Phosphatidate phosphatase LPIN2

Overview
NamePhosphatidate phosphatase LPIN2
Smed IDSMED30031931
Length (bp)2838
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Phosphatidate phosphatase LPIN2 (SMED30031931) t-SNE clustered cells

Violin plots show distribution of expression levels for Phosphatidate phosphatase LPIN2 (SMED30031931) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Phosphatidate phosphatase LPIN2 (SMED30031931) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Phosphatidate phosphatase LPIN2 (SMED30031931) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031931

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
posterior sideSMED30031931h1SMcG0013190 dd_Smed_v4_8002_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30031931h1SMcG0013190 dd_Smed_v4_8002_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Phosphatidate phosphatase LPIN2 vs. Ensembl Human
Match: LPIN3 (lipin 3 [Source:HGNC Symbol;Acc:HGNC:14451])

HSP 1 Score: 362.844 bits (930), Expect = 1.336e-110
Identity = 198/426 (46.48%), Postives = 264/426 (61.97%), Query Frame = 1
Query: 1027 PTYPIIQELKLSLCGDISVNDNISEETFFQHLVSFEDFIKDPDEXXXXXXXXXXXNGKYYNWGVAAPMILSIIAFKTELPINTVSNLKETYMSQKKRRSTWFSWRRHEPPNDKKEPVKPELSV----------------IPPTPIVENKLTTVDSSEEISTHNKVYKKKIRLSSEEVSALNLKEGRNDIVFSMTTKYQGTTCCYATIYRWKWYDKIVISDVDGTITKSDVLGHVLPILGRDWTQAGVVKLYNKIFQNNYRFIYLSARAIGQAGITRTFLQDIVQEFSDKLPEGPILLSPTSLFQSLHREVIEKKPEYFKIQCLNDVRSLFPDSVHPLYAGFGNRINDVIAYKAVGIDPKRIFTVNPEGSLKNEYCQKWSTSYGNLFDVADHFFQFQSVHGISGIDYALEDYIDVNYWSLPINEVDI 2256
            PT   +  + LSLCG ++ + +IS E F QH VS++D  K+P  LL + +LV+ +NGK+YNW VAAPMILS+ AF+  LP +T+  L+   M +K  R  WFSWRR +   +++   K + +                  P +P++   L               YKK +RLSS+++  LNL+EG ND+VFS+TT+YQGT  C ATIY WKW DK+VISD+DGTITKSD LGH+LP LG+DWT  G+  LY+KI  N Y+F+Y SARAIG A +T+ +LQ  V E    LP+GPILLSP+SLF +LHREVIEKKPE FK+ CL+D++ LF     P YA FGNR NDV AY+ VG+   RIFTVNP G L  E  +   ++Y  L +V +    F  V      D A  +Y +  YW  P+  VD+
Sbjct:  431 PTLDTVDTIALSLCGGLADSRDISLEKFNQHSVSYQDLTKNPG-LLDDPNLVVKINGKHYNWAVAAPMILSLQAFQKNLPKSTMDKLEREKMPRKGGR-WWFSWRRRDFLAEERSAQKEKTAAKEQQGEKTEVLSSDDDAPDSPVI---LEIPSLPPSTPPSTPTYKKSLRLSSDQIRRLNLQEGANDVVFSVTTQYQGTCRCKATIYLWKWDDKVVISDIDGTITKSDALGHILPQLGKDWTHQGITSLYHKIQLNGYKFLYCSARAIGMADLTKGYLQ-WVSEGGCSLPKGPILLSPSSLFSALHREVIEKKPEVFKVACLSDIQQLFLPHGQPFYAAFGNRPNDVFAYRQVGLPESRIFTVNPRGELIQELIKNHKSTYERLGEVVE--LLFPPVARGPSTDLANPEYSNFCYWREPLPAVDL 848          

