                   KKL   KV++ LGLDRC    +GAAPI++ TLEFF  ++I ++++YGMSESSGPHTI   D  ++   G ++ G + KI  PD +  GEI   GRHVF+GY N  +KT+E+LD + WLHSGD+GK D  G+L +TGRIKEL+ITAGGEN+ PVPIED +K ++P ISN M++GDKKKF+S LLTLK ++++ T  P ++L+  AI      G +A  V D++      + + I + +N VN ++ S A  VQKW IL +DFS+ GGELGPT+K+KR  V + Y+D I S Y
Sbjct:   60 DSGVASLPPVTIHQLFQDTVKKYGDYVALASK---QGDQWHKMTYEQYYEQCRIAAKGFLKLGLERYHGVGILGFNSAEWFIADVGAIFAGGFAVGIYTTNSAEACHYVAQNCEANIIVVENQKQLQKILQIQDQLPHLKAIIQYKDELKEK-----RPNLYTWKEFMQLGKDIPDSQLDQIISSQKPNQCCTLIYTSGTTGQPKGVMLSHDNITWTAASAGKTVRLR-EATDMQEIVVSYLPLSHIAAQMIDIWLTMKHGGATYFAQPDALKGSLANTLREVRPTAFMGVPRVWEKMQEKMKAVGAKSSTIKRKVATWAKGVGLETNLKKMNGSTPHPMKYHVAKKLVFKKVRKALGLDRCTKCYTGAAPITKDTLEFFLSLNIPVYELYGMSESSGPHTISLPDAFRITSCGKVISGCKTKIHQPDNDGSGEILFWGRHVFMGYLNMEDKTQESLDEEGWLHSGDIGKHDENGFLYITGRIKELIITAGGENIPPVPIEDALKEQVPIISNAMVIGDKKKFLSMLLTLKCNVNADTGEPEDELTPEAIEFCRQIGSKATLVSDIVGGKDTAVYAAIQDGVNSVNQKATSNAQKVQKWLILDQDFSIAGGELGPTMKLKRPVVAKMYKDQIDSFY 686          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Mouse
Match: Acsbg2 (acyl-CoA synthetase bubblegum family member 2 [Source:MGI Symbol;Acc:MGI:3587728])

HSP 1 Score: 480.715 bits (1236), Expect = 2.512e-158
Identity = 268/626 (42.81%), Postives = 377/626 (60.22%), Query Frame = 3
Query:  834 TIINRLKENVESQPNHVVLKHKSDPKKDYDLSLTMKEYLEQITKAATGFITLGLEPKAAICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKILSILPG-VPQVKAIIKYTGEVQEEAKKKSKIPIYTWSQFLSIDSTNATDELHNRQENVKPKDCAVLIYTSGTTGLPKGVMLSHDNILFTLKMVQIHLELKKF---QNIIISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKTLKEVRPTVFLGVPRVYEKIQEQL-ENLKASTN----------------------------------KKLDSVKVKQNLGLDRCEYIASGAAPISQQTLEFFQDIDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDENLIGEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIEAKEVEDLLNSNFAVLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMY 2594
            TI    +E+ E    +  L  K+  K D   +LT  +Y E   KAA   I LGL+    + ILGFN   W ++ LG I AGG+  GIY +N+AE C+Y++      ILI+END QL KIL I P  +  VKAI++Y   + E     S   +Y+W+ F+ + +     +L     + K   CAV++YTSGTTG PKGV+LSHDNI +T   +   +E+ +    QN I+SYLPLSH+AA + DI   + +G+  +FAQPDAL+G+L  TL+EV+PT+F+GVPR++EK+Q+ + EN+  S+                                   K L   KV+ +LGLD C    S A+P+SQ   EFF  +DI I +IYGMSE SGPHT+  K   ++   G ++ G +  + N ++  +GE+CM GRHVF+GY N  E T EALD   WLHSGD+G++D   +L +TGRIKE+LITAGGENV+P+PIE  +K ++P IS+ MLVGDK KF+  LLTLK + D K+  P  KLSV A    +  G +A  V D+L S   V+ + I   ++ VN Q++S +  ++KW IL +DFS++GGELGPT K+KR  + +KY+  I SMY
Sbjct:   48 TIPELFQESAERFSAYPALASKNGKKWD---TLTFSQYYEMCRKAAKSLIKLGLQRFQCVGILGFNSVEWVVTALGTILAGGLCVGIYATNSAEACQYVIQQANVSILIVENDQQLQKILLIPPDKMETVKAIVQYKLPLME-----SMANLYSWNDFMELGNDIPNIQLDRVILSQKANQCAVILYTSGTTGTPKGVLLSHDNITWTAGAMSQEMEINRVSGKQNTIVSYLPLSHIAAQLTDIWIPIKIGALTFFAQPDALRGTLVYTLQEVKPTLFMGVPRIWEKMQDTIKENVARSSRLRKKAFAWAKMLGLKVNTKRMLGKRDIPMNYRMAKALVFAKVRTSLGLDNCHAFFSSASPLSQDVSEFFLSLDIPIGEIYGMSECSGPHTVSNKSVYRVLSCGKVLSGCKNMLYNQNKEGVGEVCMWGRHVFMGYLNKEEATLEALDENGWLHSGDIGRLDSHDFLYITGRIKEILITAGGENVSPIPIETLVKEKIPIISHAMLVGDKAKFLCMLLTLKCETDRKSGEPLNKLSVEAKSFCQMLGSQATTVSDILKSRDQVVYTAIQYGIDIVNQQAMSDSHRIRKWIILEKDFSIQGGELGPTSKLKRSVITQKYKAQIDSMY 665          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Mouse
Match: Acsbg1 (acyl-CoA synthetase bubblegum family member 1 [Source:MGI Symbol;Acc:MGI:2385656])

HSP 1 Score: 470.7 bits (1210), Expect = 8.960e-154
Identity = 243/599 (40.57%), Postives = 368/599 (61.44%), Query Frame = 3
Query:  909 KKDYDLSLTMKEYLEQITKAATGFITLGLEPKAAICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKILSILPGVPQVKAIIKYTGEVQEEAKKKSKIPIYTWSQFLSIDSTNATDELHNRQENVKPKDCAVLIYTSGTTGLPKGVMLSHDNILFTLKMVQIHLELKKF---QNIIISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKTLKEVRPTVFLGVPRVYEKIQEQLE-------------------------------NLKASTNKKLDSV---KVKQNLGLDRCEYIASGAAPISQQTLEFFQDIDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDENLIGEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIEAKEVEDLLNSNFAVLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMY 2594
            +KD    ++  +Y     K A GF+ LGLE   ++ ILGFN P WF S +G ++AGG+  GIYT+++ E C+YI  DC+  +++++   QL KIL I   +P +KA++ Y     +E   K    +YT  + + +      + L    +  +P  C VL+YTSGTTG PKGVMLS DNI +T +      +++     Q +++SYLPLSH+AA + D+ + +  G+ + FA PDALKG+L  TL+EV PT  +GVPRV+EKI E+++                               +LK  T++  D +   +V+Q LG  +C+    GAAP++ +T  FF  ++I ++  YG+SES+GPH +      +L   G ++ G  +K+ N D + IGEIC+ GR +F+GY N  +KT EA+DS+ WLH+GD+G++D +G+L +TGR+KEL+ITAGGENV PVPIE+ +K ELP IS+ ML+GD++KF+S LLTLK  LD +T  PT+ L+  A+   +  G +A  V +++      +   I   + RVNA + ++  ++QKW IL RDFS+ GGELGPT+K+KR+ V+EKY+D+I S Y
Sbjct:  123 RKDKWERISYYQYYLIARKVAKGFLKLGLERAHSVAILGFNSPEWFFSAVGTVFAGGIVTGIYTTSSPEACQYISHDCRANVIVVDTQKQLEKILKIWKDLPHLKAVVIY-----QEPPPKKMANVYTMEELIELGQEVPEEALDAIIDTQQPNQCCVLVYTSGTTGNPKGVMLSQDNITWTARYGSQAGDIQPAEVQQEVVVSYLPLSHIAAQIYDLWTGIQWGAQVCFADPDALKGTLVNTLREVEPTSHMGVPRVWEKIMERIQEVAAQSGFIRRKMLLWAMSVTLEQNLTCPSNDLKPFTSRLADYLVLARVRQALGFAKCQKNFYGAAPMTAETQRFFLGLNIRLYAGYGLSESTGPHFMSSPYNYRLYSSGRVVPGCRVKLVNQDADGIGEICLWGRTIFMGYLNMEDKTCEAIDSEGWLHTGDMGRLDADGFLYITGRLKELIITAGGENVPPVPIEEAVKMELPIISSAMLIGDQRKFLSMLLTLKCTLDPETSEPTDSLTEQAVEFCQRVGSKASTVSEIVGQRDEAVYQAIHEGIQRVNANAAARPYHIQKWAILQRDFSISGGELGPTMKLKRLTVLEKYKDIIDSFY 716          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Mouse
Match: Acsbg3 (acyl-CoA synthetase bubblegum family member 3 [Source:MGI Symbol;Acc:MGI:1925875])

HSP 1 Score: 314.694 bits (805), Expect = 1.134e-94
Identity = 194/644 (30.12%), Postives = 326/644 (50.62%), Query Frame = 3
Query:  807 DETKNVPEETIINRLKENVESQPNHVVLKHKSDPKKDYDLSLTMKEYLEQITKAATGFITLGLEPKAAICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKILSILPGVPQVKAIIKYTGEVQEEAKKKSKIPIYTWSQFLSIDSTNATDELHNRQENVKPKDCAVLIYTSGTTGLPKGVMLSHDNILFTLKMVQIHLELK---KFQNIIISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALK----------GSLGKTLKEVRPTVFLGVPRVYEKIQEQLE------------------NLKASTNKKLDSVKVKQNL-----------------GLDRCEYIASGAAPISQQTLEFFQDIDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDENLIGEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIEAKEVEDLLNSNFAVLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMY 2594
            D   N P  T+ + +        +++ +  K   KK + L LT  EY E   +AA  F+ +GLE    + I+G N   W I+ +G I AGG+S GI +S + + C+ I    +  I +++ND QL KI  I   +  +KAII+Y  ++QE     ++  +Y+W  FL +    + ++L    + +KP  C  L+Y  GTTG  K +MLSHDNI +T   +   L  K   + Q I++SYLPL      +LD+   + +  T+YF   D+ K          G L + L+EV+PT F G+P V++++ + L+                   +   TNKKL   ++ Q L                 GL+ C+   +    +   TL+FF  ++I I ++YG+SE +G HT+      ++   G  +     K+E  +++ IG +C+ GRH+F+GY    + T+  +D+  WLH+ DLG +D + +L V G   +L+  + GE V P PIE+ +++ +P +   MLVG    ++  LLTLK  ++ +T      L+   +        ++  + D+L     ++   I+  +  VN+++ +  A + KW IL  DFS+ GGELGP  KM R  V++ Y++ I+ +Y
Sbjct:   65 DPLDNEPPVTVPDLIMSAATKYSHYLAIGSKY--KKSWQL-LTYIEYYEACRRAAKAFLKVGLERFHGVGIMGINSSEWVIASIGAIMAGGISVGILSSISPKACQVIAETSEMDIFVVDNDRQLQKINQIQGYLKHLKAIIQYREDIQE-----AQPNLYSWKGFLDLADGISDEKLDKIIDTLKPNQCCALVYNQGTTGPSKAIMLSHDNITWTTAAIVQSLGFKCPPQGQEILVSYLPLCFPGIQILDVWVAISVAGTVYFPSLDSGKWSGLPRTPGTGFLMELLREVQPTTFCGIPWVWDRMLDSLKTKFLDSTAFRRRIDHWAMRMGLHTNKKLMMGEIHQPLCFGLAKRLTFERARKFLGLNHCQQFLNMGMGLPSGTLDFFLSVNIPIMELYGLSECTGLHTVSNLQAYRILSAGKALPKTHTKVEKENKDGIGNLCIWGRHIFMGYLRDKQSTERKVDTHGWLHTNDLGFLDFDKFLYVMGNNNDLIKLSSGEMVNPYPIEERVRTRIPIVRYAMLVGQDAPYLCALLTLKCQINPETGEARSNLTSEVVACCRKLRSQSTWLSDVLYDRDPLVTEFINQGIEDVNSEAPTMGAKIIKWVILDNDFSVDGGELGPMSKMNRSIVVKIYQEEIQKLY 700          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Mouse
Match: Acsl5 (acyl-CoA synthetase long-chain family member 5 [Source:MGI Symbol;Acc:MGI:1919129])

HSP 1 Score: 164.081 bits (414), Expect = 1.591e-41
Identity = 156/574 (27.18%), Postives = 256/574 (44.60%), Query Frame = 3
Query: 1011 ICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKIL-----SILPGVPQVKAIIKYTGEVQEEAKKKSKIPIYTWSQFLSI-DSTNATDELHNRQENVKPKDCAVLIYTSGTTGLPKGVMLSHDNILFTLKMVQIHLELKKFQ----NIIISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKTLKEVRPTVFLGVPR----VYEKIQEQ--------LENL---------------KASTNKKLDSVKVKQNLGLDRCEYIASGAAPISQQTLEFFQD-IDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIEN-PDENLI-----GEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFG--IEAKEVEDLLNSNFAVLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMY 2594
            + I   N P W ISEL       V+  +Y +   E   +++      ++I +   +   ++      + PG+  +  +  +  ++ +  +K          + LS+ D+ N   E   +    KP+D +V+ +TSGTTG PKG ML+H+N++  +      LE   FQ    ++ ISYLPL+H+   ++        G  I F Q D     L   +K ++PTVF  VPR    VY+K+Q +        L NL               + S   KL   K++ +LG  +   + +GAAPIS   L FF+  +   + + YG +E +G  +I    +   G VGT +    +K+E+  D N       GEIC++G +VF GY    EKT+E LD   WLH+GD+G+    G L +  R K +   A GE +AP  IE+      P +   +     + F+                    + V    SL SF   I  K   + L  N  V ++ +++         +     V+   + P  F+++ G L PTLK KR+ + + ++  IKS+Y
Sbjct:  135 VGIFAQNRPEWVISELACYTYSMVAVPLYDTLGTEAIIFVINRADIPVVICDTPQKATMLVENVEKGLTPGLKTIILMDPFDDDLMKRGEKCG-------VEMLSLHDAENIGKENFKKPVPPKPEDLSVICFTSGTTGDPKGAMLTHENVVSNMAAFLKFLE-PIFQPTSDDVTISYLPLAHMFERLVQ-GILFSCGGKIGFFQGDIR--LLPDDMKALKPTVFPTVPRLLNRVYDKVQNEAKTPLKKFLLNLAIISKFNEVKNGIIRRDSLWDKLVFSKIQGSLG-GKVRLMITGAAPISTPVLTFFRAAMGCWVFEAYGQTECTGGCSITSPGDWTAGHVGTPVACNFVKLEDVADMNYFSVNNEGEICIKGNNVFKGYLKDPEKTQEVLDKDGWLHTGDIGRWLPNGTLKIVDRKKNIFKLAQGEYIAPEKIENVYSRSRPVLQVFVHGESLRSFLI------------------GVVVPDPDSLPSFAAKIGVKGSFEELCKNQCVKEAILEDLQKIGKEGGLKSFEQVKSIFVHPEPFTIENGLLTPTLKAKRVELAKFFQTQIKSLY 678          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Mouse
Match: Acsl6 (acyl-CoA synthetase long-chain family member 6 [Source:MGI Symbol;Acc:MGI:894291])

HSP 1 Score: 149.058 bits (375), Expect = 1.411e-36
Identity = 160/582 (27.49%), Postives = 261/582 (44.85%), Query Frame = 3
Query: 1017 ILGFNHPAWFISELGGIYAGGVSCGIYTS----------NTAEICKYIMIDCKCQILILENDDQLNKILSILPGVPQVKAIIKYTGEVQEEAKKKSKIPIYTWSQFLSIDSTNATD----ELHNRQENVKPKDCAVLIYTSGTTGLPKGVMLSHDNIL--FT--LKMVQIHLELKKFQNIIISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKTLKEVRPTVFLGVPRV----YEKIQEQLEN------LKASTNKKLDSV-----------------KVKQNLGLDRCEYIASGAAPISQQTLEFFQD-IDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDE-NLI-----GEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIED-NIKSELPFISNVMLVGDK-KKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIEAKEVEDLLNSNFAVLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMYTV 2600
            +   N P W I+EL       V   +Y +          NTA+IC  I+       L+LE+ ++        PG+  V  +  +   ++E  KK            + I S  A +    E H+     +P D +++ +TSGTTG PKG ML+H N++  F+  LK+ +  +   +  +++IS+LPL+H+   ++  +     G  + F Q D     L   +K +RPT+F  VPR+    Y+KI  Q +       L+ +  +K   V                 K++ +LG      I +GAAP S   L F +  +   +++ YG +E +   T     +   G VG  +    +K+ + +E N       GEIC++G +VF GY    ++TKEALDS  WLH+GD+GK   EG L +  R K +   A GE VAP  IE+  I+SE   ++ + + GD  K F+               +P  ++  S     +  GIE    E  +       K+ +D+ +       +     V+   I    FS++ G L PTLK KR  + E ++  I+ +Y V
Sbjct:  152 VFAQNRPEWIIAELACYTYSMVVVPLYDTLGPGSISYIINTADICTVIVDKPHKATLLLEHVERKET-----PGLKLVILMEPFEDALRERGKKCG----------VDIKSMQAIEDCGRENHHAPVPPRPDDLSIVCFTSGTTGNPKGAMLTHGNVVADFSGFLKVTE-KVIFPRQDDVLISFLPLAHMFERVIQ-SVVYCHGGRVGFFQGDIR--LLSDDMKALRPTIFPVVPRLLNRMYDKIFHQADTSLKRWLLEFAAKRKQAEVRSGIIRNNSIWDELFFNKIQASLG-GHVRMIVTGAAPASPTVLGFLRAALGCQVYEGYGQTECTAGCTFTTPGDWTSGHVGAPLPCNHIKLVDAEELNYWTCKGEGEICVKGPNVFKGYLKDEDRTKEALDSDGWLHTGDIGKWLPEGTLKIIDRKKHIFKLAQGEYVAPEKIENIYIRSEP--VAQIYVHGDSLKAFL-----------VGIVVPDPEVMPSWA---QKKGIEGTYQELCMKKELK--KAILDDMVMLGKESGLHSFEQVKAIYIHCDMFSVQNGLLTPTLKAKRPELREYFKKQIEELYLV 695          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. UniProt/SwissProt
Match: sp|Q7ZYC4|ACBG2_XENLA (Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Xenopus laevis OX=8355 GN=acsbg2 PE=2 SV=1)