HSP 2 Score: 107.071 bits (266), Expect = 5.964e-23
Identity = 55/119 (46.22%), Postives = 77/119 (64.71%), Query Frame = 1
Query:  142 IKYVYSDINPSTLTGAIDIIVVEQEDGSFTCGPFHVRFGKMGTLKPADKIVDIHLNGVYLENLHMKLGSAGEAYFIETVEPTLSETIDSSFIVSP--------FHSDSEEVDDSEKTDL 474
            +K +Y  +NP+TL+G ID++VV+Q DGSF C PFHVRFGK+G L+  +K+VDI LNG  + +LHMKLG +GEA+F++ +E +  E +      SP        F SDS+    SE   L
Sbjct:   15 VKELYRGLNPATLSGGIDVLVVKQVDGSFRCSPFHVRFGKLGVLRSREKVVDIELNGEPV-DLHMKLGDSGEAFFVQELE-SDDEHVPPGLCTSPIPWGGLSGFPSDSQLGTASEPEGL 131          
BLAST of Phosphatidate phosphatase LPIN2 vs. Ensembl Human
Match: LPIN3 (lipin 3 [Source:HGNC Symbol;Acc:HGNC:14451])

HSP 1 Score: 362.459 bits (929), Expect = 1.494e-110
Identity = 198/426 (46.48%), Postives = 264/426 (61.97%), Query Frame = 1
Query: 1027 PTYPIIQELKLSLCGDISVNDNISEETFFQHLVSFEDFIKDPDEXXXXXXXXXXXNGKYYNWGVAAPMILSIIAFKTELPINTVSNLKETYMSQKKRRSTWFSWRRHEPPNDKKEPVKPELSV----------------IPPTPIVENKLTTVDSSEEISTHNKVYKKKIRLSSEEVSALNLKEGRNDIVFSMTTKYQGTTCCYATIYRWKWYDKIVISDVDGTITKSDVLGHVLPILGRDWTQAGVVKLYNKIFQNNYRFIYLSARAIGQAGITRTFLQDIVQEFSDKLPEGPILLSPTSLFQSLHREVIEKKPEYFKIQCLNDVRSLFPDSVHPLYAGFGNRINDVIAYKAVGIDPKRIFTVNPEGSLKNEYCQKWSTSYGNLFDVADHFFQFQSVHGISGIDYALEDYIDVNYWSLPINEVDI 2256
            PT   +  + LSLCG ++ + +IS E F QH VS++D  K+P  LL + +LV+ +NGK+YNW VAAPMILS+ AF+  LP +T+  L+   M +K  R  WFSWRR +   +++   K + +                  P +P++   L               YKK +RLSS+++  LNL+EG ND+VFS+TT+YQGT  C ATIY WKW DK+VISD+DGTITKSD LGH+LP LG+DWT  G+  LY+KI  N Y+F+Y SARAIG A +T+ +LQ  V E    LP+GPILLSP+SLF +LHREVIEKKPE FK+ CL+D++ LF     P YA FGNR NDV AY+ VG+   RIFTVNP G L  E  +   ++Y  L +V +    F  V      D A  +Y +  YW  P+  VD+
Sbjct:  430 PTLDTVDTIALSLCGGLADSRDISLEKFNQHSVSYQDLTKNPG-LLDDPNLVVKINGKHYNWAVAAPMILSLQAFQKNLPKSTMDKLEREKMPRKGGR-WWFSWRRRDFLAEERSAQKEKTAAKEQQGEKTEVLSSDDDAPDSPVI---LEIPSLPPSTPPSTPTYKKSLRLSSDQIRRLNLQEGANDVVFSVTTQYQGTCRCKATIYLWKWDDKVVISDIDGTITKSDALGHILPQLGKDWTHQGITSLYHKIQLNGYKFLYCSARAIGMADLTKGYLQ-WVSEGGCSLPKGPILLSPSSLFSALHREVIEKKPEVFKVACLSDIQQLFLPHGQPFYAAFGNRPNDVFAYRQVGLPESRIFTVNPRGELIQELIKNHKSTYERLGEVVE--LLFPPVARGPSTDLANPEYSNFCYWREPLPAVDL 847          

HSP 2 Score: 107.071 bits (266), Expect = 6.218e-23
Identity = 55/119 (46.22%), Postives = 77/119 (64.71%), Query Frame = 1
Query:  142 IKYVYSDINPSTLTGAIDIIVVEQEDGSFTCGPFHVRFGKMGTLKPADKIVDIHLNGVYLENLHMKLGSAGEAYFIETVEPTLSETIDSSFIVSP--------FHSDSEEVDDSEKTDL 474
            +K +Y  +NP+TL+G ID++VV+Q DGSF C PFHVRFGK+G L+  +K+VDI LNG  + +LHMKLG +GEA+F++ +E +  E +      SP        F SDS+    SE   L
Sbjct:   15 VKELYRGLNPATLSGGIDVLVVKQVDGSFRCSPFHVRFGKLGVLRSREKVVDIELNGEPV-DLHMKLGDSGEAFFVQELE-SDDEHVPPGLCTSPIPWGGLSGFPSDSQLGTASEPEGL 131          
BLAST of Phosphatidate phosphatase LPIN2 vs. Ensembl Human
Match: LPIN2 (lipin 2 [Source:HGNC Symbol;Acc:HGNC:14450])

HSP 1 Score: 355.14 bits (910), Expect = 2.522e-107
Identity = 208/538 (38.66%), Postives = 307/538 (57.06%), Query Frame = 1
Query:  742 LDSRASSEKPTETTITVTNESVHTLVN-NKPNDLENSKDVYLEDIMASGVSDELKRAYLYTEETKIRTRHQSNENVTLTVDAGYRSDGEVSV----LAISPTYPIIQELKLSLCGDISVNDNISEETFFQHLVSFEDFIKDPDEXXXXXXXXXXXNGKYYNWGVAAPMILSIIAFKTELPINTVSNLKETYMSQKKRRSTWFSWRRHE------PPNDKKEPVKPELSVIPPTP-------IVENKLTTVDSSEEIS-------------THNKV--YKKKIRLSSEEVSALNLKEGRNDIVFSMTTKYQGTTCCYATIYRWKWYDKIVISDVDGTITKSDVLGHVLPILGRDWTQAGVVKLYNKIFQNNYRFIYLSARAIGQAGITRTFLQDIVQEFSDKLPEGPILLSPTSLFQSLHREVIEKKPEYFKIQCLNDVRSLFPDSVHPLYAGFGNRINDVIAYKAVGIDPKRIFTVNPEGSLKNEYCQKWSTSYGNLFDVADHFFQFQSVHGISGIDYALEDYIDVNYWSLPINEVDI 2256
            L + A +E P+E+      +S       +K +  +   D+YL+D+   G+  E+   Y    E++  +R Q  E+ TL+     +S G  +       +S +   + ++ LSLCG +S N  IS+E F +H++++ +F ++P  +     ++ + N +YYNW +AAPMILS+  F+  LP  TV +  +  M +K  R  W+ WR+ E      P + + +   P  S +P +          EN  ++ + S+E+              +H     YKK +RLSS++++ L L +G ND+VFS+TT+YQGT  C  TIY W W DKI+ISD+DGTITKSD LG +LP LG+DWT  G+ KLY+ I +N Y+F+Y SARAIG A +TR +L   V +    LP GP++LSP+SLF + HREVIEKKPE FKI+CLND+++LF  S  P YA FGNR NDV AY  VG+   RIFTVNP+G L  E  +   +SY  L ++ +H F   S    S   +   ++    YW  PI EVD+
Sbjct:  364 LPNAALAEAPSESKPAAKVDSPSKKKGVHKRSQHQGPDDIYLDDL--KGLEPEVAALYFPKSESEPGSR-QWPESDTLSGSQSPQSVGSAAADSGTECLSDSAMDLPDVTLSLCGGLSENGEISKEKFMEHIITYHEFAENPGLIDNPNLVIRIYN-RYYNWALAAPMILSLQVFQKSLPKATVESWVKDKMPKKSGR--WWFWRKRESMTKQLPESKEGKSEAPPASDLPSSSKEPAGARPAENDSSSDEGSQELEESITVDPIPTEPLSHGSTTSYKKSLRLSSDQIAKLKLHDGPNDVVFSITTQYQGTCRCAGTIYLWNWNDKIIISDIDGTITKSDALGQILPQLGKDWTHQGIAKLYHSINENGYKFLYCSARAIGMADMTRGYLH-WVNDKGTILPRGPLMLSPSSLFSAFHREVIEKKPEKFKIECLNDIKNLFAPSKQPFYAAFGNRPNDVYAYTQVGVPDCRIFTVNPKGELIQERTKGNKSSYHRLSELVEHVFPLLSKEQNSA--FPCPEFSSFCYWRDPIPEVDL 892          