HSP 1 Score: 535.798 bits (1379), Expect = 8.243e-178
Identity = 287/635 (45.20%), Postives = 394/635 (62.05%), Query Frame = 3
Query:  804 DDETKNVPEETIINRLKENVESQPNHVVLKHKSDPKKDYDLSLTMKEYLEQITKAATGFITLGLEPKAAICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKILSILPGVPQVKAIIKYTGEVQEEAKKKSKIPIYTWSQFLSIDSTNATDELHNRQENVKPKDCAVLIYTSGTTGLPKGVMLSHDNILFTLKMVQIHLELKK---FQNIIISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKTLKEVRPTVFLGVPRVYEKIQEQLENL--KASTNK---------------------------------KLDSVKVKQNLGLDRCEYIASGAAPISQQTLEFFQDIDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDENLIGEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIEAKEVEDLLNSNFAVLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMY 2594
            D +  ++P  TI    +E V    ++V L  K   + D    ++ K+Y EQ   AA GFI LGLE    + ILGFN   WFI+++G I+AGG + GIYT+N+AE C Y+  +C+  I+++EN  QL KIL +   +P +KAII+Y  E++E+        +YTW +F+ +       +L     + KP  C  LIYTSGTTG PKGVMLSHDNI +T       + L++    Q I++SYLPLSH+AA M+DI  T+  G   YFAQPDALKGSL  TL+EVRPT F+GVPRV+EK+QE+++ +  K+ST K                                 KL   KV++ LGLDRC    +GAAPI++ TLEFF  ++I ++++YGMSESSGPHTI   D  ++   G ++ G + KI  PD +  GEI   GRHVF+GY N  +KT E+LD + WLHSGD+GK D  G+L +TGRIKEL+ITAGGEN+ PVP ED +K ++P ISN ML+GDKKKF+S LLTLK ++++ T  P ++L+  AI+     G +A  V D++      + + I   +N VN +S S A  VQKW IL +DFS+ GGELGPT+K+KR  V + Y+D I S Y
Sbjct:   99 DSDVASLPPVTIHQLFQETVNKYGDYVALASK---QGDQWHKMSYKQYYEQCRIAAKGFIKLGLERYHGVGILGFNSAEWFIADVGAIFAGGFAVGIYTTNSAEACHYVAQNCEANIIVVENQKQLQKILQVQDQLPHLKAIIQYKDELKEKRPN-----LYTWKEFMQLGKDIPDSQLDQIISSQKPNQCCTLIYTSGTTGQPKGVMLSHDNITWTAAAAGKTVRLREATDLQEIVVSYLPLSHIAAQMIDIWLTMKYGGATYFAQPDALKGSLAITLREVRPTAFMGVPRVWEKMQEKMKAVGAKSSTIKRKMATWAKGVGLETNLKKMNGSTPHPMKYHVANKLVFKKVRKALGLDRCTKCYTGAAPITKDTLEFFLSLNIPVYELYGMSESSGPHTISLPDAFRITSCGKVISGCKTKIHQPDSDGSGEILFWGRHVFMGYLNMEDKTHESLDEEGWLHSGDIGKHDENGFLYITGRIKELIITAGGENIPPVPTEDAVKEQVPIISNAMLIGDKKKFLSMLLTLKCNVNADTGEPEDELTPEAIQFCRQIGSKATLVSDIVGGKDTAVYAAIQEGVNSVNEKSTSNAQKVQKWLILEKDFSITGGELGPTMKLKRPVVAKMYKDQIDSFY 725          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. UniProt/SwissProt
Match: sp|Q5ZKR7|ACBG2_CHICK (Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Gallus gallus OX=9031 GN=ACSBG2 PE=2 SV=2)

HSP 1 Score: 521.931 bits (1343), Expect = 2.988e-172
Identity = 278/628 (44.27%), Postives = 389/628 (61.94%), Query Frame = 3
Query:  831 ETIINRLKENVESQPNHVVLKHKSDPKKDYDLSLTMKEYLEQITKAATGFITLGLEPKAAICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQ-LNKILSILPGVPQVKAIIKYTGEVQEEAKKKSKIPIYTWSQFLSIDSTNATDELHNRQENVKPKDCAVLIYTSGTTGLPKGVMLSHDNILFT---LKMVQIHLELKKFQNIIISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKTLKEVRPTVFLGVPRVYEKIQEQLENLKASTN-----------------------------------KKLDSVKVKQNLGLDRCEYIASGAAPISQQTLEFFQDIDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDENLIGEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIEAKEVEDLLNSNFAVLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMYT 2597
            +T+    +E V    ++  L  K   K    + LT K Y ++  KAA  F+ L LE    +CILGFN P WFI+++G I+AGG++ GIYT+N+ E C Y+  +C   IL++EN  Q   K L I   +P +KAII+Y  E++E+   +     Y+W +FL +       +L    E+ KP  C  LIYTSGTTG PKGVMLSHDN+ +T        + LE  + Q +++SYLPLSHVAA M+DI   V  G  ++FAQPDALKG+L  TL+EVRPT FLGVPRV+EKI+E+++++ A ++                                   ++L   KV++ +GLDRC    +GAAPIS++TLEFF  ++I + ++YGMSESSGPHT+      +L   G  M G    I  PD + IGEIC  GRH+F+GY N  EKTKEA+D   WLHSGDLGK D +G++ +TGRIKEL+ITAGGENV PVPIED +K   P ISN MLVGDK KF++ LLTLK  +++++  P + L+  AI   +  G +A +V ++++S    + + I  A++ VN ++VS A  +QKW +L +DFS+ GGELGPT+K+KR  V +KY+D+I   Y 
Sbjct:  101 KTVHEVFQEAVSKYGDYYALASK---KNGQWVKLTYKMYYDKCWKAAKSFLKLVLERFHGVCILGFNSPEWFIADIGAIFAGGLAVGIYTTNSPEACHYVAENCSANILVVENHTQACRKSLEIEHKLPHMKAIIQYGEELKEKRPNQ-----YSWREFLDLGEDIPDSQLREIIESQKPNQCCTLIYTSGTTGQPKGVMLSHDNLTWTSIAAGRSLMLLEATEKQELVVSYLPLSHVAAQMIDIWLPVTFGGQVFFAQPDALKGTLVDTLREVRPTAFLGVPRVWEKIEEKMKSVGAKSSTLRRKVASWAKGVGLQTNLKWMNGHSEVPMNFRLARQLVYKKVRKAIGLDRCTKCFTGAAPISRETLEFFLSLNIPVFELYGMSESSGPHTVSIPQAFRLTSCGKEMAGCRTLIHKPDADGIGEICFAGRHIFMGYLNMEEKTKEAIDKDGWLHSGDLGKCDKDGFIYITGRIKELIITAGGENVPPVPIEDAVKEACPIISNAMLVGDKAKFLAMLLTLKCIINTESGEPGDDLTAEAIEYCQKLGSKATKVSEIISSKDKAVYAAIQAAVSEVNKRAVSNAQKIQKWVVLEKDFSVGGGELGPTMKLKRPVVAQKYKDLIDEFYA 720          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. UniProt/SwissProt
Match: sp|Q5FVE4|ACBG2_HUMAN (Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Homo sapiens OX=9606 GN=ACSBG2 PE=1 SV=2)

HSP 1 Score: 484.952 bits (1247), Expect = 3.523e-159
Identity = 266/627 (42.42%), Postives = 375/627 (59.81%), Query Frame = 3
Query:  834 TIINRLKENVESQPNHVVLKHKSDPKKDYDLSLTMKEYLEQITKAATGFITLGLEPKAAICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKILSILPGVPQ-----VKAIIKYTGEVQEEAKKKSKIPIYTWSQFLSIDSTNATDELHNRQENVKPKDCAVLIYTSGTTGLPKGVMLSHDNILFTLKMVQIHLELKKFQNIIISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKTLKEVRPTVFLGVPRVYEKIQEQLENLKAST-----------------------------------NKKLDSVKVKQNLGLDRCEYIASGAAPISQQTLEFFQDIDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDENLIGEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIEAKEVEDLLNSNFAVLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMY 2594
            TI    +E+V     +  L  K+  K +    L   +Y E   KAA   I LGLE    + ILGFN   WFI+ +G I AGG+  GIY +N+AE+C+Y++   K  IL++END QL KILSI    PQ     +KAII+Y   +++         +Y+W  F+ +  +    +L    E+ K   CAVLIYTSGTTG+PKGVMLSHDNI +    V    +L      ++SYLPLSH+AA M+DI   + +G+  YFAQ DALKG+L  TLKEV+PTVF+GVP+++EKI E ++   A +                                    K L   KVK +LGLD C    SG AP++Q+T EFF  +DI I ++YG+SESSGPHTI  ++  +L   G ++ G +  +   +++ IGEIC+ GRH+F+GY  +  +T EA+D + WLHSGDLG++DG G+L VTG IKE+LITAGGENV P+P+E  +K ++P ISN MLVGDK KF+S LLTLK +++  +  P +KL+  AI      G +A  V +++     ++   I   +N VN ++++ A  ++KW IL +DFS+ GGELGP +K+KR FV +KY+  I  MY
Sbjct:   52 TIPEFFRESVNRFGTYPALASKNGKKWEI---LNFNQYYEACRKAAKSLIKLGLERFHGVGILGFNSAEWFITAVGAILAGGLCVGIYATNSAEVCQYVITHAKVNILLVENDQQLQKILSI----PQSSLEPLKAIIQYRLPMKKNNN------LYSWDDFMELGRSIPDTQLEQVIESQKANQCAVLIYTSGTTGIPKGVMLSHDNITWIAGAVTKDFKLTDKHETVVSYLPLSHIAAQMMDIWVPIKIGALTYFAQADALKGTLVSTLKEVKPTVFIGVPQIWEKIHEMVKKNSAKSMGLKKKAFVWARNIGFKVNSKKMLGKYNTPVSYRMAKTLVFSKVKTSLGLDHCHSFISGTAPLNQETAEFFLSLDIPIGELYGLSESSGPHTISNQNNYRLLSCGKILTGCKNMLFQQNKDGIGEICLWGRHIFMGYLESETETTEAIDDEGWLHSGDLGQLDGLGFLYVTGHIKEILITAGGENVPPIPVETLVKKKIPIISNAMLVGDKLKFLSMLLTLKCEMNQMSGEPLDKLNFEAINFCRGLGSQASTVTEIVKQQDPLVYKAIQQGINAVNQEAMNNAQRIEKWVILEKDFSIYGGELGPMMKLKRHFVAQKYKKQIDHMY 665          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. UniProt/SwissProt
Match: sp|Q2XU92|ACBG2_MOUSE (Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Mus musculus OX=10090 GN=Acsbg2 PE=1 SV=1)

HSP 1 Score: 480.715 bits (1236), Expect = 1.757e-157
Identity = 268/626 (42.81%), Postives = 377/626 (60.22%), Query Frame = 3
Query:  834 TIINRLKENVESQPNHVVLKHKSDPKKDYDLSLTMKEYLEQITKAATGFITLGLEPKAAICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKILSILPG-VPQVKAIIKYTGEVQEEAKKKSKIPIYTWSQFLSIDSTNATDELHNRQENVKPKDCAVLIYTSGTTGLPKGVMLSHDNILFTLKMVQIHLELKKF---QNIIISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKTLKEVRPTVFLGVPRVYEKIQEQL-ENLKASTN----------------------------------KKLDSVKVKQNLGLDRCEYIASGAAPISQQTLEFFQDIDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDENLIGEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIEAKEVEDLLNSNFAVLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMY 2594
            TI    +E+ E    +  L  K+  K D   +LT  +Y E   KAA   I LGL+    + ILGFN   W ++ LG I AGG+  GIY +N+AE C+Y++      ILI+END QL KIL I P  +  VKAI++Y   + E     S   +Y+W+ F+ + +     +L     + K   CAV++YTSGTTG PKGV+LSHDNI +T   +   +E+ +    QN I+SYLPLSH+AA + DI   + +G+  +FAQPDAL+G+L  TL+EV+PT+F+GVPR++EK+Q+ + EN+  S+                                   K L   KV+ +LGLD C    S A+P+SQ   EFF  +DI I +IYGMSE SGPHT+  K   ++   G ++ G +  + N ++  +GE+CM GRHVF+GY N  E T EALD   WLHSGD+G++D   +L +TGRIKE+LITAGGENV+P+PIE  +K ++P IS+ MLVGDK KF+  LLTLK + D K+  P  KLSV A    +  G +A  V D+L S   V+ + I   ++ VN Q++S +  ++KW IL +DFS++GGELGPT K+KR  + +KY+  I SMY
Sbjct:   48 TIPELFQESAERFSAYPALASKNGKKWD---TLTFSQYYEMCRKAAKSLIKLGLQRFQCVGILGFNSVEWVVTALGTILAGGLCVGIYATNSAEACQYVIQQANVSILIVENDQQLQKILLIPPDKMETVKAIVQYKLPLME-----SMANLYSWNDFMELGNDIPNIQLDRVILSQKANQCAVILYTSGTTGTPKGVLLSHDNITWTAGAMSQEMEINRVSGKQNTIVSYLPLSHIAAQLTDIWIPIKIGALTFFAQPDALRGTLVYTLQEVKPTLFMGVPRIWEKMQDTIKENVARSSRLRKKAFAWAKMLGLKVNTKRMLGKRDIPMNYRMAKALVFAKVRTSLGLDNCHAFFSSASPLSQDVSEFFLSLDIPIGEIYGMSECSGPHTVSNKSVYRVLSCGKVLSGCKNMLYNQNKEGVGEVCMWGRHVFMGYLNKEEATLEALDENGWLHSGDIGRLDSHDFLYITGRIKEILITAGGENVSPIPIETLVKEKIPIISHAMLVGDKAKFLCMLLTLKCETDRKSGEPLNKLSVEAKSFCQMLGSQATTVSDILKSRDQVVYTAIQYGIDIVNQQAMSDSHRIRKWIILEKDFSIQGGELGPTSKLKRSVITQKYKAQIDSMY 665          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. UniProt/SwissProt
Match: sp|A1L1K7|ACBG2_RAT (Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Rattus norvegicus OX=10116 GN=Acsbg2 PE=2 SV=1)

HSP 1 Score: 474.167 bits (1219), Expect = 6.082e-155
Identity = 265/627 (42.26%), Postives = 377/627 (60.13%), Query Frame = 3
Query:  834 TIINRLKENVESQPNHVVLKHKSDPKKDYDLSLTMKEYLEQITKAATGFITLGLEPKAAICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKILSILPG-VPQVKAIIKYTGEVQEEAKKKSKIPIYTWSQFLSIDSTNATDELHNRQENVKPKDCAVLIYTSGTTGLPKGVMLSHDNILFTLKMVQIHLELKKF---QNIIISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKTLKEVRPTVFLGVPRVYEKIQEQL-ENLKASTN----------------------------------KKLDSVKVKQNLGLDRCEYIASGAAPISQQTLEFFQDIDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDENLIGEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIEAKEVEDLLNSNFAVLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMYT 2597
            TI    +E+VE    +  L  K+  K D   +LT  +Y +   KAA   I LGL+    + ILGFN   W ++ LG I AGG+  GIY +N+AE C+Y++      +LI+END QL KILSI P  +  VKAI++Y   + E +       +Y+W  F+ + +     +L     + K   CAV+IYTSGTTG PKGVMLSHDNI +T   +   +EL      Q+ I+SYLPLSH+AA ++DI   + +G   +FAQPDAL+G+L  TL+EV+PT FLGVPRV+EK+Q+ + EN+  S+N                                  K L   KV+ +LGLD C    SGA+P+SQ   EFF  +DI I +IYGM+E SGPHT+  K   ++   G ++ G +  +   +++ +GE+CM GRHVF+GY    + T E LD   WLHSGD+G++D   +L +TGRIKE+LITAGGEN+ P+PIE  +K ++P IS+ MLVGDK KF+S LLTLK + D  +  P +KL++ AI   +  G +A  V D+L     V+ + I   ++ VN Q+VS +  ++KW IL +DFS++GGELGPT K+KR  + +KY+  I +MY+
Sbjct:   48 TIPELFQESVERFGAYPALASKNGKKWD---TLTFSQYYDVCRKAARSLIKLGLQRFHGVGILGFNSVEWVVAALGAILAGGLCVGIYATNSAEACQYVIKQANVNVLIVENDQQLQKILSIPPDKMETVKAIVQYRLPLMENSTN-----LYSWQDFMELGNAIPNIQLDRVILSQKANQCAVIIYTSGTTGSPKGVMLSHDNITWTAGAMAREIELIHVSGKQDTIVSYLPLSHIAAQLMDIWIPIKVGVLTFFAQPDALRGTLVYTLQEVKPTYFLGVPRVWEKMQDTIKENVAKSSNLRKKAFAWAKMLGLKVNTKKMLGKRDIPMNYRMAKALVFTKVRTSLGLDNCHTFFSGASPLSQDVSEFFLSLDIPIGEIYGMTECSGPHTVSCKSIYRVLSCGKVLNGCKNMLYKQNKDGVGEVCMWGRHVFMGYLGKEDATLEVLDEDGWLHSGDIGRLDSHDFLYITGRIKEVLITAGGENIWPIPIETLVKEKIPIISHAMLVGDKAKFLSMLLTLKCETDQMSGEPLDKLNLEAISFCQMLGSQAVTVSDILKIRDPVVYTAIQYGIDIVNQQAVSDSHRIRKWIILEKDFSIQGGELGPTSKLKRDLITQKYKAQIDNMYS 666          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. TrEMBL
Match: A0A3P8WSG3 (AMP-binding domain-containing protein OS=Cynoglossus semilaevis OX=244447 PE=4 SV=1)

HSP 1 Score: 551.206 bits (1419), Expect = 0.000e+0
Identity = 283/627 (45.14%), Postives = 395/627 (63.00%), Query Frame = 3
Query:  831 ETIINRLKENVESQPNHVVLKHKSDPKKDYDLSLTMKEYLEQITKAATGFITLGLEPKAAICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKILSILPGVPQVKAIIKYTGEVQEEAKKKSKIPIYTWSQFLSIDSTNATDELHNRQENVKPKDCAVLIYTSGTTGLPKGVMLSHDNILFTLKMVQIHLELKKFQNIIISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKTLKEVRPTVFLGVPRVYEKIQEQLE--NLKASTNKK---------------------------------LDSVKVKQNLGLDRCEYIASGAAPISQQTLEFFQDIDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDENLIGEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIEAKEVEDLLNSNFAVLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMYTV*Q 2606
             T+     E VE   ++  LK K   K+   ++LT +EY +Q   AA  F+ LGLE    + ILGFN   WFIS++G I+AGG++ GIYT+N+ E C Y+  +C+  IL++EN  QL+KIL +   +P +KAI++Y GE Q++A       IYTW +F+ + S    ++L+ R ++++  +C  LIYTSGTTG PKGVMLSHDN+ +T +     ++      +++SYLPLSHVAA M+DI  ++  G T+YFA PDALKGSLG TL+E RPT FLGVPRV+EK+QE+++   +KAS  ++                                 L   KV+  LGLDRC+   +GAAPIS+ TLE+F  ++I + ++YGMSESSGPHT+    +  +   G +M G + K+ENPD   IGEIC  GRH+F+GY N V+KT EALD   WLHSGDLGK D   +L +TGRIKEL+ITAGGEN+ PVPIED +K+E+P +SNVML+GDK KF+S +L     +      PT+ LS  A+   +  G+ A +V +++ +    +   I   + RVNA + S A  VQKW IL +DFS+ GGELGPT+K++R  V++ YED I  MY V Q
Sbjct:  115 RTVHQLFLEAVEQCGDYPALKSK---KEGQWVTLTWREYYKQCRAAAKSFLKLGLERYHGVGILGFNAAEWFISDIGCIFAGGLAAGIYTTNSPEACMYVAANCEANILVVENQKQLDKILQVKDQLPHLKAIVQYRGEPQQKAPF-----IYTWEEFMKLGSDVPDEQLNARIDSLRANECCTLIYTSGTTGNPKGVMLSHDNLTWTARTASTLVDYSYGDEVLVSYLPLSHVAAQMVDIWLSMTFGGTVYFADPDALKGSLGTTLREARPTYFLGVPRVWEKMQEKMKAMGMKASPMRRRVANWAKSIGLQYNYSAMNGENVVPWGYMLANNLVFKKVRAALGLDRCKICFTGAAPISKDTLEYFMSLNIPLMELYGMSESSGPHTVSVNHDYSITSCGKVMPGCKTKLENPDNEGIGEICFWGRHIFMGYLNMVDKTAEALDQDGWLHSGDLGKHDRNKFLFITGRIKELIITAGGENIPPVPIEDKLKAEVPILSNVMLIGDKLKFLS-MLLTLKCVMDDNGEPTDDLSPEALDYCQQHGVTATKVSEIIANREPAIYKAIQEGLERVNAMATSNAQKVQKWVILDKDFSVPGGELGPTMKLRRPIVVKMYEDKINEMYAVAQ 732          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. TrEMBL
Match: A0A0F8AB95 (Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Larimichthys crocea OX=215358 GN=EH28_04941 PE=4 SV=1)

HSP 1 Score: 550.051 bits (1416), Expect = 0.000e+0
Identity = 276/624 (44.23%), Postives = 397/624 (63.62%), Query Frame = 3
Query:  834 TIINRLKENVESQPNHVVLKHKSDPKKDYDLSLTMKEYLEQITKAATGFITLGLEPKAAICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKILSILPGVPQVKAIIKYTGEVQEEAKKKSKIPIYTWSQFLSIDSTNATDELHNRQENVKPKDCAVLIYTSGTTGLPKGVMLSHDNILFTLKMVQIHLELKKFQNIIISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKTLKEVRPTVFLGVPRVYEKIQEQLE--NLKASTNKK---------------------------------LDSVKVKQNLGLDRCEYIASGAAPISQQTLEFFQDIDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDENLIGEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIEAKEVEDLLNSNFAVLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMYTV 2600
            TI     E VE  P +  L  K + +  +   +T ++Y EQ   AA  F+ LGLE    + ILGFN P WFIS++G I AGG++ GIYT+N+ E C+Y+  +C+  IL++EN  QL KIL +   +P +KAI++Y GE+Q++A       +YTW++F+ +      ++L+    +++  +C  LIYTSGTTG PKGVMLSHDN+ +T++     + LK+ Q +++SYLPLSH AA M D+   +    T YFA+PDALKGSLG TLKE RPT FLGVPRV+EK+QE+++   +KA+  +K                                 +   KV+  LGLDRC+   +GAAPI+++TLE+F  ++I + +IYGMSESSGPHT+   +E ++   G +M G + K++NPDE+  GEIC  GRHVF+GY N  +KT EA+D   WLHSGDLGK D  G+L +TGRIKEL+ITAGGEN+ PVPIED +K+E+P ISN ML+GDK+KF+S +L     +      PT++L+  A+   +  G+ A +V +++ +    + + I   +  VNA++ S A  VQKW IL RDFS+ GGELGPT+K++R  V++ Y++ I  MY V
Sbjct:   13 TIHQMFLETVEKYPEYPALASKQEGRWVF---VTWRQYYEQCRAAAKSFLKLGLERYHGVGILGFNSPEWFISDIGCILAGGLATGIYTTNSPEACQYVAANCEANILVVENQKQLEKILQVKDQLPHLKAIVQYKGELQQKAPF-----LYTWAEFMKLGEDVPEEQLNAMINSLRANECCTLIYTSGTTGNPKGVMLSHDNLTWTVQSALSMVNLKEAQEVVVSYLPLSHAAAQMFDMWMCICYAVTTYFAEPDALKGSLGTTLKEARPTCFLGVPRVWEKMQEKMKAVGVKATPMRKRVADWAKSIGLQYNYSMMNGENRVPWGFSMANAMVFKKVRAALGLDRCKICFTGAAPITKETLEYFMSLNIPVMEIYGMSESSGPHTVSSNEEYRITSCGKVMTGCQTKLDNPDEDGNGEICFWGRHVFMGYLNMPDKTAEAIDQNGWLHSGDLGKHDQTGFLYITGRIKELIITAGGENIPPVPIEDALKAEVPIISNAMLIGDKQKFLS-MLLTLKCVVDDNAEPTDELTPEALDFCQRNGVRATKVSEIIANKEPAIYTAIQEGLELVNARATSNAQKVQKWVILERDFSISGGELGPTMKLRRPIVLKMYQEKINEMYAV 627          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. TrEMBL
Match: A0A3P8YES4 (Acyl-CoA synthetase bubblegum family member 2 OS=Esox lucius OX=8010 PE=4 SV=1)

HSP 1 Score: 542.732 bits (1397), Expect = 1.074e-178
Identity = 282/625 (45.12%), Postives = 389/625 (62.24%), Query Frame = 3
Query:  825 PEETIINRLKENVESQPNHVVLKHKSDPKKDYDLSLTMKEYLEQITKAATGFITLGLEPKAAICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKILSILPGVPQVKAIIKYTGEVQEEAKKKSKIPIYTWSQFLSIDSTNATDELHNRQENVKPKDCAVLIYTSGTTGLPKGVMLSHDNILFTLKMVQIHLELK---KFQNIIISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKTLKEVRPTVFLGVPRVYEKIQEQLENLKASTN--------------------------------KKLDSVKVKQNLGLDRCEYIASGAAPISQQTLEFFQDIDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDENLIGEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIEAKEVEDLLNSNFAVLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMY 2594
            P  T+    K  VE    +  L  +   +     +L+ KEY +    AA  F+ LGLE    + ILGFN   WFIS++  I AGG + GIYT+N+ E C+Y+  +CK  I+++EN  QL KIL I   +P +KAII+Y     ++A K+ +  +YTW+ F+ +    +  +L       KP  C  LIYTSGTTG PKGVMLSHDN+ +T   V  H+ L    K Q I++SYLPLSH+AA M+DI  T+ +G   YFAQPDALKG+L  T++EVRPT F+GVPRV+EK+QE++++  A ++                                KKL   KV++ LGLDRC    +GAAPI++ TLEFF  +DI ++++YGMSES+GPHTI + +  +L   G ++ G E KI +PDE   GEIC  GRHVF+GY N  +KTK+ALD + WLHSGDLGK D  G+L +TGRIKEL+ITAGGEN+ PVPIED +K  LP +SN ML+GDK+KF++ LLT+K  ++  T  P ++L+  AI      G  A  V ++      V+ + I + +NRVN  + S A  +QKWTIL +DFS+ GGELGPT+K+KR  VM+ Y++ I+  Y
Sbjct:   67 PPLTVDQMFKSAVERFGRYTALGWREGEQTK---TLSYKEYYQACRTAAKSFLKLGLERYHGVGILGFNSAEWFISDIAAILAGGFAVGIYTTNSPEACQYVAENCKANIIVVENQKQLQKILQIQDKLPHLKAIIQY-----KDALKEKRPNLYTWADFMELGRDESDTQLDGIIATQKPNQCCTLIYTSGTTGQPKGVMLSHDNLTWTALSVGCHVRLTEATKSQEIVVSYLPLSHIAAQMVDIWVTMKVGGATYFAQPDALKGTLVNTMREVRPTAFMGVPRVWEKMQEKMKSTGAKSSTVRRKVAVWAKGVGLQTNLRKMNQTPVNYRLAKKLVFTKVRKALGLDRCTKCYTGAAPITKDTLEFFLSLDIPLYELYGMSESTGPHTISQSEAFRLTSCGKVIPGCETKIHSPDEEGNGEICFWGRHVFMGYLNMADKTKDALDDEGWLHSGDLGKHDENGFLFITGRIKELIITAGGENIPPVPIEDAVKEALPLVSNAMLIGDKRKFLAMLLTIKCQVNGDTGAPEDELTPEAIELCRKLGSSATRVSEIAGGRDRVIHAAIQDGINRVNENATSNAQRIQKWTILGQDFSIFGGELGPTMKLKRPVVMKMYKEQIEHFY 683          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. TrEMBL
Match: H3C3L0 (AMP-binding domain-containing protein OS=Tetraodon nigroviridis OX=99883 PE=4 SV=1)

HSP 1 Score: 539.265 bits (1388), Expect = 2.127e-178
Identity = 276/624 (44.23%), Postives = 402/624 (64.42%), Query Frame = 3
Query:  834 TIINRLKENVESQPNHVVLKHKSDPKKDYDLSLTMKEYLEQITKAATGFITLGLEPKAAICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKILSILPGVPQVKAIIKYTGEVQEEAKKKSKIP-IYTWSQFLSIDSTNATDELHNRQENVKPKDCAVLIYTSGTTGLPKGVMLSHDNILFTLKMVQIHLELKKFQNIIISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKTLKEVRPTVFLGVPRVYEKIQEQLENL--KASTNKK---------------------------------LDSVKVKQNLGLDRCEYIASGAAPISQQTLEFFQDIDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDENLIGEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIEAKEVEDLLNSNFAVLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMYT 2597
            T++    E +ES  +H  L +K + +    + LT ++Y +Q   AA  F+ LGLE    + ILGFN P WFIS++G I AGG++ GIYT+N+ E C+Y+  +C+  IL++EN  QL+KIL +   +P +KAI++Y G +      K K+P +YTW++F+ +    + + L+   ++++  +C  LIYTSGTTG PKGVMLSHDN+ +T++     + L   + ++ISYLPLSH AA M D+   +    T YFA+PDALKGSLG TLKEVRPT FLGVPR++EK+QE+++ +  KAS  +K                                 L   KV+  LGLDRC+   +GAAPI++ TLE+F  ++I + +IYGMSESSGPHT+ + +E ++   G +M G + K++NPDE+  GEIC  GRHVF+GY N  EKT EA+D + WLHSGDLGK D   +  +TGRI+EL+ITAGGEN+ PVPIED +K+E+P ISN ML+GDK KF+S +L     + + +  PT+KLS  A+      G+ A +V +++ +    + ++I   + RVNA++ S A  VQK+TIL RDFS+ GGELGPT+K++R  V++ Y++ I  MY+
Sbjct:    3 TLLQXFLETLESYGDHPALAYKEEGQW---VKLTYRQYYQQCRAAAKSFLKLGLERYHGVGILGFNAPEWFISDIGCILAGGLATGIYTTNSPEACQYVAANCEANILVVENQTQLDKILKVKDQLPHLKAIVQYKGPL------KQKLPFLYTWAEFIRLGEDVSEERLNAVIDSLQANECCSLIYTSGTTGNPKGVMLSHDNVTWTVQSALSTVNLTPAEEVVISYLPLSHAAAQMFDMWLGISFAVTTYFAEPDALKGSLGTTLKEVRPTCFLGVPRIWEKMQEKMKAVGAKASPMRKGIANWAKAIGLEYNYSAMNGENVVPWGFGLANSLVFKKVRAALGLDRCKMCFTGAAPITKDTLEYFMSLNIPVMEIYGMSESSGPHTVSRNEEYRITSCGKVMPGCKTKLDNPDEDGNGEICFWGRHVFMGYLNMPEKTAEAIDQEGWLHSGDLGKHDQLNFTYITGRIQELIITAGGENIPPVPIEDALKAEVPIISNAMLIGDKLKFLS-MLLTLKCVVNDSGEPTDKLSPEALDVCRQLGVTATKVSEIIANKEPAIYNSIQEGIVRVNARATSNAQKVQKFTILERDFSIGGGELGPTMKLRRPIVVKMYQEKINEMYS 616          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. TrEMBL
Match: A0A1A8AI75 (AMP-binding domain-containing protein OS=Nothobranchius furzeri OX=105023 GN=Nfu_g_1_007364 PE=4 SV=1)

HSP 1 Score: 542.347 bits (1396), Expect = 5.167e-178
Identity = 282/624 (45.19%), Postives = 399/624 (63.94%), Query Frame = 3
Query:  834 TIINRLKENVESQPNHVVLKHKSDPKKDYDLSLTMKEYLEQITKAATGFITLGLEPKAAICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKILSILPGVPQVKAIIKYTGEVQEEAKKKSKIPIYTWSQFLSIDSTNATDELHNRQENVKPKDCAVLIYTSGTTGLPKGVMLSHDNILFTLKMVQIHLELKKFQNIIISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKTLKEVRPTVFLGVPRVYEKIQEQLENL--KASTNKK---------------------------------LDSVKVKQNLGLDRCEYIASGAAPISQQTLEFFQDIDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDENLIGEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIEAKEVEDLLNSNFAVLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMYTV 2600
            TI     E VE   +   L  K+D +    ++LT +EY E+   AA  F+ LGLE    + ILGFN P WFIS++G I+AGG++ GIYT+N+ E C+Y+  +C+  +L++EN  QL+KIL +   +P +KAII+Y GE+Q++A       +YTW++F+ +    + ++L+   ++++  +C  LIYTSGTTG PKGVMLSHDNI +T + V   +     + +++SYLPLSHVAA M+DI   + +G TIYFA PDALKGSL  TLKEVRPT FLGVPRV+EK+QE+++    KAS  KK                                 L   +V+  LGLDRC +  +GAAPI++ TLE+F  ++I + ++YGMSESSGPHT+   ++ ++G  G +M G + K+++PDE+  GEIC  GRHVF+GY N  +KT EALD   WLHSGDLGK D + +L +TGRIKEL+ITAGGEN+ PVPIED +K+E+P ISN ML+GDK KF+S ++            PT+ LS   +   +  G+++ +V ++L +    +   I   M RVNA+S S A  VQKW +L RDFS+ GGELGPTLK++R  V++ Y+D I  +YT 
Sbjct:  119 TIHQMFLETVEWCGDKPALVSKTDGRW---VTLTWREYYEECRTAAKSFLKLGLERFHGVGILGFNSPEWFISDVGCIFAGGLATGIYTTNSPEACQYVAANCEADVLVVENQKQLDKILKVKGQLPHLKAIIQYKGELQQKAPF-----LYTWAEFMKLGEDVSNEQLNAVIDSLRSNECCSLIYTSGTTGNPKGVMLSHDNISWTARTVFKMINENYGEEVLVSYLPLSHVAAQMIDIWGCMSLGGTIYFADPDALKGSLVNTLKEVRPTGFLGVPRVWEKMQEKMKAAGSKASPLKKRLADWAKSVGLQYNYSVMNGENAVPWGFMLSNNLVFKRVRAGLGLDRCTFCCTGAAPITKDTLEYFMSLNIPVKELYGMSESSGPHTV-SINQYRIGSCGKVMPGCKTKLDHPDEDGNGEICFWGRHVFMGYLNMPDKTVEALDEDGWLHSGDLGKHDKDDFLYITGRIKELIITAGGENIPPVPIEDAVKTEVPIISNAMLIGDKLKFLS-MMLTLKCEMDDNGEPTDDLSPEVLDFCQQHGVKSTKVSEVLANKEPAIYKAIQEGMERVNARSTSNAQKVQKWIVLGRDFSVVGGELGPTLKLRRPVVVKMYQDEINELYTA 732          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Cavefish
Match: acsbg2 (acyl-CoA synthetase bubblegum family member 2 [Source:NCBI gene;Acc:103045839])

HSP 1 Score: 526.939 bits (1356), Expect = 3.296e-175
Identity = 270/597 (45.23%), Postives = 388/597 (64.99%), Query Frame = 3
Query:  930 LTMKEYLEQITKAATGFITLGLEPKAAICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKILSILPGVPQVKAIIKYTGEVQEEAKKKSKIPIYTWSQFLSIDSTNATDELHNRQENVKPKDCAVLIYTSGTTGLPKGVMLSHDNILFTLKMVQIHLELK---KFQNIIISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKTLKEVRPTVFLGVPRVYEKIQEQLENL-----------------------------------KASTN----KKLDSVKVKQNLGLDRCEYIASGAAPISQQTLEFFQDIDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDENLIGEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIEAKEVEDLLNSNFAVLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMY 2594
            ++ KEY +    AA  F+ LGLE    + ILGFN P WFIS++G I+AGG + GIYT+N+ E C+Y+  +C+  IL++EN  QL KIL I   +P +KAII+Y     ++A K+ +  +YTW +FL +       +L++  ++ KP  C  LIYTSGTTG PKGVMLSHDN+ +T      ++ L    + Q  +ISYLPLSH+AA M+DI  T+ +G   YFAQPDALKGSL  TL+EVRPT F+GVPRV+EK+QE+++++                                   +AS N    K+L   KV++ LGLDRC    +GAAPI+++TLEFF  +D+ ++++YGMSES+GPHTI   +  +L   G ++ G + K+ +PD    GEIC  GRHVF+GY N  EKT EALD+  WLHSGDLGK D + +L +TGRIKEL+ITAGGEN+ PVPIED +K  +P ISN ML+GDK+KF+S LLT+K++++++T  P ++L+  A+      G  A  V ++      ++++ I   +N+VN ++ S A  +QK+T+L +DFS+ GGELGPT+K+KR  VM+ Y++ I++ Y
Sbjct:  147 ISYKEYFDTCLIAAKSFLKLGLERCHGVGILGFNSPEWFISDIGAIFAGGFAVGIYTTNSPEACQYVAENCQANILVVENHKQLQKILQIQDKLPHLKAIIQY-----KDALKEKRPNLYTWEEFLELGRNEPDTKLNDIIDSQKPNQCCTLIYTSGTTGQPKGVMLSHDNLTWTAFATARNVNLDYADQSQEEVISYLPLSHIAAQMIDIWITMQVGGATYFAQPDALKGSLANTLREVRPTAFMGVPRVWEKMQEKMKSIGAKSSTVRRKVASWAKDVGLHTNLSKMEQQNGSMARASLNYRLAKRLVFRKVRKALGLDRCRLCFTGAAPITKETLEFFLSLDLPVYELYGMSESTGPHTISLPNAFRLTSCGKVIPGCQTKLFSPDAEGNGEICFWGRHVFMGYLNMTEKTAEALDADGWLHSGDLGKHDKDDFLFITGRIKELIITAGGENIPPVPIEDAVKEVVPLISNAMLIGDKRKFLSMLLTIKSEVNAETGAPEDELTPEAVEFCRKLGSNATRVSEVAGGRDHLVQAAIQEGINKVNKKATSNAQRIQKFTVLEQDFSITGGELGPTMKLKRPVVMKMYKEQIENFY 738          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Cavefish
Match: ENSAMXT00000016625.2 (long-chain-fatty-acid--CoA ligase ACSBG2-like [Source:NCBI gene;Acc:103043523])