HSP 2 Score: 101.679 bits (252), Expect = 3.161e-21
Identity = 43/81 (53.09%), Postives = 63/81 (77.78%), Query Frame = 1
Query:  127 KLISGIKYVYSDINPSTLTGAIDIIVVEQEDGSFTCGPFHVRFGKMGTLKPADKIVDIHLNGVYLENLHMKLGSAGEAYFI 369
            ++I  +K +Y  IN +TL+G ID+IVV+Q+DGS+ C PFHVRFGK+G L+  +K++DI +NG  + +LHMKLG  GEA+F+
Sbjct:   10 QVIVTVKELYKGINQATLSGCIDVIVVQQQDGSYQCSPFHVRFGKLGVLRSKEKVIDIEINGSAV-DLHMKLGDNGEAFFV 89          
BLAST of Phosphatidate phosphatase LPIN2 vs. Ensembl Human
Match: LPIN1 (lipin 1 [Source:HGNC Symbol;Acc:HGNC:13345])

HSP 1 Score: 318.546 bits (815), Expect = 6.547e-94
Identity = 196/469 (41.79%), Postives = 279/469 (59.49%), Query Frame = 1
Query:  916 YTEETKIRTRHQSNENVTLT-VDAGYRS--DGEVSVLAISPTYPIIQELKLSLCGDISVNDNISEETFFQHLVSFEDFIKDPDEXXXXXXXXXXXNGKYYNWGVAAPMILSIIAFKTELPINTVSNLKETYMSQKKRRSTWFSWRRHEPPNDKKEPVKPELSVI---------PPTPIVENKLTTVDSS--EEISTH------------NKVYKKKIRLSSEEVSALNLKEGRNDIVFSMTTKYQGTTCCYATIYRWKWYDKIVISDVDGTITKSDVLGHVLPILGRDWTQAGVVKLYNKIFQNNYRFIYLSARAIGQAGITRTFLQDIVQEFSDKLPEGPILLSPTSLFQSLHREVIEKKPEYFKIQCLNDVRSLFPDSVHPLYAGFGNRINDVIAYKAVGIDPKRIFTVNPEGSLKNEYCQKWSTSYGNLFDVADHFFQFQSVHGISGIDYALED-YIDVNYWSLPI 2241
            +  +   R+ +QS ++V  + VD+G  S  DG   + +I+          +SLCG +S +  I+++ F +  VS++ F+ +P  ++ + +LV+ +  KYYNW  AAP++L++ AF+  LP  TV ++    M +K  R  WFSWR        KE  KPE  +          PP   +  ++    SS  EE +              N  YKK +RL+SE++ +L LK G ND+VFS+TT+YQGT  C  TIY W W DK++ISD+DGTIT+SD LGH+LP LG+DWT  G+ KLY+K+ QN Y+F+Y SARAIG A +TR +L   V E    LP+GP+LLSP+SLF +LHREVIEKKPE FK+QCL D+++LF  +  P YA FGNR  DV +YK VG+   RIFTVNP+G L  E+ +   +SY  L +V DH F        S  D+   D + +  +W  P+
Sbjct:  432 HASDNGARSANQSPQSVGSSGVDSGVESTSDGLRDLPSIA----------ISLCGGLSDHREITKDAFLEQAVSYQQFVDNP-AIIDDPNLVVKIGSKYYNWTTAAPLLLAMQAFQKPLPKATVESIMRDKMPKKGGR-WWFSWRGRN--TTIKEESKPEQCLAGKAHSTGEQPPQLSLATRVKHESSSSDEERAAAKPSNAGHLPLLPNVSYKKTLRLTSEQLKSLKLKNGPNDVVFSVTTQYQGTCRCEGTIYLWNWDDKVIISDIDGTITRSDTLGHILPTLGKDWTHQGIAKLYHKVSQNGYKFLYCSARAIGMADMTRGYLH-WVNERGTVLPQGPLLLSPSSLFSALHREVIEKKPEKFKVQCLTDIKNLFFPNTEPFYAAFGNRPADVYSYKQVGVSLNRIFTVNPKGELVQEHAKTNISSYVRLCEVVDHVFPLLKRSHSS--DFPCSDTFSNFTFWREPL 883          