HSP 1 Score: 518.85 bits (1335), Expect = 7.815e-172
Identity = 268/623 (43.02%), Postives = 390/623 (62.60%), Query Frame = 3
Query:  834 TIINRLKENVESQPNHVVLKHKSDPKKDYDLSLTMKEYLEQITKAATGFITLGLEPKAAICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKILSILPGVPQVKAIIKYTGEVQEEAKKKSKIP-IYTWSQFLSIDSTNATDELHNRQENVKPKDCAVLIYTSGTTGLPKGVMLSHDNILFTLKMVQIHLELKKFQNIIISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKTLKEVRPTVFLGVPRVYEKIQEQLENLKA------------------STNKKL----DSV-------------KVKQNLGLDRCEYIASGAAPISQQTLEFFQDIDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDENLIGEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIEAKEVEDLLNSNFAVLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMY 2594
            TI    ++ V    +H  L+ K +       +LT K+Y +    AA  F+ LGLE    + ILGFN P WFIS +  I AGG++ GIYT+N+AE C+Y+  +C+  ++++EN+ QL KIL +   +P +KAI++Y GE++       KIP +YTW+ F+ + +  A D+L +   +    +C  LIYTSGTTG PKGVMLSHDNI +      + +  K  +  ++SYLPLSHVAA + D+  ++    T +FA+PDALKGSL  TL++VRPT FLGVPRV+EK+QE ++++ A                   TN  L     SV             +V+  LGLDRC    +GAAPI+++TLE+F  ++I ++++YGMSES+GPHT+  ++  ++   G +++G + K++ PDE+  GE+C  GRHVF+GY N  EKT EALD++ WLHSGDLGK+D   ++ +TGRIKEL+ITAGGENV PVPIED +K E+  ISN MLVGDKKKF++ +L            PT++L+  A+   +  G+ A +V +++N+    +   I   +N +N ++ S A  VQKWT+LPRDFS+ GGELGPT+K+KR  V + Y+D I   Y
Sbjct:  153 TIHQMFQDTVNKYGDHPALRWKENGAW---TTLTYKQYYQHCRTAAKSFLKLGLERFHGVGILGFNSPEWFISNVACIMAGGLTTGIYTTNSAEACQYVAHNCEANVIVVENNKQLVKILQVKDQLPHLKAIVQYKGELER------KIPNLYTWADFMKLGTDIADDQLDDLINSQNANECCSLIYTSGTTGNPKGVMLSHDNITWIANASGMMIGTKMKEESLVSYLPLSHVAAQVNDLWVSMKFAGTTHFAEPDALKGSLANTLRDVRPTSFLGVPRVWEKMQEAMQSIGAKNSAMKKRIADWAKGIGLQTNYNLMNGDTSVPWGFMLANNLIFKRVRAALGLDRCRTCFTGAAPITKETLEYFMSLNIQLYELYGMSESTGPHTLSWENNFRIMSCGKVIRGCKTKLDKPDEDGNGEVCFWGRHVFMGYLNMPEKTDEALDTEGWLHSGDLGKLDQNDFMYITGRIKELIITAGGENVPPVPIEDALKEEVSIISNAMLVGDKKKFLA-MLLTLKCKVDDNGDPTDELTPLAVEYCQQRGVTATKVSEIINNKEPAIYKAIQEGVNIINEKATSNAQRVQKWTLLPRDFSISGGELGPTMKLKRPVVSKMYKDDIDKFY 765          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Cavefish
Match: acsbg1 (acyl-CoA synthetase bubblegum family member 1 [Source:NCBI gene;Acc:103040425])

HSP 1 Score: 463.381 bits (1191), Expect = 2.713e-151
Identity = 244/594 (41.08%), Postives = 363/594 (61.11%), Query Frame = 3
Query:  927 SLTMKEYLEQITKAATGFITLGLEPKAAICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKILSILPGVPQVKAIIKYTGEVQEEAKKKSKIP-IYTWSQFLSIDSTNATDELHNRQENVKPKDCAVLIYTSGTTGLPKGVMLSHDNILFTLKMVQIHLELKKF---QNIIISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKTLKEVRPTVFLGVPRVYEKIQEQLEN--LKASTNKK----------LDS----------------------VKVKQNLGLDRCEYIASGAAPISQQTLEFFQDIDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDENLIGEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIEAKEVEDLLNSNFAVLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMY 2594
            +++  +Y ++    A  F+ LGLE   ++ ILG N   WF S +G ++AGG + GIY++N+ E C +I  D +  I++++++ QL+KIL I   +P +KAI++ +G +      K K+P +Y+W QF+ +      + L    ++ KP  C VLIYTSGTTGLPKGVMLSHDNI +T        +++     Q  I+SYLPLSH+AA + D+ + +  G  +YFA+PDALKG+L  TLKE  P+  +GVPRV+EK+ E++++   +A+  K+          LD+                       K++  LG   CE   SGAAPI   T +FF  ++I +++ YGMSESSGPH +      K+   G ++ G   KI N D    GE+C+ GR++F+GY N  +KT EA D   WL SGDLGK+D +G+L +TGR+KEL+ITAGGENV PVPIED +K ELP +S+ ML+GDK+KF+S LLT+K   +  T  PT+ LS  A++  +  G +A +V D+      ++   I   + RVNA++ S A  +QKWTIL +DFS+ GGELGPT+K++R   ++ Y + I++ Y
Sbjct:  111 TISFCQYYDRCRMTAKSFLKLGLERFHSVAILGSNSEEWFFSAVGAVFAGGFATGIYSTNSPEACHHIASDSRANIIVVDSNWQLDKILLIKDNLPHLKAIVQISGCL------KKKLPNLYSWEQFMQLGQDIPDETLDGIIKSQKPNQCCVLIYTSGTTGLPKGVMLSHDNITWTACHASRAGDMQPAEIKQETIVSYLPLSHIAAQIYDMWTGIQWGEMVYFARPDALKGTLVHTLKEATPSSHMGVPRVWEKMMEKIKHELSRAAYLKRKLVNWAMSVTLDANLTYGKDEEKPFLFGVVNSLVIEKLRAELGFSNCEKFFSGAAPIGWDTYKFFLGLNIHLYEAYGMSESSGPHFMSGPQTYKMKSCGKVVPGCRCKIANEDAGGSGEVCLWGRNIFMGYLNMKDKTVEAFDEDGWLCSGDLGKLDEDGFLFITGRLKELIITAGGENVPPVPIEDAVKEELPIVSHAMLIGDKRKFLSMLLTVKCVFNLDTMEPTDDLSPEAVKFCQRLGSQATKVSDITGGKDKLVNHAIQEGIARVNARATSNAQRIQKWTILGKDFSVSGGELGPTMKLRRAAALKMYHNEIEAFY 698          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Cavefish
Match: acsl5 (acyl-CoA synthetase long chain family member 5 [Source:NCBI gene;Acc:103039859])

HSP 1 Score: 157.147 bits (396), Expect = 1.940e-39
Identity = 160/610 (26.23%), Postives = 272/610 (44.59%), Query Frame = 3
Query:  930 LTMKEYLEQITKAATGFITLGLEPK--AAICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKILS-----ILPGVPQVKAIIKYTGEVQEEAKKKSKIPIYTWSQFLSIDSTNATD-ELHNR---QENVKPKDCAVLIYTSGTTGLPKGVMLSHDNILFTLKMVQIHLELKKFQ--------NIIISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKTLKEVRPTVFLGVPRVYEKIQEQLENLKASTNKKL--------------------DSV-------KVKQNLGLDRCEYIASGAAPISQQTLEFFQD-IDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDE------NLIGEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIED-NIKSELPFISNVMLVGDKKKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIEAKEVEDLLNSNFAVLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMYT 2597
            L  K+  ++     +G +  GL+P   + I I   N P W ISEL       V+  +Y +   E   +I+       +I +  ++   +L      ++P +  +  +  +   V + A K              ++  N  D E+H+    +   KP+D +++ +TSGTTG PKG ML+H+N++           +K F+        ++ IS+LPL+H+   ++      G G  + F Q D     L   +K ++PTVF  VPR+  ++ +++++   +  KK                     DS+       KV+++LG  R   + +GAAPIS   L F +  +   I + YG +E +   TI    +   G VG  +    +K+ + +E      N  GE+C++G++VF GY N  E+T EALD   WLH+GD+GK    G L +  R K +   A GE +AP  IE+  I+S L  ++ V + GD  +  S L+ +            EKLS+    S+E            L  N  + K+ I +         +     V+   +    F+++ G L PTLK KR  + + ++  I S+Y 
Sbjct:  106 LKYKQVSDRAEYLGSGLLHRGLKPSPDSFIGIFAQNRPEWIISELACYTYSMVAVPLYDTLGPEALIFIINRGSISTVICDKQNKAETLLDSCEKKLIPVLNTIIIMDPFDAAVGDRASK------------CGVEILNLKDVEVHSNSIYRFPPKPEDLSIVCFTSGTTGDPKGAMLTHENVVADAASF-----VKSFESAFTPLPTDVTISFLPLAHMFERVVQTV-LYGAGGRVGFFQGDIR--LLPDDMKTLKPTVFPVVPRLLNRVYDRVQSGAQTPFKKWLLNFAIERKHAEVKEGIIRNDSIWDKFIFHKVQESLG-GRVRVMVTGAAPISPSVLSFLRACLGCQIFEAYGQTECTAGCTISLPGDWTAGHVGVPVPCNVVKLVDVEEMNYFASNDEGEVCIKGKNVFRGYLNDPERTAEALDQDGWLHTGDIGKWLSSGVLKIIDRKKNIFKLAQGEYIAPEKIENVYIRSAL--VAQVFVHGDSLQ--SSLVAIVVPDPEVLPGYAEKLSLKG--SMEE-----------LCKNQQIKKAIITDLTKLGREAGLKSFEQVKDLYLHADQFTIENGLLTPTLKAKRPELCKYFKTQIDSLYA 677          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Cavefish
Match: acsl5 (acyl-CoA synthetase long chain family member 5 [Source:NCBI gene;Acc:103039859])

HSP 1 Score: 156.762 bits (395), Expect = 2.807e-39
Identity = 157/611 (25.70%), Postives = 268/611 (43.86%), Query Frame = 3
Query:  930 LTMKEYLEQITKAATGFITLGLEPK--AAICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKILS-----ILPGVPQVKAIIKYTGEVQEEAKKKSKIPIYTWSQFLSIDSTNATDELHNRQENVK------PKDCAVLIYTSGTTGLPKGVMLSHDNILFTLKMVQIHLELKKFQ--------NIIISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKTLKEVRPTVFLGVPRVYEKIQEQLENLKASTNKKL--------------------DSV-------KVKQNLGLDRCEYIASGAAPISQQTLEFFQD-IDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDE------NLIGEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIEAKEVEDLLNSNFAVLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMYT 2597
            L  K+  ++     +G +  GL+P   + I I   N P W ISEL       V+  +Y +   E   +I+       +I +  ++   +L      ++P +  +  +  +   V + A K              ++  N  D     ++N+K      P+D +++ +TSGTTG PKG ML+H+N++           +K F+        ++ IS+LPL+H+   ++      G G  + F Q D     L   +K ++PTVF  VPR+  ++ +++++   +  KK                     DS+       KV+++LG  R   + +GAAPIS   L F +  +   I + YG +E +   TI    +   G VG  +    +K+ + +E      N  GE+C++G++VF GY N  E+T EALD   WLH+GD+GK    G L +  R K +   A GE +AP  IE N+      ++ V + GD  +  S L+ +            EKLS+    S+E            L  N  + K+ I +         +     V+   +    F+++ G L PTLK KR  + + ++  I S+Y 
Sbjct:  106 LKYKQVSDRAEYLGSGLLHRGLKPSPDSFIGIFAQNRPEWIISELACYTYSMVAVPLYDTLGPEALIFIINRGSISTVICDKQNKAETLLDSCEKKLIPVLNTIIIMDPFDAAVGDRASK------------CGVEILNLKDVEALGKDNIKKPVPPKPEDLSIVCFTSGTTGDPKGAMLTHENVVADAASF-----VKSFESAFTPLPTDVTISFLPLAHMFERVVQTV-LYGAGGRVGFFQGDIR--LLPDDMKTLKPTVFPVVPRLLNRVYDRVQSGAQTPFKKWLLNFAIERKHAEVKEGIIRNDSIWDKFIFHKVQESLG-GRVRVMVTGAAPISPSVLSFLRACLGCQIFEAYGQTECTAGCTISLPGDWTAGHVGVPVPCNVVKLVDVEEMNYFASNDEGEVCIKGKNVFRGYLNDPERTAEALDQDGWLHTGDIGKWLSSGVLKIIDRKKNIFKLAQGEYIAPEKIE-NVYIRSALVAQVFVHGDSLQ--SSLVAIVVPDPEVLPGYAEKLSLKG--SMEE-----------LCKNQQIKKAIITDLTKLGREAGLKSFEQVKDLYLHADQFTIENGLLTPTLKAKRPELCKYFKTQIDSLYA 679          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Sea Lamprey
Match: acsbg2 (acyl-CoA synthetase bubblegum family member 2 [Source:ZFIN;Acc:ZDB-GENE-030131-7099])

HSP 1 Score: 514.227 bits (1323), Expect = 1.316e-171
Identity = 265/595 (44.54%), Postives = 371/595 (62.35%), Query Frame = 3
Query:  930 LTMKEYLEQITKAATGFITLGLEPKAAICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKILSILPGVPQVKAIIKYTGEVQEEAKKKSKIPIYTWSQFLSIDSTNATDELHNRQENVKPKDCAVLIYTSGTTGLPKGVMLSHDNILFTL----KMVQIHLELKKFQNIIISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKTLKEVRPTVFLGVPRVYEKIQEQLENLKAST---------------------NKKLDSV---------------KVKQNLGLDRCEYIASGAAPISQQTLEFFQDIDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDENLIGEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIEAKEVEDLLNSNFAVLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMY 2594
            LT KEY  Q  +AA  F+ LGL+    + ILGFN   WFIS++G I AGG + GIYT+N+AE C+Y+  +C   I+++END QL KIL +   +P +KAI++Y GE++E+     K  +Y+W++F+         +L     + +   C  LIYTSGTTG PKGVMLSHDN+ +T     ++ Q+      +Q ++ISYLPLSH+AA ++DI   +  G   YFAQPDALKGSL  T+KEVRPT F+GVPRV+EK+ E+++   A +                     N K +                 KV++ LGLDRC    +GAAPI++ TLEFF  +DI + ++YGMSESSGPHTI      ++G  GTL++G    + + DE   GE+C  GRHVF+GY N  EKT+EA+D   WLHSGDLG+VD +G L +TGRIKEL+ITAGGENV P+PIED IK ELP +SN M++GD++KF+S LLTLK + +  +  P + L+   +   +  G  A     +      V++  I + + RVN ++ S A  VQKW +L RDFS+ GGELGPT+K+KR  V + Y+++I+ +Y
Sbjct:  111 LTYKEYYAQCRQAAKSFLKLGLQRYHGVGILGFNSAEWFISDIGAILAGGFAVGIYTTNSAEACQYVADNCLANIIVVENDKQLQKILEVQSQLPHLKAIVQYKGELKEK-----KPNVYSWAEFMRAGEEVPDAQLDAIIASQRANQCCSLIYTSGTTGSPKGVMLSHDNLTWTATVTGELTQLRSADDNYQEVVISYLPLSHIAAQLVDIWLPMRFGGVTYFAQPDALKGSLVVTMKEVRPTGFMGVPRVWEKMMEKMKATAAKSGIFKRKIAGWAKSVGLQTHLANMKGNPAEAPMGYTLANMLVFKKVREALGLDRCTKCYTGAAPITRDTLEFFLSLDIPVFELYGMSESSGPHTISSPTAFQIGSCGTLLRGCRTLLHSKDEEGSGEVCFWGRHVFMGYLNMEEKTREAIDDDGWLHSGDLGRVDEQGLLYITGRIKELIITAGGENVPPIPIEDAIKEELPVVSNAMVIGDRRKFLSVLLTLKCESNGDSGEPDDALTDEVVHWCQRVGSTATRASQIAGGKDPVVERAIRDGIERVNKRAPSNAQRVQKWELLLRDFSIPGGELGPTMKLKRPVVTKIYQELIERLY 700          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Sea Lamprey
Match: ACSL1 (acyl-CoA synthetase long chain family member 1 [Source:HGNC Symbol;Acc:HGNC:3569])

HSP 1 Score: 164.081 bits (414), Expect = 2.333e-42
Identity = 163/612 (26.63%), Postives = 280/612 (45.75%), Query Frame = 3
Query:  906 PKKDYDLSLTMKEYLEQITKAATGFITLGLEPKA--AICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKILSILPGVPQ-----VKAII---KYTGEVQEEAKKKSKIPIYTWSQFLSIDSTNATDELHNRQENVKPKDCAVLIYTSGTTGLPKGVMLSHDNILFTLKM---VQIHLELKKFQNIIISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKTLKEVRPTVFLGVPRVYEKIQEQLEN----------LKASTNKKL----------DSV-------KVKQNLGLDRCEYIASGAAPISQQTLEFFQDI-DILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDE------NLIGEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIEAKEVEDLLNSNFAVLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRD-FSLKGGELGPTLKMKRMFVMEKYEDVIKSMYT 2597
            P   Y+  ++ KE  ++     +GF+ LG +P +   I I   N P W I+E        V   +Y +   E   YI+   +  +++    D+L K+  +L  + +     VK I+    + G V E+  +K  I +  + +   I  TN     H      +P D A++ YTSGTTG PKG ML+H N++        +     L    +++IS+LPL+H+   +++ AS +  G  + F Q D     L   +K ++PTVF  VPR+  +I +++ +          L+ + ++K+          DS+       +V+ ++G  R  ++ +GAAPIS   L F + I    +++ +G +E +   T     +   G VG  M    +K+ +  E      N  GE+C+ G +VF GY     +T EALD   WLH+GD+GK    G L +  R K +   + GE +AP  IE       P ++ V + GD  +  SC             +P  ++  S +   +  GI+       +N +   +++ I + M R+  ++  K+    +   L  D FS++ G L PT K+KR  V + +   I S+Y 
Sbjct:  116 PNHPYEW-ISYKETSDRAEYLGSGFLHLGAKPSSEQVIGIFSQNRPEWIIAEQACYTYSLVVVPLYDTLGRESIDYIINQAEISMVVC---DKLEKVKGLLESIEEGAIRIVKTIVVMDPFDG-VMEQRARKCGIDLILFRELEVIGKTN-----HREPIPPQPDDIAIICYTSGTTGNPKGAMLTHKNMISDFSAFLAITKDTFLPNTDDVLISFLPLAHMFERLVE-ASILCNGGRVGFYQGDIRL--LMDDMKVLQPTVFPVVPRLLNRIHDKVLSGAKSHFKRWLLEFAVSRKIAELRCGVVRKDSIWDKLIFHRVQASMG-GRVRFMVTGAAPISASILTFLRAILGCQVYEGFGQTECTAGCTFTMPSDSTAGHVGPPMPCNHIKVVDVAEMNYFAANGEGEVCVYGTNVFKGYLKDPTRTAEALDEDGWLHTGDIGKWLPNGTLKIVDRKKHIFKLSQGEYIAPEKIETVYVRSEP-VAQVFVHGDSLQ--SC--------LVCIVVPDMEVLPSWV---QKRGIKCNPNSVFINKD---VRAAILHDMVRLGKEAGLKSFEQVRAVHLHSDLFSIENGLLTPTFKVKRAEVCKFFHSEIDSLYA 696          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Sea Lamprey
Match: ACSL1 (acyl-CoA synthetase long chain family member 1 [Source:HGNC Symbol;Acc:HGNC:3569])

HSP 1 Score: 149.058 bits (375), Expect = 1.085e-38
Identity = 131/448 (29.24%), Postives = 214/448 (47.77%), Query Frame = 3
Query: 1362 KPKDCAVLIYTSGTTGLPKGVMLSHDNILFTLK---MVQIHLELKKFQNIIISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKTLKEVRPTVFLGVPRVYEKIQEQL----------ENLKASTNKKLDSVK---VKQNLGLD-------------RCEYIASGAAPISQQTLEFFQDI-DILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDENLI------GEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIEAKEVEDLLNSNFAVLKSTIDNAMNRVNAQS-VSKAAYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMY 2594
            KP+D A++ +TSGTTG PKG ML+H NI+  +     V   L L +  +I ISYLPL+H+   ++  A+    G++I F Q D     L   ++ +RPTVF  VPR+  ++ +++          + L+    +K+  ++   V++N   D             R   I +GAAPIS   L F + +    +++ YG +E +   T+    + K G VG  M    +K+ +  +         GE+C++G +VF GY    EKT EA+D   WLH+GD+G+    G L +  R K +   A GE +AP  IE N+ S    ++ V + GD  +  +C             +P  ++    IR     G  ++     L  N  V ++ +++ M R+  +S +     V+   +    FS++ G L PT K KR  +   +  VI SMY
Sbjct:   17 KPEDLAIVCFTSGTTGNPKGAMLTHRNIVSDMSGFLKVTESLFLPETSDIAISYLPLAHMFERLVQ-ATLFCHGASIGFFQGDVR--LLLDDMQALRPTVFPVVPRILNRMYDKVLGSTRTPFRRKLLEFGARRKMAELQRGVVRRNSLWDWLVFRPMQLSVGGRVRMIMTGAAPISPGVLNFLRVVMGCQMYEGYGQTECTAGCTLTLPGDWKAGHVGAPMPCNYIKLHDVKDMEYYTSQGKGEVCVKGPNVFKGYLKDAEKTAEAVDRDGWLHTGDIGQWMPNGTLKIIDRKKHIFKLAQGEYIAPEKIE-NVYSRCEPVAQVYVHGDSLQ--AC--------LVAVVVPDPEILCCWIRKKGIVGTYSE-----LCRNKEVRQAILED-MQRLGKESDLQPFEQVKDVHLHNEMFSIENGLLTPTFKAKRTELRTHFRSVISSMY 444          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Sea Lamprey
Match: acsl3b (acyl-CoA synthetase long chain family member 3b [Source:ZFIN;Acc:ZDB-GENE-030131-492])

HSP 1 Score: 78.1814 bits (191), Expect = 6.044e-16
Identity = 79/303 (26.07%), Postives = 135/303 (44.55%), Query Frame = 3
Query: 1194 SILPGVPQVKAIIKYTGEVQEEAKKKSKIPIYTWSQFLSIDSTNATDELHNRQ---ENVKPKDCAVLIYTSGTTGLPKGVMLSHDNILFTLKMVQIHLELKKFQNIIISYLPLSHV---AANMLDIASTVGMGSTIYFAQPDAL--------KGSLGKTLKEVRPTVFLGVPRVYEKIQEQLEN------------LKASTNKKLDSV---------------KVKQNLGLDRCEYIASGAAPISQQTLEFFQDIDIL-IHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDEN 1976
            +IL  VP+++ ++   G     A    K+P       +S D     D+  +RQ   +   P+D AV++YTSG+TG+PKGV ++H N++  +  + + +      +  I YLPL+HV    A M+ ++     G  I ++    L        KGS G  +  +RPT+   VP + E+I + +               K + N KL+ +               K+   LG      + SGAAP+S +T  F        + Q YG++E+    TI +  +   G VG  +   E+++ N +E 
Sbjct:    2 AILMQVPRLRYVVLVDGTASGVAG--VKLPRGIEVMGMS-DVEELGDKPQHRQRARDRPGPRDLAVVMYTSGSTGIPKGVRIAHSNLVAAITGMYLRINDICGDDTYIGYLPLAHVLELGAEMVCLSR----GCRIGYSSAQTLTDQSTRIKKGSQGD-VTILRPTLMAAVPEIMERIYKGVMGKVQCMSLLQRIIFKLAYNYKLEQLERGFDTPLCNRLVFNKLCALLG-GNVRLLLSGAAPLSPRTQRFMNVCFCCPVGQGYGLTETCAAGTIAELQDYSTGHVGAPLSCCEIQLRNWEEG 295          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Yeast
Match: FAA2 (Medium chain fatty acyl-CoA synthetase; activates imported fatty acids; accepts a wide range of fatty acid chain lengths with a preference for medium chains, C9:0-C13:0; localized to the peroxisome; comparative analysis suggests that a mitochondrially targeted form may result from translation starting at a non-canonical codon upstream of the annotated start codon [Source:SGD;Acc:S000000817])

HSP 1 Score: 155.606 bits (392), Expect = 1.202e-39
Identity = 127/471 (26.96%), Postives = 219/471 (46.50%), Query Frame = 3
Query: 1011 ICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKILSILPGVPQVKAIIKYTGEVQEEAK--KKSKIPIYTWS-----QFLSIDSTNATDELHNRQENVKPKDCAV--LIYTSGTTGLPKGVMLSHDNIL----FTLKMVQIHLELKKFQNIIISYLPLSHVAANML---DIASTVGMGSTIYFAQPDALKGSLGKTLKEVRPTVFLGVPRVYEKIQEQLEN-LKAST------NKKLDSV--------------------------KVKQNLGLDRCEYIASGAAPISQQTLEFFQD-IDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIE-------NPDENLIGEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKK 2252
            + IL  N+P W +++L        +  +Y +      +YI+   +  ILI    +  + +L ++P +  V  ++       +E +   +S +P+   S      F S++         N+   + P   ++  + +TSGTTGLPKGV +SH NI     F     +I  + +  Q   + +LPL+H+   M+   D+A   G+G   +  +PD     L + LK ++P     VPR+  + +  ++N L  ST      N  LDS                           K++ +LGL    +I +G+APIS+ TL F +  +DI I Q YG++E+     + +  EK +G  G +    E +++       + D++L GE+ +RG  VF  YF    +T +A+D   W  +GD+  +DG+G + V  R+K     A GE +AP  IE+   S  P+I+ + + GD  K
Sbjct:  166 VAILSHNNPEWILTDLACQAYSLTNTALYETLGPNTSEYILNLTEAPILIFAKSNMYH-VLKMVPDMKFVNTLVCMDELTHDELRMLNESLLPVKCNSLNEKITFFSLEQVEQVG-CFNKIPAIPPTPDSLYTISFTSGTTGLPKGVEMSHRNIASGIAFAFSTFRIPPDKRNQQLYDMCFLPLAHIFERMVIAYDLAIGFGIG---FLHKPDPT--VLVEDLKILKPYAVALVPRILTRFEAGIKNALDKSTVQRNVANTILDSKSARFTARGGPDKSIMNFLVYHRVLIDKIRDSLGLSNNSFIITGSAPISKDTLLFLRSALDIGIRQGYGLTETFAGVCLSEPFEKDVGSCGAIGISAECRLKSVPEMGYHADKDLKGELQIRGPQVFERYFKNPNETSKAVDQDGWFSTGDVAFIDGKGRISVIDRVKNFFKLAHGEYIAPEKIENIYLSSCPYITQIFVFGDPLK 629          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Yeast
Match: FAA1 (Long chain fatty acyl-CoA synthetase; activates fatty acids with a preference for C12:0-C16:0 chain lengths; role in the competitive import of long-chain fatty acids and sphingoid long-chain bases; accounts for most acyl-CoA synthetase activity; localizes to lipid particles and the plasma membrane; role in sphingolipid-to-glycerolipid metabolism; forms ER foci upon replication stress; faa1 faa4 double null complemented by any of human ACSBG1, ACSL1, 3, 4, 5, 6, SLC27A2, or 4 [Source:SGD;Acc:S000005844])

HSP 1 Score: 115.546 bits (288), Expect = 5.943e-27
Identity = 90/333 (27.03%), Postives = 160/333 (48.05%), Query Frame = 3
Query: 1371 DCAVLIYTSGTTGLPKGVMLSHDNILFTLKMVQIH-LELKKFQNIIISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKT----LKEVRPTVFLGVPRVYEKIQE----QLENLKASTNKKLDSVKVKQNLGLDRC------------------------EYIASGAAPISQQTLEFFQDIDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDE------NLIGEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKK 2252
            D   ++YTSG+TG PKGV+L H N++  +    ++ L+     + +I +LPL+H+   + ++ S    G+ I +A    L  S  +     L+E +PT+ +GV  V+E +++    Q++NL   T KK+        L + R                          Y+ +G +PIS+   EF  ++   +   YG++E+    TI      +LG  G L   V +K+ + +E      N  GE+ + G +V   Y+   E+T +AL S  W  +GD+G+ +  G+L +  R K L+ T  GE +A   +E   +S   +++N+ +  D+ K
Sbjct:  263 DLCCIMYTSGSTGEPKGVVLKHSNVVAGVGGASLNVLKFVGNTDRVICFLPLAHIFELVFELLSFY-WGACIGYATVKTLTSSSVRNCQGDLQEFKPTIMVGVAAVWETVRKGILNQIDNLPFLT-KKIFWTAYNTKLNMQRLHIPGGGALGNLVFKKIRTATGGQLRYLLNGGSPISRDAQEFITNLICPMLIGYGLTETCASTTILDPANFELGVAGDLTGCVTVKLVDVEELGYFAKNNQGEVWITGANVTPEYYKNEEETSQALTSDGWFKTGDIGEWEANGHLKIIDRKKNLVKTMNGEYIALEKLESVYRSN-EYVANICVYADQSK 592          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Yeast
Match: FAA4 (Long chain fatty acyl-CoA synthetase; activates fatty acids with a preference for C12:0-C16:0 chain lengths; role in the competitive import of long-chain fatty acids and sphingoid long-chain bases; role in stationary phase survival; localizes to lipid particles and the plasma membrane; role in sphingolipid-to-glycerolipid metabolism; forms cytoplasmic foci upon replication stress; faa1 faa4 double null complemented by any of human ACSBG1, ACSL1, 3, 4, 5, 6, SLC27A2, or 4 [Source:SGD;Acc:S000004860])

HSP 1 Score: 92.8189 bits (229), Expect = 9.064e-20
Identity = 107/498 (21.49%), Postives = 211/498 (42.37%), Query Frame = 3
Query:  924 LSLTMKEYLEQITKAATGFITLGLEPKA--AICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKILSILPGVPQVKAII----------KYTGEVQEEAKK--------KSKIPIYTWSQFLSIDSTNATDELHNRQENVKPKDCAVLIYTSGTTGLPKGVMLSHDNILFTLKMVQIH-LELKKFQNIIISYLPLSHVAANMLDIASTVGMG----STIYFAQPDALKGSLGKTLKEVRPTVFLGVPRVYEKIQE----QLENLKASTNKKLDSV--------------------KVKQNLGLDRCEYIASGAAPISQQTLEFFQDIDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDE------NLIGEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKK 2252
            +++T +E +  +     G I +G++P       I       W  + LG +  G      Y +       + M++    + I  ++  L+K+   L     VK +I          +  G++ + AK         +  I IY++ + + I    A DE+       KP+D A ++YTSG+TG PKGV+L+H NI+  +  V  + +      + II++LPL+H+     +  +    G    + +    P + +   G  L E +PTV +GV  V+E +++    ++  L   +     +V                    ++++  G     +I +G + IS    +F  ++   +   YG++E      + + +    G  G L+  +  K+ + ++      N  GE+  +G  +   Y+   E+T  A     W  +GD+ +   +G + +  R K L+ T  GE +A   +E   +S  P++ N+ +  D+ K
Sbjct:   98 ITMTYEEMICVMHDIGRGLIKIGVKPNGENKFHIFASTSHKWMKTFLGCMSQGIPVVTAYDTLGESGLIHSMVETD-SVAIFTDNQLLSKLAVPLKTAKNVKFVIHNEPIDPSDKRQNGKLYKAAKDAVDKIKEVRPDIKIYSFDEIIEI-GKKAKDEV--ELHFPKPEDPACIMYTSGSTGTPKGVVLTHYNIVAGIGGVGHNVIGWIGPTDRIIAFLPLAHIFELTFEFEAFYWNGILGYANVKTLTPTSTRNCQGD-LMEFKPTVMVGVAAVWETVRKGILAKINELPGWSQTLFWTVYALKERNIPCSGLLSGLIFKRIREATG-GNLRFILNGGSAISIDAQKFLSNLLCPMLIGYGLTEGVANACVLEPEHFDYGIAGDLVGTITAKLVDVEDLGYFAKNNQGELLFKGAPICSEYYKNPEETAAAFTDDGWFRTGDIAEWTPKGQVKIIDRKKNLVKTLNGEYIALEKLESIYRSN-PYVQNICVYADENK 588          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Yeast
Match: FAA3 (Long chain fatty acyl-CoA synthetase; activates imported fatty acids with a preference for C16:0-C18:0 chain lengths; green fluorescent protein (GFP)-fusion protein localizes to the cell periphery [Source:SGD;Acc:S000001271])

HSP 1 Score: 88.5817 bits (218), Expect = 1.814e-18
Identity = 92/370 (24.86%), Postives = 167/370 (45.14%), Query Frame = 3
Query: 1269 KSKIPIYTWSQFLSIDSTNATDELHNRQENVKPKDCAVLIYTSGTTGLPKGVMLSHDNILFTLKMVQIHLELKKFQNI-----IISYLPLSHVAANMLDIAS-----TVGMGS--TIYFAQPDALKGSLGKTLKEVRPTVFLGVPRVYEKIQ----EQLENLKASTNKKLDSV--------------------KVKQNLGLDRCEYIASGAAPISQQTLEFFQDIDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDE------NLIGEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKK 2252
            +  I IY++ + + I    + DE+  +    +PKD A ++YTSG+   PKGV+L+H NI+  +  V  ++    F  I     ++S+LPL+H+   + +  +      +G GS  T+        KG     L E +PT+ +GV  V+E ++    E++ +L     K   S                     KV+Q  G    +YI +G + IS    +FF  +   +   YG++E+     + + D  + G VG L+  V  K+ +  +      N  GE+ ++G  V   Y+    +T  +     W  +GD+ +   +G L +  R K L+ T  GE +A   +E   +S   ++ N+ +  D+ +
Sbjct:  232 RPDIKIYSFEEVVKI-GKKSKDEV--KLHPPEPKDLACIMYTSGSISAPKGVVLTHYNIVSGIAGVGHNV----FGWIGSTDRVLSFLPLAHIFELVFEFEAFYWNGILGYGSVKTLTNTSTRNCKGD----LVEFKPTIMIGVAAVWETVRKAILEKISDLTPVLQKIFWSAYSMKEKSVPCTGFLSRMVFKKVRQATG-GHLKYIMNGGSAISIDAQKFFSIVLCPMIIGYGLTETVANACVLEPDHFEYGIVGDLVGSVTAKLVDVKDLGYYAKNNQGELLLKGAPVCSEYYKNPIETAVSFTYDGWFRTGDIVEWTPKGQLKIIDRRKNLVKTLNGEYIALEKLESVYRSN-SYVKNICVYADESR 588          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Yeast
Match: PCS60 (Oxalyl-CoA synthetase; capable of catalyzing conversion of oxalate to oxalyl-CoA; catalyzes first step in pathway of oxalate degradation that functions to protect yeast from inhibitory effects of oxalate; peroxisomal protein that binds mRNA; localizes to both peroxisomal peripheral membrane and matrix, expression is highly inducible by oleic acid; similar to E. coli long chain acyl-CoA synthetase [Source:SGD;Acc:S000000426])

HSP 1 Score: 80.8777 bits (198), Expect = 2.752e-16
Identity = 82/288 (28.47%), Postives = 135/288 (46.88%), Query Frame = 3
Query: 1362 KPKDCAVLIYTSGTTGLPKGVMLSHDNIL-FTLKMVQIHLELKKFQNIIISY--LPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSL-GKTLKEVRPTVFLGVPRVYEKIQEQLENLKASTNKKLDSVKVKQNLGLDRCEYIASGAAPISQQTLEFFQDIDILIHQIYGMSESSGPHTIGK--KDEKKLGCVGTLMKGVELKIENPDENL-----IGEICMRGRHVFLGYFNAVEKTKEALD-SQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIE 2189
            +  D A++++TSGTT  PK V L H NI+  TL +   +    K   +  SY  +PL HV   +  + ST     ++    PD     L      +     F  VP +       +  L          ++      +  C   +S  AP +   LE  ++ +  + + Y M+E+S   T       ++K G VG   +GV + I + ++N+     +GE+ +RG +V LGY N  +  KE     +N+  +GD G  D EG+L++TGRIKE LI  GGE ++P+ ++
Sbjct:  187 RSSDVALILHTSGTTSTPKTVPLLHLNIVRSTLNIANTY----KLTPLDRSYVVMPLFHVHGLIGVLLSTFRTQGSV--VVPDGFHPKLFWDQFVKYNCNWFSCVPTI------SMIMLNMPKPNPFPHIRF-----IRSC---SSALAPATFHKLE--KEFNAPVLEAYAMTEASHQMTSNNLPPGKRKPGTVGQ-PQGVTVVILDDNDNVLPPGKVGEVSIRGENVTLGYANNPKANKENFTKRENYFRTGDQGYFDPEGFLVLTGRIKE-LINRGGEKISPIELD 450          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Nematostella
Match: EDO32054 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW65])

HSP 1 Score: 441.039 bits (1133), Expect = 3.905e-145
Identity = 246/573 (42.93%), Postives = 342/573 (59.69%), Query Frame = 3
Query:  909 KKDYDLSLTMKEYLEQITKAATGFITLGLEPKAAICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKILSILPGVPQVKAIIKYTGEVQEEAKKKSKIPIYTWSQFLSIDSTNATDELHNRQENVKPKDCAVLIYTSGTTGLPKGVMLSHDNILFTLKMVQIHLELKKFQNIIISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKTLKEVRPTVFLGVPRVYEKIQEQLENLKASTNKKLDSV---------------------------------KVKQNLGLDRCEYIASGAAPISQQTLEFFQDIDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDENLIGEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIEAKEVEDLLNSNFAVLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRDFSLKGGELG 2528
            + D     T  EY E++  AA  FI             G N        L  I   G + GIYT+N+ E C ++  +C   ++++EN  QL+KIL +   +P +KA+++YTGEV  E K ++   +Y W+QFL +  T A   L  R   +    C  LIYTSGTTG PKGVM+SHDNI +T +    H++  K +  I+SYLPLSHVAA M DI  ++    T++FAQPDALKGSL  TL+E RPT+FLGVPRV+EKI E++  + A+       +                                 K+K +LGLDRC      AAP++ +TL +FQ I+I ++++YGMSE SGP TI        G  G  M+G E+KI+ PDE+  GE+CMRGR+VF+G+ N  EKTKEALD   WLHSGD+ K+D     +  G   +L+ITAGGEN+APVPIEDNIK E+P ISN +L+GDK+KF+SCLLTLK ++++ T  PT++L+ +AI   +S G EA  V ++L +    +   I   ++R N +++S+A  VQKW IL  DF++ GGELG
Sbjct:    5 RNDQWQHWTYSEYYEEVRIAAKSFIEREW---------GRN------GRLHCILIRGFAVGIYTTNSPEACHFVADNCNANVIVVENKAQLSKILKVWDRLPHLKAVVQYTGEV--EGKHEN---VYNWNQFLELGKTVADRVLQERMSQLVANRCCTLIYTSGTTGAPKGVMISHDNITWTAQAALNHVQAGKREEHIVSYLPLSHVAAQMTDIYMSMYCCGTVWFAQPDALKGSLVNTLRECRPTLFLGVPRVWEKIMEKMLEVGATVTGPKRRIADWAKGKALQGNMNIEQGRSTPFGWTIATGILKKIKVSLGLDRCWGQFVAAAPVTMETLRYFQSINIPLYELYGMSECSGPLTISIPGHVLSGSCGIKMEGTEMKIDKPDEDGNGELCMRGRNVFMGFLNNEEKTKEALDVDGWLHSGDVCKIDDVSIRIAEG---QLIITAGGENIAPVPIEDNIKKEVPLISNAILIGDKRKFLSCLLTLKVEVEADTGAPTDRLTKAAIAFCKSVGSEATTVSEILKTKDENVMKAIQAGVDRANEEAISRAQKVQKWCILENDFTIHGGELG 554          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Nematostella
Match: EDO46335 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQC0])