HSP 2 Score: 100.523 bits (249), Expect = 6.784e-21
Identity = 47/99 (47.47%), Postives = 66/99 (66.67%), Query Frame = 1
Query:  142 IKYVYSDINPSTLTGAIDIIVVEQEDGSFTCGPFHVRFGKMGTLKPADKIVDIHLNGVYLENLHMKLGSAGEAYFIETVEPTLSETIDSSFIVSPFHSD 438
            +K +Y  +NP+TL+G IDIIV+ Q +G+  C PFHVRFGKMG L+  +K+VDI +NG  ++ LHMKLG  GEA+F++  +    E I      SP  S+
Sbjct:   21 VKELYKGLNPATLSGCIDIIVIRQPNGNLQCSPFHVRFGKMGVLRSREKVVDIEINGESVD-LHMKLGDNGEAFFVQETD-NDQEVIPMHLATSPILSE 117          
BLAST of Phosphatidate phosphatase LPIN2 vs. Ensembl Human
Match: LPIN1 (lipin 1 [Source:HGNC Symbol;Acc:HGNC:13345])

HSP 1 Score: 318.546 bits (815), Expect = 7.378e-94
Identity = 196/469 (41.79%), Postives = 279/469 (59.49%), Query Frame = 1
Query:  916 YTEETKIRTRHQSNENVTLT-VDAGYRS--DGEVSVLAISPTYPIIQELKLSLCGDISVNDNISEETFFQHLVSFEDFIKDPDEXXXXXXXXXXXNGKYYNWGVAAPMILSIIAFKTELPINTVSNLKETYMSQKKRRSTWFSWRRHEPPNDKKEPVKPELSVI---------PPTPIVENKLTTVDSS--EEISTH------------NKVYKKKIRLSSEEVSALNLKEGRNDIVFSMTTKYQGTTCCYATIYRWKWYDKIVISDVDGTITKSDVLGHVLPILGRDWTQAGVVKLYNKIFQNNYRFIYLSARAIGQAGITRTFLQDIVQEFSDKLPEGPILLSPTSLFQSLHREVIEKKPEYFKIQCLNDVRSLFPDSVHPLYAGFGNRINDVIAYKAVGIDPKRIFTVNPEGSLKNEYCQKWSTSYGNLFDVADHFFQFQSVHGISGIDYALED-YIDVNYWSLPI 2241
            +  +   R+ +QS ++V  + VD+G  S  DG   + +I+          +SLCG +S +  I+++ F +  VS++ F+ +P  ++ + +LV+ +  KYYNW  AAP++L++ AF+  LP  TV ++    M +K  R  WFSWR        KE  KPE  +          PP   +  ++    SS  EE +              N  YKK +RL+SE++ +L LK G ND+VFS+TT+YQGT  C  TIY W W DK++ISD+DGTIT+SD LGH+LP LG+DWT  G+ KLY+K+ QN Y+F+Y SARAIG A +TR +L   V E    LP+GP+LLSP+SLF +LHREVIEKKPE FK+QCL D+++LF  +  P YA FGNR  DV +YK VG+   RIFTVNP+G L  E+ +   +SY  L +V DH F        S  D+   D + +  +W  P+
Sbjct:  426 HASDNGARSANQSPQSVGSSGVDSGVESTSDGLRDLPSIA----------ISLCGGLSDHREITKDAFLEQAVSYQQFVDNP-AIIDDPNLVVKIGSKYYNWTTAAPLLLAMQAFQKPLPKATVESIMRDKMPKKGGR-WWFSWRGRN--TTIKEESKPEQCLAGKAHSTGEQPPQLSLATRVKHESSSSDEERAAAKPSNAGHLPLLPNVSYKKTLRLTSEQLKSLKLKNGPNDVVFSVTTQYQGTCRCEGTIYLWNWDDKVIISDIDGTITRSDTLGHILPTLGKDWTHQGIAKLYHKVSQNGYKFLYCSARAIGMADMTRGYLH-WVNERGTVLPQGPLLLSPSSLFSALHREVIEKKPEKFKVQCLTDIKNLFFPNTEPFYAAFGNRPADVYSYKQVGVSLNRIFTVNPKGELVQEHAKTNISSYVRLCEVVDHVFPLLKRSHSS--DFPCSDTFSNFTFWREPL 877          