HSP 1 Score: 172.555 bits (436), Expect = 5.309e-45
Identity = 152/572 (26.57%), Postives = 261/572 (45.63%), Query Frame = 3
Query:  930 LTMKEYLEQITKAATGFITLG---LEPKAAICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKILSILPGVPQVKAIIKYTGEVQEEAKKKSKIPIYTWSQFLSIDSTNATDELHNRQENV-KPKDCAVLIYTSGTTGLPKGVMLSHDNILFTLKMVQIHLELKKFQ----NIIISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKT---LKEVRPTVFLGVPRVYEKIQEQLENLKASTNKKLDSVKVKQNLGLDRCEYIASGAAPISQQTLEFFQDIDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELK-IENPDENLI-----GEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIEAKEVEDLLNSNFAVLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMY 2594
            LT  E L + +   +G   LG   +E    I +   N   W + E        V   +Y +   + C +I+   K  +++ +   ++  +L      P +K IIK   +V  E K++ +       + +S     A  + H  ++ + KP D AV+ YTSGTTG PKG M++H N +  L  + + ++    +    ++ ISYLPL+H+   +  +   +  G   +F       G++ K    L+E++PTVF+ VPRV  ++ +++  +K  ++  +        L   + E   +     S      F  I +L  + YG +E++   TI    +   G VG  M   ++K ++ PD N       GEIC  G +VF GY +  EKT+EA+D   WLHSGD+G+    G L +  R K +   A GE +AP  IE  +  + P +  V + GD +K  SC++ +    ++  +  TEK  V              ++E L N N  V K+ ++        + +     V+   + P  F++  G L PTLK KR  +   ++D  + +Y
Sbjct:  109 LTYNEVLNRASNVGSGLQELGSNDVEGDTFIGVYASNKIEWVLIEQACAMHAKVITPLYDTLGPDACAFIINQAKMSMVVCDAA-KIPLLLQRADQCPTLKFIIKINPDVTSEEKQEGE---RNGIKIISFSDVEAMGKAHPYEKKLPKPDDLAVVCYTSGTTGNPKGAMITHSNAVAMLAGLCVMIKKCGIRVDNDDVHISYLPLAHMYERLAQLMIFMYGGKVGFFG------GNIRKIMEDLQELKPTVFISVPRVLNRVYDKV--MKEISSSSIKKFVFNTALSFKKAEVERNIVRKNSIWDYLVFNKIQVL--EGYGQTETTAAATIQLVGDHTFGHVGPPMPCTKIKLVDVPDMNYFAKDGKGEICFYGPNVFKGYLHDPEKTREAIDEDGWLHSGDVGEWTENGTLKLIDRKKHIFKLAQGEYIAPEKIE-AVYMQCPLVHQVFVYGDSRK--SCIVGVVVPEETALKKWTEKNEVQG------------DMEALCN-NEKVRKAILEEMSAMGKKEKLFSFQQVKDIYLHPDPFTVDNGLLTPTLKFKRPVIQAHFKDTFEKLY 650          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Nematostella
Match: EDO45504 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSR2])

HSP 1 Score: 157.918 bits (398), Expect = 2.304e-40
Identity = 151/593 (25.46%), Postives = 275/593 (46.37%), Query Frame = 3
Query:  933 TMKEYLEQITKAATGFITLGLEP--KAAICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKILSILPGVPQVKAIIKYTG--EVQEEAKKKSKIPIYTWSQFLSIDSTNATDELHNRQENVKPKDCAVLIYTSGTTGLPKGVMLSHDNI-------LFTLKMVQIHLELKKFQNIIISYLPLSHVAANMLDIASTV-GMGSTIYFAQPDALKGSLGKTLKEVRPTVFLGVPRVYEKIQEQLENLKAST----NKKLDSVK--VKQNLGLDRCEY-------------IASGAAPISQQTLEFFQDI-DILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDE------NLIGEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDK-KKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIEAKEVEDLLNSNFAVLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMY 2594
            T  +  E+ +   +G   LG +P  +  + +   N   W +++L       V+  IY S+ +E C YI+   K   ++  +  ++N +L     +P +K+II  +G  EV+ +      I I ++ +   I   N  +++  R     P+D   + +TSGTTG PKGV+L+HDNI       LF +K  Q   EL   Q+  +SYLP  H+      +   + G    +Y  + + L        K +RPTVF  VPR+   I +++  L+  +    N      +  ++++   DR  +             I  G+AP+S +   F + +    +++ YG +E++   T+ +  +   G VG  +    +K+ +  E      N  GEIC+RGR+VF GY +  E+T+EA DS  W +SGD+G+   +G L +  R K +   + GE +AP  I++     + F++ V + G+  K FI               +P  ++ +   ++ +  G + K+    L  N  V K+   + + +     ++    V+   + P  F+++ G L PTLK KR  + + +E+ +  +Y
Sbjct:   53 TYSQIHERASNFGSGLCELGCDPSQETFVGLWSTNCTEWLLADLACQMFSMVTVPIYDSHGSEACTYIINKAKLSTIVC-HKKKVNFLLEHAHLLPTLKSIIVISGAGEVRRDKSDILGIRIISFDEVEKIGINNPHEKVPAR-----PEDTFTISWTSGTTGFPKGVILTHDNIISDMSAYLFLIK--QDGEELTP-QDTHLSYLPPEHMYERCTQVLMMMAGAKIGLYHGKREFLMDDF----KALRPTVFAAVPRLLNAIYDKVVPLRRYSLFAGNTFFFHARRIIRKDTIWDRLVFKKIQDLIGGNVRIITCGSAPLSARVTSFIRCVMGCYLNEGYGSTETTAMVTMQRLKDFNTGHVGAPVPCATVKLVDVPEMDYYASNNQGEICIRGRNVFKGYLHDAERTEEAFDSSGWFYSGDIGEWTQDGTLRIIDRKKHIFKLSQGEYIAPAKIQNAYLRSM-FVAQVFVHGNSLKSFI-----------VAVVVPDAEVLIPWAKTHDIEG-DIKQ----LCQNQTVRKAIHGDMIAKGKEAKLNSLEQVKGIYLHPELFTVEEGLLTPTLKTKRPALAQFFEEKLNVLY 615          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Nematostella
Match: EDO45461 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSR3])

HSP 1 Score: 158.688 bits (400), Expect = 2.411e-40
Identity = 156/603 (25.87%), Postives = 266/603 (44.11%), Query Frame = 3
Query:  930 LTMKEYLEQITKAATGFITLGLEP--KAAICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKILSILPGVPQVKAIIKYTGEVQEEAKKKSKIPIYTWSQFLSIDSTNATDELHNRQENV----KPKDCAVLIYTSGTTGLPKGVMLSHDNILFTLKMVQIHLELKKFQ----NIIISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKTLKEVRPTVFLGVPR----VYEKIQEQ--------------LENLKASTNKKL-------DSVKVK--QNLGLDRCEYIASGAAPISQQTLEFFQDI--DILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDE------NLIGEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDK-KKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIEAKEVEDL--LNSNFAVLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMY 2594
            L+  E  E+     +  + LG  P  +  + I   N   W +++L       VS  IY ++  + C +I+     + ++  N  ++  IL  +  +P +K II+    V+EE +K +K+        + + S +  +E+  +   V    KP D   + YTSGTTG PKG + +H N++  +  V     ++++     ++  SYLPL+H A     +   +  G  I F + D     L + ++E++PT F  VPR    VY+K+  Q              L   KA  NK +       D V  K  Q L   R   I SGAAP+S + + FF+    D  I + YG +E +   ++    + + G VG  +    +K+ +  E      +L GE+C++G +V   Y    EKT E LD   WLH+GD+G     G L +  R K++   A GE VAP  +E NI    PF++   + G+  K F+                    + V     L+ +  +     DL  L     V ++  ++ +       +     V+   + P  FS++   +  T K+KR  +++ + DVI+S+Y
Sbjct:   93 LSYNEVRERAHSFGSALVHLGCHPSQRTFVGIQAKNCVEWVLTDLACQMFSMVSVPIYDTHGPDACLFIINHADVETIVC-NHTKVPFILKNIKRIPHLKCIIQIGELVKEEERKDAKV------SGIELLSFSIAEEIGRKNIKVVNPPKPNDIFTICYTSGTTGTPKGAVQTHSNVIADVSGV-----IRQYNTCGIDVHFSYLPLAH-AYERTGVICMLQSGCRIGFYRGDP--QLLFEDIQELKPTFFASVPRIMNKVYDKVMAQVSESKFKSWMFQKGLHAKKADMNKNVFRSNTIWDKVVFKKVQMLFGGRVRAITSGAAPLSPKVMTFFRCAMGDCRIMEGYGQTECTACASLQLPQDMQAGIVGPPLTCNYIKLVDVPEKSYSTKDLKGEVCIKGPNVIPRYHKNPEKTAETLDEDGWLHTGDIGMWLENGALKIIDRKKDIFKLAQGEYVAPGKLE-NIAQRSPFVAQAFVHGESLKTFVVA------------------ILVPDGEVLKKWAAQKNIQGDLKTLCEKEEVRQAVFEDVVRVCKEAELFSFEQVKAVHLHPEAFSVENDLMTATFKIKRPQIIKAFHDVIESLY 661          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Nematostella
Match: EDO29879 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2D4])

HSP 1 Score: 151.754 bits (382), Expect = 4.735e-38
Identity = 158/638 (24.76%), Postives = 289/638 (45.30%), Query Frame = 3
Query:  864 ESQPNHVVLKHKSDPKKDYDLSLTMKEYLEQITKAATGFITLGLEPKAAICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKILSILPGVPQVKAIIKYTGEVQEEAKKKSKIPIYTWSQFLSIDSTNATDELHNRQENVK------PKDCAVLIYTSGTTGLPKGVMLSHDNILFTLKMVQIHLELK-KFQNIIISYLPLSHVAANMLDIASTVGMGSTIYFAQPDAL--------KGSLGKTLKEVRPTVFLGVPRVYEKIQEQ-LENLK-----------ASTNKKLDSV---------------KVKQNLGLDRCEYIASGAAPISQQTLEFFQDIDIL--IHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDEN---------LIGEICMRGRHVFLGYFNAVEKTKEALD----SQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDK-KKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIEAKEVED---LLNSNFAVLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMY 2594
            E+QPN  V K   + + +Y+  LT  E   +      G ITLG +P+  I +       W +S L     G     IY +   E   + + + +   +I ++   L K+ ++   + Q++ II Y G  ++         +  +   + + S    +EL +RQ N +      P+D AV++YTSG+TGLPKGV++SH N+L     +   +E     +++ + YLPL+HV   + + A  +  G+ I ++ P  L        KGS G  L  +RPT+   VP + ++I++  +E +K            + N KL  +               K+++ LG  R   + SG AP+S  T ++F ++     + Q YG++E+ G  TI    ++  G VG  +   E+K+ + +E            GEI + G +V LGY+   +KT+E  +     Q W H+GD+G+   +G L +  R K+L+    GE V+   +E  + ++  ++ NV +  D  K F  C                  L V   + L+      +   D    + SN A+ ++ + +     N+  + K    Q+ +++   ++ +   +   LK+KR  +   Y+D ++++Y
Sbjct:  105 ETQPNGRVFK--KEIRGEYNW-LTYAEVDSRARNLGNGLITLGQQPRQNIVVFAETQADWMVSALSCFGFGFPVVTIYATLGDEAVAHGINETEVNFVITDSV-LLPKLAAVSGQLTQLQHII-YMGNAKKSV-------LMNFPSSIKLHSMVEVEELGSRQGNAQSRYVPHPEDTAVIMYTSGSTGLPKGVIISHANLLAATAAMGARVEPSITEKDVYVGYLPLAHVLELVAENA-LLAHGACIGYSSPLTLSDQSSKIKKGSKGD-LTVLRPTLMAAVPVIMDRIRQNVMEKVKDGPRLLQLFFTFAYNYKLQQIKRGYDAPLLNRFIFAKLRKLLG-GRVRQMLSGGAPLSSDT-QYFMNVCFCCPVGQGYGLTETCGGGTICHTWDRTTGRVGPPIASCEVKLVSWEEGGYTIRDKPFARGEIVIGGSNVTLGYYKNPQKTQEDFEVDRNGQRWFHTGDIGEFHDDGCLKIIDRKKDLVKLQSGEYVSLGKVEAAL-AQCQYVENVCVFADSLKTFCVC------------------LVVPRPKQLKQLADSLQVPTDDWSAVCSNKAIREAVLKDIRIVGNSAKLEKFEIPQRMSLVLEQWTPESELVTAALKLKRKNITSFYQDTLRTLY 707          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Medaka
Match: ENSORLT00000027775.1 (long-chain-fatty-acid--CoA ligase ACSBG2 [Source:NCBI gene;Acc:101158282])

HSP 1 Score: 528.48 bits (1360), Expect = 3.057e-176
Identity = 281/623 (45.10%), Postives = 388/623 (62.28%), Query Frame = 3
Query:  834 TIINRLKENVESQPNHVVLKHKSDPKKDYDLSLTMKEYLEQITKAATGFITLGLEPKAAICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKILSILPGVPQVKAIIKYTGEVQEEAKKKSKIPIYTWSQFLSIDSTNATDELHNRQENVKPKDCAVLIYTSGTTGLPKGVMLSHDNILFTLKMVQIHLELKKFQNIIISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKTLKEVRPTVFLGVPRVYEKIQEQLE--NLKASTNKK---------------------------------LDSVKVKQNLGLDRCEYIASGAAPISQQTLEFFQDIDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDENLIGEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIEAKEVEDLLNSNFAVLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMYT 2597
            TI     E VE   +   L  K D +     SLT ++Y EQ   AA  F+ LGLE    + ILGFN P WFIS++G I+AGG++ GIYT+N+ E C+Y+  +C+  IL++EN  QL+KIL +   +P +KAII+Y G++Q+    K+ I +Y+W +F+ +    + ++L+   ++ +  +C  LIYTSGTTG PKGVMLS DNI +T ++    +     Q I+ISYLPLSHVAA M+DI  ++    T YFA+PDALKGSL  TLKE RPT FLGVPRV+EK+QE +     KAS  KK                                 L   KV+  LGLDRC Y  +GAAPI++ TLE+F  ++I + ++YGMSESSGPHT+   DE ++G  G ++ G ++K+ NPDE   GE+C  GR+VF+GY N  +KT+EALD   WLHSGDLGK D E +L +TGRIKEL+ITAGGEN+ PVPIED +KSELP ISN ML+GDK KF+S +L     +      P  +LS   +       + A +V ++  +    +   I   ++RVNA+S S A  +QKW +L RDFS+ GGELGPTLK++R  V++ Y++ I  +Y+
Sbjct:  107 TIHQMFLETVERSGDQTALVFKEDGQT---ASLTWRQYYEQCRAAAKSFLKLGLERFHGVGILGFNSPEWFISDIGCIFAGGLAAGIYTTNSPEACQYVAANCEANILVVENQKQLDKILQVKDQLPHLKAIIQYKGKLQQ----KTSI-LYSWEEFMKVGEDVSDEQLNAVIDSQRANECCTLIYTSGTTGNPKGVMLSQDNITWTARISSGLICKNYGQEILISYLPLSHVAAQMVDIWISMSFSGTTYFAEPDALKGSLVNTLKEARPTCFLGVPRVWEKMQEGMRAGGEKASPLKKRVADWAKSIGLQYNYSAMEGENLVPWGFMLANNLVFKKVRAALGLDRCRYCFTGAAPITKDTLEYFLSLNIPVKELYGMSESSGPHTV-SIDEYRIGSCGKVIPGSKIKLNNPDEEGNGEVCFWGRNVFMGYLNMPDKTEEALDEDGWLHSGDLGKFDQENFLYITGRIKELIITAGGENIPPVPIEDAVKSELPIISNTMLIGDKLKFLS-MLITLKCVMDDNGEPLNELSSEVLDFCRRHSVTATKVSEITANKEPAIYKAIQEGIDRVNARSTSNAQKIQKWVVLERDFSVVGGELGPTLKLRRPIVVKMYQEKINELYS 719          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Medaka
Match: ENSORLT00000001544.2 (long-chain-fatty-acid--CoA ligase ACSBG2 [Source:NCBI gene;Acc:101158282])

HSP 1 Score: 528.48 bits (1360), Expect = 3.057e-176
Identity = 281/623 (45.10%), Postives = 388/623 (62.28%), Query Frame = 3
Query:  834 TIINRLKENVESQPNHVVLKHKSDPKKDYDLSLTMKEYLEQITKAATGFITLGLEPKAAICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKILSILPGVPQVKAIIKYTGEVQEEAKKKSKIPIYTWSQFLSIDSTNATDELHNRQENVKPKDCAVLIYTSGTTGLPKGVMLSHDNILFTLKMVQIHLELKKFQNIIISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKTLKEVRPTVFLGVPRVYEKIQEQLE--NLKASTNKK---------------------------------LDSVKVKQNLGLDRCEYIASGAAPISQQTLEFFQDIDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDENLIGEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIEAKEVEDLLNSNFAVLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMYT 2597
            TI     E VE   +   L  K D +     SLT ++Y EQ   AA  F+ LGLE    + ILGFN P WFIS++G I+AGG++ GIYT+N+ E C+Y+  +C+  IL++EN  QL+KIL +   +P +KAII+Y G++Q+    K+ I +Y+W +F+ +    + ++L+   ++ +  +C  LIYTSGTTG PKGVMLS DNI +T ++    +     Q I+ISYLPLSHVAA M+DI  ++    T YFA+PDALKGSL  TLKE RPT FLGVPRV+EK+QE +     KAS  KK                                 L   KV+  LGLDRC Y  +GAAPI++ TLE+F  ++I + ++YGMSESSGPHT+   DE ++G  G ++ G ++K+ NPDE   GE+C  GR+VF+GY N  +KT+EALD   WLHSGDLGK D E +L +TGRIKEL+ITAGGEN+ PVPIED +KSELP ISN ML+GDK KF+S +L     +      P  +LS   +       + A +V ++  +    +   I   ++RVNA+S S A  +QKW +L RDFS+ GGELGPTLK++R  V++ Y++ I  +Y+
Sbjct:  107 TIHQMFLETVERSGDQTALVFKEDGQT---ASLTWRQYYEQCRAAAKSFLKLGLERFHGVGILGFNSPEWFISDIGCIFAGGLAAGIYTTNSPEACQYVAANCEANILVVENQKQLDKILQVKDQLPHLKAIIQYKGKLQQ----KTSI-LYSWEEFMKVGEDVSDEQLNAVIDSQRANECCTLIYTSGTTGNPKGVMLSQDNITWTARISSGLICKNYGQEILISYLPLSHVAAQMVDIWISMSFSGTTYFAEPDALKGSLVNTLKEARPTCFLGVPRVWEKMQEGMRAGGEKASPLKKRVADWAKSIGLQYNYSAMEGENLVPWGFMLANNLVFKKVRAALGLDRCRYCFTGAAPITKDTLEYFLSLNIPVKELYGMSESSGPHTV-SIDEYRIGSCGKVIPGSKIKLNNPDEEGNGEVCFWGRNVFMGYLNMPDKTEEALDEDGWLHSGDLGKFDQENFLYITGRIKELIITAGGENIPPVPIEDAVKSELPIISNTMLIGDKLKFLS-MLITLKCVMDDNGEPLNELSSEVLDFCRRHSVTATKVSEITANKEPAIYKAIQEGIDRVNARSTSNAQKIQKWVVLERDFSVVGGELGPTLKLRRPIVVKMYQEKINELYS 719          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Medaka
Match: acsbg2 (acyl-CoA synthetase bubblegum family member 2 [Source:NCBI gene;Acc:101171154])

HSP 1 Score: 523.472 bits (1347), Expect = 7.797e-174
Identity = 270/631 (42.79%), Postives = 389/631 (61.65%), Query Frame = 3
Query:  825 PEETIINRLKENVESQPNHVVLKHKSDPKKDYDLSLTMKEYLEQITKAATGFITLGLEPKAAICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKILSILPGVPQVKAIIKYTGEVQEEAKKKSKIPIYTWSQFLSIDSTNATDELHNRQENVKPKDCAVLIYTSGTTGLPKGVMLSHDNILFTLKMVQIHLELKKF---QNIIISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKTLKEVRPTVFLGVPRVYEKIQEQLENLKASTN--------------------------------------KKLDSVKVKQNLGLDRCEYIASGAAPISQQTLEFFQDIDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDENLIGEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIEAKEVEDLLNSNFAVLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMY 2594
            P  T+       VE   ++  L  K   + D   SL  K+Y +    AA  ++ LGL+    +CILGFN   WFI+++G I AGG   G+YT+N+ E C+++  +CK  +++LEN+ QL KIL I   +P +KAI++Y G ++E+     +  +YTW++F+ +        L     + KP  C  LIYTSGTTG PKGVMLSHDN+ +T      H+ L      Q +++SYLPLSH+AA M+D+   + +G + +FAQPDALKGSL  TLKEVRPT F+GVPRV+EK+QE+++++ A ++                                      KKL   KV++ LGLDRC    +GAAP ++ TLEFF  +DI + ++YGMSE +GPHTI + D  +L   G  + G   K++NPDE   GEIC  GRH+F+GY NA +KT+EALD++ WLHSGDLGK D  G+L +TGRIKEL+ITAGGEN+ PVPIED +K  +P +SN ML+GDK+KF+S L+T+K  ++ +T  P ++L+  A+   +  G  AK V ++       + + I   +N+VN ++ S A  +QK+ IL RDFS+ GGELGPT+K+KR  V++ Y+D I + Y
Sbjct:  124 PPLTVHQMFTSAVERYGDNTALAWK---EGDQAKSLNYKDYYKACRTAAKSYLKLGLQRYHGVCILGFNSAEWFIADIGAILAGGFGVGVYTTNSPEACQFVAENCKANVIVLENEKQLQKILQIEDQLPHLKAIVQYKGALREK-----RPNLYTWAEFMELGRDEPDGPLDAIIASQKPNQCCSLIYTSGTTGQPKGVMLSHDNLTWTALSTAKHVCLTDATVAQEVVVSYLPLSHIAAQMVDMWLIMRVGGSTHFAQPDALKGSLVNTLKEVRPTAFMGVPRVWEKMQEKMKSIGAKSSTLRRKVASWAKDVGLQTNLTRMRQNTATGQAPFQYHLAKKLVFKKVRKALGLDRCTKCYTGAAPTTKDTLEFFLSLDIPLFELYGMSECTGPHTISRPDAFRLTSCGKEIPGCTTKLDNPDEEGNGEICFWGRHIFMGYLNAPDKTEEALDAEGWLHSGDLGKRDEHGFLYITGRIKELIITAGGENIPPVPIEDAVKDAVPLLSNAMLIGDKRKFLSMLVTIKCQINPETGNPEDELTPEAVEICKKLGTSAKTVSEIAGGRDRTVHAAIQEGINQVNKKATSNAQCIQKFVILNRDFSINGGELGPTMKLKRPVVLKMYKDQIDNFY 746          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Medaka
Match: acsbg2 (acyl-CoA synthetase bubblegum family member 2 [Source:NCBI gene;Acc:101171154])

HSP 1 Score: 523.087 bits (1346), Expect = 1.511e-173
Identity = 270/631 (42.79%), Postives = 388/631 (61.49%), Query Frame = 3
Query:  825 PEETIINRLKENVESQPNHVVLKHKSDPKKDYDLSLTMKEYLEQITKAATGFITLGLEPKAAICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKILSILPGVPQVKAIIKYTGEVQEEAKKKSKIPIYTWSQFLSIDSTNATDELHNRQENVKPKDCAVLIYTSGTTGLPKGVMLSHDNILFTLKMVQIHLELKKF---QNIIISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKTLKEVRPTVFLGVPRVYEKIQEQLENLKASTN--------------------------------------KKLDSVKVKQNLGLDRCEYIASGAAPISQQTLEFFQDIDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDENLIGEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIEAKEVEDLLNSNFAVLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMY 2594
            P  T+       VE   ++  L  K   + D   SL  K+Y +    AA  ++ LGL+    +CILGFN   WFI+++G I AGG   G+YT+N+ E C+++  +CK  +++LEN+ QL KIL I   +P +KAI++Y G ++E+        +YTW++F+ +        L     + KP  C  LIYTSGTTG PKGVMLSHDN+ +T      H+ L      Q +++SYLPLSH+AA M+D+   + +G + +FAQPDALKGSL  TLKEVRPT F+GVPRV+EK+QE+++++ A ++                                      KKL   KV++ LGLDRC    +GAAP ++ TLEFF  +DI + ++YGMSE +GPHTI + D  +L   G  + G   K++NPDE   GEIC  GRH+F+GY NA +KT+EALD++ WLHSGDLGK D  G+L +TGRIKEL+ITAGGEN+ PVPIED +K  +P +SN ML+GDK+KF+S L+T+K  ++ +T  P ++L+  A+   +  G  AK V ++       + + I   +N+VN ++ S A  +QK+ IL RDFS+ GGELGPT+K+KR  V++ Y+D I + Y
Sbjct:  133 PPLTVHQMFTSAVERYGDNTALAWK---EGDQAKSLNYKDYYKACRTAAKSYLKLGLQRYHGVCILGFNSAEWFIADIGAILAGGFGVGVYTTNSPEACQFVAENCKANVIVLENEKQLQKILQIEDQLPHLKAIVQYKGALREKRPN-----LYTWAEFMELGRDEPDGPLDAIIASQKPNQCCSLIYTSGTTGQPKGVMLSHDNLTWTALSTAKHVCLTDATVAQEVVVSYLPLSHIAAQMVDMWLIMRVGGSTHFAQPDALKGSLVNTLKEVRPTAFMGVPRVWEKMQEKMKSIGAKSSTLRRKVASWAKDVGLQTNLTRMRQNTATGQAPFQYHLAKKLVFKKVRKALGLDRCTKCYTGAAPTTKDTLEFFLSLDIPLFELYGMSECTGPHTISRPDAFRLTSCGKEIPGCTTKLDNPDEEGNGEICFWGRHIFMGYLNAPDKTEEALDAEGWLHSGDLGKRDEHGFLYITGRIKELIITAGGENIPPVPIEDAVKDAVPLLSNAMLIGDKRKFLSMLVTIKCQINPETGNPEDELTPEAVEICKKLGTSAKTVSEIAGGRDRTVHAAIQEGINQVNKKATSNAQCIQKFVILNRDFSINGGELGPTMKLKRPVVLKMYKDQIDNFY 755          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Medaka
Match: acsl2 (long-chain-fatty-acid--CoA ligase 1 [Source:NCBI gene;Acc:101168717])

HSP 1 Score: 161.77 bits (408), Expect = 1.060e-40
Identity = 157/607 (25.86%), Postives = 264/607 (43.49%), Query Frame = 3
Query:  906 PKKDYDLSLTMKEYLEQITKAATGFITLGL--EPKAAICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKILSILPG--VPQVKAIIKYTGEVQE--EAKKKSKIPIYTWSQFLSIDSTNATDELHNRQENVKPKDCAVLIYTSGTTGLPKGVMLSHDNILFTLKMVQIHLE---LKKFQNIIISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKTLKEVRPTVFLGVPR----VYEKI--------------------QEQLENLKASTNKKLDSV---KVKQNLGLDRCEYIASGAAPISQQTLEFFQ-DIDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELK-IENPDENLI-----GEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIEAKEVEDLLNSNFAVLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMYT 2597
            P + Y+  ++  E  +Q     +G +  G    P+  I I G N P W ISEL           +Y +   E   +I+   +  ++I + + +   +L I      P++  ++ +T   Q   E  KK  + +    + + +   N  D +       +P+D AV+ +TSGTTG PKG M++H NI      V   LE   + +  ++ ISYLPL+H+   M+ + +    G+++ F Q D     L   +K ++PT    VPR    +Y+KI                    Q +L       N   D +   K++ +LG     ++ + +APIS   L F +  +  LI + YG +E +   T     +   G VG  +    +K ++ PD N       GEIC++G  VF GY    E+T EALDS+ WLH+GD+G+    G L +  R K +   + GE +AP  IE+      P +  V + GD  +                 +P  ++ V   +    F    KE    L  N  V  + +++         +     V+   + P  FS+  G L PTLK +R  + + +++ + SMY+
Sbjct:  166 PGQPYEW-ISYTEVAQQAQWIGSGLLAKGCLPTPEQYIGIFGQNKPEWVISELACYTYSMAVVPLYDTLGTEAMVHIINLAEMSLVICDQEQRAASLLHIKEKGLTPKLSCLVLFTSFSQAFAERAKKCHVEVLRLDELMELGRQNLKDPVPP-----QPQDLAVVCFTSGTTGKPKGAMITHGNIASNTSSVIKILEGFFVIRHDDVSISYLPLAHMFERMIQL-TMFCFGASVGFYQGDITL--LMDDMKTLKPTFLPVVPRLLNRIYDKILASTKSPFRRALLHFAVQRKQAELSRGIVRNNSLWDKLIFNKIQASLG-GNLRFVLTASAPISSTVLSFLRATLGCLIFEGYGQTECTSGCTFSMPGDSSTGHVGAPLPCAMVKLVDIPDMNYYAKNGEGEICIQGPSVFRGYLKDPERTAEALDSEGWLHTGDVGQWLKNGSLRIVDRKKHIFKLSQGEYIAPEKIENIYMRSTPVL-QVFVHGDSLQ----------SYLVGIVVPDPEVFVDWSKE-RGFMGSYKE----LCQNPDVKNAVLEDMRGVGKEAGLKSFEQVKDLYLHPEMFSIANGLLTPTLKSRRNDIRQVFQEQLSSMYS 746          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Planmine SMEST
Match: SMESG000027217.1 (SMESG000027217.1)

HSP 1 Score: 1222.99 bits (3163), Expect = 0.000e+0
Identity = 627/632 (99.21%), Postives = 629/632 (99.53%), Query Frame = 3
Query:  705 MVDTKSVIGVTNAVNNVKXXXXXXXXXXXXXXVDDETKNVPEETIINRLKENVESQPNHVVLKHKSDPKKDYDLSLTMKEYLEQITKAATGFITLGLEPKAAICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKILSILPGVPQVKAIIKYTGEVQEEAKKKSKIPIYTWSQFLSIDSTNATDELHNRQENVKPKDCAVLIYTSGTTGLPKGVMLSHDNILFTLKMVQIHLELKKFQNIIISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKTLKEVRPTVFLGVPRVYEKIQEQLENLKASTNKKLDSVKVKQNLGLDRCEYIASGAAPISQQTLEFFQDIDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDENLIGEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIEAKEVEDLLNSNFAVLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMYTV 2600
            MVDTKSVIGVTNAVNNVKIDDNQGIND IISNVDDETKNVPEETIINRLKENVESQPNHVVLK+KSDPKKDYDLSLTMKEYLEQITKAATGFITLGLEPKAAICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKILSILPGVPQVKAIIKYTGEVQEEAKKKSKIPIYTWSQFLSIDSTNATDELHNRQENVKPKDCAVLIYTSGTTGLPKGVMLSHDNILFTLKMVQIHLELKKFQNIIISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKTLKEVRPTVFLGVPRVYEKIQEQLENLKASTNKKLDSVKVKQNLGLDRCEYIASGAAPISQQTLEFFQ IDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDENLIGEICMRGRHVFLGYFNAVEKTKEALDS+NWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKKFISCLLTLKTD DSKTQLPTEKLSVSAIRSLESFGIEAKEVEDLLNSNFAVLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMYTV
Sbjct:    1 MVDTKSVIGVTNAVNNVKIDDNQGINDKIISNVDDETKNVPEETIINRLKENVESQPNHVVLKYKSDPKKDYDLSLTMKEYLEQITKAATGFITLGLEPKAAICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKILSILPGVPQVKAIIKYTGEVQEEAKKKSKIPIYTWSQFLSIDSTNATDELHNRQENVKPKDCAVLIYTSGTTGLPKGVMLSHDNILFTLKMVQIHLELKKFQNIIISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKTLKEVRPTVFLGVPRVYEKIQEQLENLKASTNKKLDSVKVKQNLGLDRCEYIASGAAPISQQTLEFFQGIDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDENLIGEICMRGRHVFLGYFNAVEKTKEALDSENWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKKFISCLLTLKTDFDSKTQLPTEKLSVSAIRSLESFGIEAKEVEDLLNSNFAVLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMYTV 632          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Planmine SMEST
Match: SMESG000027204.1 (SMESG000027204.1)

HSP 1 Score: 773.852 bits (1997), Expect = 0.000e+0
Identity = 376/633 (59.40%), Postives = 492/633 (77.73%), Query Frame = 3
Query:  801 VDDETKNVPEETIINRLKENVESQPNHVVLKHKSDPKKDYDLSLTMKEYLEQITKAATGFITLGLEPKAAICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKILSILPGVPQVKAIIKYTGEVQEEAKKKSKIPIYTWSQFLSIDSTNATDELHNRQENVKPKDCAVLIYTSGTTGLPKGVMLSHDNILFTLKMVQIHLELKKFQNIIISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKTLKEVRPTVFLGVPRVYEKIQEQLENL--KASTNKK--------------------------------LDSVKVKQNLGLDRCEYIASGAAPISQQTLEFFQDIDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDENLIGEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIEAKEVEDLLNSNFAVLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMYT 2597
            + +ET N P+ETI   LK+ V++  +  VLK+KSDPK  YD+ +TM++YLE I KAA+ FI LGL+ KAA+ ILGFNHPAWFIS+LGGI+AGG+ CGIYT+NT +ICK+IM DC CQI+++ENDDQLNKILSILP VPQ+KAIIKYTG+V  E K K  I IYTW++F++++  ++ DEL  R   ++P DCA+LIYTSGTTG PKGVMLSHDN++FT+K    H++++ F+N +ISYLPLSH+AAN+ DI +TV +G T+YFAQPDALKGSLGKTLKEVRPTVF+GVPRV+EKIQEQ++ +  KA T KK                                L   K+K+ LGLDRC Y+AS AAP++QQ+L++F  +D+ I+QIYG+SE +GPHT+G  D+ ++G  GT++KGVE+KI+ P+E+ IGEIC+RGRHVFLGY+N +EKTKE++DS  WLHSGDLGKV+   +L +TGRIKEL+ITAGGEN+APVPIED IK  +PFIS+VMLVGD++KF+SCLLTLK+ +D  TQ PT +L+ +AIRSL+  GIEAK VE++L      LK  ID A+ +VN+ SVS+AAYVQKW++LPRDFS+ GGELGPT+KMKRM ++E Y +++ SMY+
Sbjct:   47 ITEETANTPKETIPECLKKLVKTNSDFPVLKYKSDPKNGYDIEVTMEQYLELIQKAASNFIKLGLDVKAAVGILGFNHPAWFISQLGGIFAGGIICGIYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHVKIQPFKNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKPVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNEHNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMYS 679          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Planmine SMEST
Match: SMESG000027204.1 (SMESG000027204.1)

HSP 1 Score: 773.081 bits (1995), Expect = 0.000e+0
Identity = 376/633 (59.40%), Postives = 492/633 (77.73%), Query Frame = 3
Query:  801 VDDETKNVPEETIINRLKENVESQPNHVVLKHKSDPKKDYDLSLTMKEYLEQITKAATGFITLGLEPKAAICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKILSILPGVPQVKAIIKYTGEVQEEAKKKSKIPIYTWSQFLSIDSTNATDELHNRQENVKPKDCAVLIYTSGTTGLPKGVMLSHDNILFTLKMVQIHLELKKFQNIIISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKTLKEVRPTVFLGVPRVYEKIQEQLENL--KASTNKK--------------------------------LDSVKVKQNLGLDRCEYIASGAAPISQQTLEFFQDIDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDENLIGEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIEAKEVEDLLNSNFAVLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMYT 2597
            + +ET N P+ETI   LK+ V++  +  VLK+KSDPK  YD+ +TM++YLE I KAA+ FI LGL+ KAA+ ILGFNHPAWFIS+LGGI+AGG+ CGIYT+NT +ICK+IM DC CQI+++ENDDQLNKILSILP VPQ+KAIIKYTG+V  E K K  I IYTW++F++++  ++ DEL  R   ++P DCA+LIYTSGTTG PKGVMLSHDN++FT+K    H++++ F+N +ISYLPLSH+AAN+ DI +TV +G T+YFAQPDALKGSLGKTLKEVRPTVF+GVPRV+EKIQEQ++ +  KA T KK                                L   K+K+ LGLDRC Y+AS AAP++QQ+L++F  +D+ I+QIYG+SE +GPHT+G  D+ ++G  GT++KGVE+KI+ P+E+ IGEIC+RGRHVFLGY+N +EKTKE++DS  WLHSGDLGKV+   +L +TGRIKEL+ITAGGEN+APVPIED IK  +PFIS+VMLVGD++KF+SCLLTLK+ +D  TQ PT +L+ +AIRSL+  GIEAK VE++L      LK  ID A+ +VN+ SVS+AAYVQKW++LPRDFS+ GGELGPT+KMKRM ++E Y +++ SMY+
Sbjct:   33 ITEETANTPKETIPECLKKLVKTNSDFPVLKYKSDPKNGYDIEVTMEQYLELIQKAASNFIKLGLDVKAAVGILGFNHPAWFISQLGGIFAGGIICGIYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHVKIQPFKNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKPVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNEHNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMYS 665          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Planmine SMEST
Match: SMESG000027204.1 (SMESG000027204.1)

HSP 1 Score: 734.947 bits (1896), Expect = 0.000e+0
Identity = 355/588 (60.37%), Postives = 461/588 (78.40%), Query Frame = 3
Query:  936 MKEYLEQITKAATGFITLGLEPKAAICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKILSILPGVPQVKAIIKYTGEVQEEAKKKSKIPIYTWSQFLSIDSTNATDELHNRQENVKPKDCAVLIYTSGTTGLPKGVMLSHDNILFTLKMVQIHLELKKFQNIIISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKTLKEVRPTVFLGVPRVYEKIQEQLENL--KASTNKK--------------------------------LDSVKVKQNLGLDRCEYIASGAAPISQQTLEFFQDIDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDENLIGEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIEAKEVEDLLNSNFAVLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMYT 2597
            M++YLE I KAA+ FI LGL+ KAA+ ILGFNHPAWFIS+LGGI+AGG+ CGIYT+NT +ICK+IM DC CQI+++ENDDQLNKILSILP VPQ+KAIIKYTG+V  E K K  I IYTW++F++++  ++ DEL  R   ++P DCA+LIYTSGTTG PKGVMLSHDN++FT+K    H++++ F+N +ISYLPLSH+AAN+ DI +TV +G T+YFAQPDALKGSLGKTLKEVRPTVF+GVPRV+EKIQEQ++ +  KA T KK                                L   K+K+ LGLDRC Y+AS AAP++QQ+L++F  +D+ I+QIYG+SE +GPHT+G  D+ ++G  GT++KGVE+KI+ P+E+ IGEIC+RGRHVFLGY+N +EKTKE++DS  WLHSGDLGKV+   +L +TGRIKEL+ITAGGEN+APVPIED IK  +PFIS+VMLVGD++KF+SCLLTLK+ +D  TQ PT +L+ +AIRSL+  GIEAK VE++L      LK  ID A+ +VN+ SVS+AAYVQKW++LPRDFS+ GGELGPT+KMKRM ++E Y +++ SMY+
Sbjct:    1 MEQYLELIQKAASNFIKLGLDVKAAVGILGFNHPAWFISQLGGIFAGGIICGIYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHVKIQPFKNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKPVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNEHNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMYS 588          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Planmine SMEST
Match: SMESG000080395.1 (SMESG000080395.1)

HSP 1 Score: 496.123 bits (1276), Expect = 8.241e-166
Identity = 261/573 (45.55%), Postives = 359/573 (62.65%), Query Frame = 3
Query:  978 FITLGLEPKAAICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKILSILPGVPQVKAIIKYTGEVQEEAKKKSKIPIYTWSQFLSIDSTNATDELHNRQENVKPKDCAVLIYTSGTTGLPKGVMLSHDNILFTLKMVQIHLELKKFQNIIISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKTLKEVRPTVFLGVPRVYEKIQEQLENLK---ASTNKKLDSV-------------------------------KVKQNLGLDRCEYIASGAAPISQQTLEFFQDIDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDENLIGEICMRGRHVFLGYFNAVEKTKEALDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKKFISCXXXXXXXXXXXXXXPTEKLSVSAIRSLESFGIEAKEVEDLLNSNFAVLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMY 2594
            F  +GL  + ++CI G N P WFI+  G I+AGGV+ GIY +N  E  ++I+ +C+C + I+ N++ L K + +    P +KAI+ Y G + +  K   KI +Y W++F+++      D L  R  ++ P +C  LIYTSGTTG PKGVM+SHDN+++T + +  +++ +  + ++ISYLPLSHVAA M DI   +   +TI+FAQPDALKGSLG TLKEV PT F+GVPRV+EKI EQ++ +    +S  K + S                                KV + LG DRC  I S AAP+S   L +F  +D++I +IYGMSE SGP TI  ++E + G VG ++     K+++ D    GEICM GRHVF+GY NA EKTKE  DS+ WLHSGD+G  + EGYL +TGRIKELLITAGGEN+APVPIE  IK  L FISN M+VGDK+K++  LLT+K  +D  TQ+PT+ L+ +A R     G     +  ++      L   ID  + R N  ++S++A VQKWT LP DFS+ GGELGPTLK+KR  V E Y  +I S+Y
Sbjct:    4 FDEIGLNARKSVCISGHNSPEWFITYFGTIFAGGVASGIYVTNNKETVEFIINNCECIVAIVANEELLKKYVCVSKNCPNLKAIVYYGGLIDDSIKGGCKISLYDWTEFMNLGININDDTLIGRLNHLIPNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMKFRHSKEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKEDGPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYFASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKLDSEDGKE-GEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKNPKLSICIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLY 575          
The following BLAST results are available for this feature:
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ACSBG28.282e-16142.42acyl-CoA synthetase bubblegum family member 2 [Sou... [more]
ACSBG27.335e-16042.42acyl-CoA synthetase bubblegum family member 2 [Sou... [more]
ACSBG27.335e-16042.42acyl-CoA synthetase bubblegum family member 2 [Sou... [more]
ACSBG12.237e-14938.90acyl-CoA synthetase bubblegum family member 1 [Sou... [more]
ACSBG25.726e-12943.86acyl-CoA synthetase bubblegum family member 2 [Sou... [more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acs-135.780e-3424.54Fatty Acid CoA Synthetase family [Source:UniProtK... [more]
acs-136.656e-3424.54Fatty Acid CoA Synthetase family [Source:UniProtK... [more]
acs-137.600e-3424.54Fatty Acid CoA Synthetase family [Source:UniProtK... [more]
acs-51.247e-3226.74Fatty Acid CoA Synthetase family [Source:UniProtK... [more]
acs-212.733e-2933.10Fatty Acid CoA Synthetase family [Source:UniProtK... [more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bgm8.764e-14741.77gene:FBgn0027348 transcript:FBtr0080590[more]
bgm8.764e-14741.77gene:FBgn0027348 transcript:FBtr0346624[more]
hll8.845e-12636.18gene:FBgn0286723 transcript:FBtr0080591[more]
CG39611.267e-4025.08gene:FBgn0036821 transcript:FBtr0302322[more]
CG39611.693e-4025.08gene:FBgn0036821 transcript:FBtr0333712[more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acsbg22.600e-17845.13acyl-CoA synthetase bubblegum family member 2 [Sou... [more]
acsbg26.549e-17845.13acyl-CoA synthetase bubblegum family member 2 [Sou... [more]
acsbg11.906e-15039.08acyl-CoA synthetase bubblegum family member 1 [Sou... [more]
acsl51.330e-4027.88acyl-CoA synthetase long chain family member 5 [So... [more]
acsl51.330e-4027.88acyl-CoA synthetase long chain family member 5 [So... [more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acsbg22.251e-17944.88acyl-CoA synthetase bubblegum family member 2 [Sou... [more]
acsbg22.617e-17944.88acyl-CoA synthetase bubblegum family member 2 [Sou... [more]
acsbg24.942e-17944.88acyl-CoA synthetase bubblegum family member 2 [Sou... [more]
acsbg27.198e-17944.81acyl-CoA synthetase bubblegum family member 2 [Sou... [more]
acsbg21.042e-17844.81acyl-CoA synthetase bubblegum family member 2 [Sou... [more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Acsbg22.512e-15842.81acyl-CoA synthetase bubblegum family member 2 [Sou... [more]
Acsbg18.960e-15440.57acyl-CoA synthetase bubblegum family member 1 [Sou... [more]
Acsbg31.134e-9430.12acyl-CoA synthetase bubblegum family member 3 [Sou... [more]
Acsl51.591e-4127.18acyl-CoA synthetase long-chain family member 5 [So... [more]
Acsl61.411e-3627.49acyl-CoA synthetase long-chain family member 6 [So... [more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7ZYC4|ACBG2_XENLA8.243e-17845.20Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Xenopu... [more]
sp|Q5ZKR7|ACBG2_CHICK2.988e-17244.27Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Gallus... [more]
sp|Q5FVE4|ACBG2_HUMAN3.523e-15942.42Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Homo s... [more]
sp|Q2XU92|ACBG2_MOUSE1.757e-15742.81Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Mus mu... [more]
sp|A1L1K7|ACBG2_RAT6.082e-15542.26Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Rattus... [more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3P8WSG30.000e+045.14AMP-binding domain-containing protein OS=Cynogloss... [more]
A0A0F8AB950.000e+044.23Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Larimi... [more]
A0A3P8YES41.074e-17845.12Acyl-CoA synthetase bubblegum family member 2 OS=E... [more]
H3C3L02.127e-17844.23AMP-binding domain-containing protein OS=Tetraodon... [more]
A0A1A8AI755.167e-17845.19AMP-binding domain-containing protein OS=Nothobran... [more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acsbg23.296e-17545.23acyl-CoA synthetase bubblegum family member 2 [Sou... [more]
ENSAMXT00000016625.27.815e-17243.02long-chain-fatty-acid--CoA ligase ACSBG2-like [Sou... [more]
acsbg12.713e-15141.08acyl-CoA synthetase bubblegum family member 1 [Sou... [more]
acsl51.940e-3926.23acyl-CoA synthetase long chain family member 5 [So... [more]
acsl52.807e-3925.70acyl-CoA synthetase long chain family member 5 [So... [more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
acsbg21.316e-17144.54acyl-CoA synthetase bubblegum family member 2 [Sou... [more]
ACSL12.333e-4226.63acyl-CoA synthetase long chain family member 1 [So... [more]
ACSL11.085e-3829.24acyl-CoA synthetase long chain family member 1 [So... [more]
acsl3b6.044e-1626.07acyl-CoA synthetase long chain family member 3b [S... [more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
FAA21.202e-3926.96Medium chain fatty acyl-CoA synthetase; activates ... [more]
FAA15.943e-2727.03Long chain fatty acyl-CoA synthetase; activates fa... [more]
FAA49.064e-2021.49Long chain fatty acyl-CoA synthetase; activates fa... [more]
FAA31.814e-1824.86Long chain fatty acyl-CoA synthetase; activates im... [more]
PCS602.752e-1628.47Oxalyl-CoA synthetase; capable of catalyzing conve... [more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO320543.905e-14542.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO463355.309e-4526.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO455042.304e-4025.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO454612.411e-4025.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO298794.735e-3824.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000027775.13.057e-17645.10long-chain-fatty-acid--CoA ligase ACSBG2 [Source:N... [more]
ENSORLT00000001544.23.057e-17645.10long-chain-fatty-acid--CoA ligase ACSBG2 [Source:N... [more]
acsbg27.797e-17442.79acyl-CoA synthetase bubblegum family member 2 [Sou... [more]
acsbg21.511e-17342.79acyl-CoA synthetase bubblegum family member 2 [Sou... [more]
acsl21.060e-4025.86long-chain-fatty-acid--CoA ligase 1 [Source:NCBI g... [more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000027217.10.000e+099.21SMESG000027217.1[more]
SMESG000027204.10.000e+059.40SMESG000027204.1[more]
SMESG000027204.10.000e+059.40SMESG000027204.1[more]
SMESG000027204.10.000e+060.37SMESG000027204.1[more]
SMESG000080395.18.241e-16645.55SMESG000080395.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031947 ID=SMED30031947|Name=Long-chain-fatty-acid--CoA ligase ACSBG2|organism=Schmidtea mediterranea sexual|type=transcript|length=2727bp
GTTTATTTATTTAATATTCTGTTGATCAAGTTCTCTTGAAATTTTGATTT
TGATATTAATGAAATTTATCTAATAATACAATCATGAATAATCATGTGAA
CTATTGTTTAAAATAAATAATGAGTTTAATGGACGTAAAAGTAAATATTT
CCAATCTGATTTCAACGTGATGCAAATTAACTTATTAGCATATGAAATGA
AAAGTAGTAAATTCAATCAATACTGAGAATAAATATGGAACATTGATAAC
AAACAAAAATTACGATAGCTCATCCAATTAAAATTACACCTTTGAGCTAA
ATTTTGTTTCGAAGTCTCAAAGGTGTTTTGTTTACACGCAGTTATTAATG
TATGCTATTTATAATGGTATTTAAAAATTTGCAAGCGATTAAAGGATTAA
TCTCATATTAGTGGTTTATCACGGTTTGCGTATCTACCAAAACAAAATTC
TATAAGTAATCAAAAACGTCAAATAAAATCTCATGGGACTCAATAAAGTT
TTAATAAAATACAATTTCACTTCTAAATCAAAACAATAAGTTTCATTTTT
AATAACAGTTTTTATAAATTTCAATCTTTTCATGCATGCATCAAAATTTG
GCCAATCAAATTTCAATAAAATTTAATGACCTTGAGTTTAGTATAAAATT
GATATAACATATAAATAAATAAACCTACAGCGACATAATTTGCAAAGTTC
AATAATGGTTGATACCAAAAGTGTAATTGGGGTTACAAATGCAGTCAATA
ACGTAAAAATCGACGACAATCAAGGAATCAACGACATAATAATTTCCAAC
GTTGATGATGAAACGAAAAATGTTCCTGAAGAGACAATTATTAACAGACT
GAAGGAAAATGTTGAAAGTCAACCAAACCATGTTGTTTTAAAACACAAAT
CCGATCCGAAAAAGGATTACGATTTAAGTTTGACAATGAAAGAATACTTG
GAGCAAATAACAAAGGCCGCCACAGGATTTATCACGCTAGGACTAGAACC
AAAGGCTGCTATTTGCATTCTGGGATTTAATCACCCAGCTTGGTTTATTA
GTGAATTGGGAGGAATATATGCTGGAGGAGTATCATGTGGAATTTATACG
TCAAATACGGCAGAAATCTGCAAATATATTATGATTGATTGCAAGTGTCA
GATCCTTATTTTGGAGAATGACGATCAGTTGAACAAAATTTTATCTATCT
TACCGGGAGTTCCTCAAGTTAAAGCCATTATCAAATACACTGGAGAAGTC
CAAGAAGAAGCTAAGAAGAAGTCAAAAATTCCAATTTATACTTGGTCGCA
GTTCTTAAGCATAGACTCAACAAACGCGACAGATGAACTGCATAATCGGC
AGGAAAATGTTAAACCTAAAGACTGTGCAGTTTTGATTTACACCAGCGGC
ACTACTGGTCTTCCAAAAGGCGTAATGCTCTCCCATGATAATATATTGTT
TACATTGAAAATGGTGCAAATTCATTTGGAATTAAAAAAGTTCCAAAATA
TTATTATTTCTTATCTTCCTTTAAGCCATGTAGCTGCGAATATGTTAGAC
ATTGCGTCTACCGTTGGTATGGGGAGCACAATATACTTTGCGCAACCAGA
CGCACTAAAAGGTTCGTTGGGAAAAACTTTAAAAGAGGTGAGACCAACAG
TTTTTCTTGGTGTCCCTCGAGTATATGAAAAAATTCAGGAACAATTAGAA
AATTTGAAGGCTTCAACAAACAAAAAATTGGATTCGGTGAAAGTTAAACA
AAATCTTGGTCTAGATCGATGTGAATACATTGCATCGGGTGCTGCTCCCA
TCTCGCAGCAAACTCTAGAGTTTTTTCAAGACATTGATATCTTAATACAC
CAGATCTATGGGATGTCTGAGAGTAGTGGACCACATACAATAGGAAAAAA
AGATGAGAAAAAACTTGGTTGTGTAGGAACTCTTATGAAAGGAGTTGAAC
TTAAAATTGAAAACCCAGATGAGAATCTTATTGGAGAAATCTGTATGCGA
GGTCGACATGTTTTTCTTGGATATTTCAATGCCGTTGAGAAAACTAAAGA
AGCCTTAGATTCGCAAAATTGGTTACATTCAGGAGATTTAGGAAAAGTTG
ACGGGGAGGGATATCTAATGGTCACTGGACGAATAAAAGAGTTGCTTATT
ACCGCTGGCGGGGAAAATGTTGCTCCTGTTCCAATTGAAGACAACATAAA
ATCAGAACTGCCATTTATCAGTAACGTAATGTTAGTAGGAGATAAGAAAA
AGTTTATTTCTTGTCTTCTGACATTGAAGACTGATTTGGATTCTAAGACT
CAACTCCCAACAGAAAAGCTTTCAGTGTCGGCAATCCGAAGTTTAGAAAG
CTTTGGCATTGAAGCTAAGGAAGTCGAAGATTTATTAAATTCAAACTTTG
CGGTTCTCAAATCAACAATTGATAATGCCATGAACCGAGTCAATGCACAG
TCAGTATCGAAGGCAGCCTATGTACAGAAATGGACAATACTTCCTAGAGA
TTTTTCGCTTAAAGGAGGAGAACTCGGTCCAACTCTGAAGATGAAAAGAA
TGTTCGTTATGGAGAAGTATGAAGATGTCATTAAGTCTATGTACACCGTG
TGACAGATTCACTTTATATCAAGATTGCCAGGATTTTGATCCGAGACTCA
TAATTCAATTTTATCATTTTCCGCTCTTGATATGTAATATTATGGAAATT
ATTTATAATAAAATATATTGAAAAAAA
back to top

protein sequence of SMED30031947-orf-1

>SMED30031947-orf-1 ID=SMED30031947-orf-1|Name=SMED30031947-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=633bp
MVDTKSVIGVTNAVNNVKIDDNQGINDIIISNVDDETKNVPEETIINRLK
ENVESQPNHVVLKHKSDPKKDYDLSLTMKEYLEQITKAATGFITLGLEPK
AAICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQI
LILENDDQLNKILSILPGVPQVKAIIKYTGEVQEEAKKKSKIPIYTWSQF
LSIDSTNATDELHNRQENVKPKDCAVLIYTSGTTGLPKGVMLSHDNILFT
LKMVQIHLELKKFQNIIISYLPLSHVAANMLDIASTVGMGSTIYFAQPDA
LKGSLGKTLKEVRPTVFLGVPRVYEKIQEQLENLKASTNKKLDSVKVKQN
LGLDRCEYIASGAAPISQQTLEFFQDIDILIHQIYGMSESSGPHTIGKKD
EKKLGCVGTLMKGVELKIENPDENLIGEICMRGRHVFLGYFNAVEKTKEA
LDSQNWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKS
ELPFISNVMLVGDKKKFISCLLTLKTDLDSKTQLPTEKLSVSAIRSLESF
GIEAKEVEDLLNSNFAVLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRDF
SLKGGELGPTLKMKRMFVMEKYEDVIKSMYTV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003996acyl-CoA ligase activity
GO:0047676arachidonate-CoA ligase activity
GO:0003824catalytic activity
GO:0000166nucleotide binding
GO:0004467long-chain fatty acid-CoA ligase activity
GO:0005524ATP binding
GO:0016874ligase activity
GO:0102391decanoate--CoA ligase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000067goblet cell
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR042099AMP-dep_Synthh-like_sf
IPR011528NERD
IPR000873AMP-dep_Synth/Lig
IPR020845AMP-binding_CS
Vocabulary: biological process
TermDefinition
GO:0008152metabolic process
GO:0001676long-chain fatty acid metabolic process
GO:0006629lipid metabolic process
GO:0006631fatty acid metabolic process
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 328..348
NoneNo IPR availablePANTHERPTHR43272:SF32LONG-CHAIN-FATTY-ACID--COA LIGASE ACSBG2coord: 39..337
NoneNo IPR availablePANTHERPTHR43272:SF32LONG-CHAIN-FATTY-ACID--COA LIGASE ACSBG2coord: 341..631
NoneNo IPR availablePANTHERPTHR43272FAMILY NOT NAMEDcoord: 341..631
coord: 39..337
NoneNo IPR availableCDDcd05933ACSBG_likecoord: 69..630
e-value: 0.0
score: 704.502
NoneNo IPR availableSUPERFAMILYSSF56801Acetyl-CoA synthetase-likecoord: 41..630
IPR042099AMP-dependent synthetase-like superfamilyGENE3DG3DSA:3.40.50.12780coord: 26..473
e-value: 1.2E-82
score: 279.9
IPR000873AMP-dependent synthetase/ligasePFAMPF00501AMP-bindingcoord: 50..483
e-value: 2.2E-91
score: 306.6
IPR020845AMP-binding, conserved sitePROSITEPS00455AMP_BINDINGcoord: 227..238