HSP 2 Score: 100.523 bits (249), Expect = 7.099e-21
Identity = 47/99 (47.47%), Postives = 66/99 (66.67%), Query Frame = 1
Query:  142 IKYVYSDINPSTLTGAIDIIVVEQEDGSFTCGPFHVRFGKMGTLKPADKIVDIHLNGVYLENLHMKLGSAGEAYFIETVEPTLSETIDSSFIVSPFHSD 438
            +K +Y  +NP+TL+G IDIIV+ Q +G+  C PFHVRFGKMG L+  +K+VDI +NG  ++ LHMKLG  GEA+F++  +    E I      SP  S+
Sbjct:   15 VKELYKGLNPATLSGCIDIIVIRQPNGNLQCSPFHVRFGKMGVLRSREKVVDIEINGESVD-LHMKLGDNGEAFFVQETD-NDQEVIPMHLATSPILSE 111          
BLAST of Phosphatidate phosphatase LPIN2 vs. Ensembl Celegans
Match: lpin-1 (LiPIN (Mammalian lipodystrophy associated) homolog [Source:UniProtKB/TrEMBL;Acc:Q9XXT5])

HSP 1 Score: 253.447 bits (646), Expect = 1.530e-71
Identity = 135/312 (43.27%), Postives = 192/312 (61.54%), Query Frame = 1
Query: 1351 PPNDKKEPVKPELSV-----IPPTPIVENKLTTVDSSEEI---------STHNKVYKKKIRLSSEEVSALNLKEGRNDIVFSMTTKYQGTTCCYATIYRWKWYDKIVISDVDGTITKSDVLGHVLPILGRDWTQAGVVKLYNKIFQNNYRFIYLSARAIGQAGITRTFLQDIVQEFSDKLPEGPILLSPTSLFQSLHREVIEKKPEYFKIQCLNDVRSLFPDSVHPLYAGFGNRINDVIAYKAVGIDPKRIFTVNPEGSLKNEYCQKWSTSYGNLF-DVADHFFQFQSVHGISGIDYALEDYIDVNYWSLPI 2241
            PPNDK  P +  +       IP +    N + +  SS+EI               Y + +RLSSE++ +L L  G N++ FS+TTK+QGTT C   IY +KWY++IV+SD+DGTITKSDVLGHV+P +G  W   GV +LY +I  N Y+ +YLS+RAIGQ+  T+ +L+ + Q+ S +LP+GP+LLSPTS+  +  REVIE++PE FKI  L D++ LFP S +P YAGFGNRI DV++Y+AV +   RI  ++P G +K       + SY ++  D  D+ F   SVH + G     E     + WS P+
Sbjct:  451 PPNDKT-PTRESVRFGAGNDIPSSTSATNGVRSRASSDEIFPLSEDELDDNFRPQYMQSLRLSSEKLKSLGLVFGANELRFSITTKFQGTTWCSCNIYLYKWYEQIVVSDIDGTITKSDVLGHVIPAIGGTWAHTGVAELYTRIKNNGYKMVYLSSRAIGQSHTTKQYLKSVAQD-SKQLPDGPVLLSPTSIITAFRREVIERRPEEFKIAALTDLKQLFP-SGNPFYAGFGNRITDVVSYEAVAVPAARILIIDPSGKVKRSDSSGLALSYKSMASDTVDYMFPPLSVH-VKGDARKTERL--TSTWSKPL 756          

HSP 2 Score: 94.3597 bits (233), Expect = 1.728e-19
Identity = 42/85 (49.41%), Postives = 60/85 (70.59%), Query Frame = 1
Query:  127 KLISGIKYVYSDINPSTLTGAIDIIVVEQEDGSFTCGPFHVRFGKMGTLKPADKIVDIHLNGVYLENLHMKLGSAGEAYFIETVE 381
            ++   +KY Y+ INP+TL+GAID++VVEQ +G +   PFHVRFGK G    +DK VDI +NGV + +L MKL  +G A+F+E  +
Sbjct:    6 RVFKNVKYFYNSINPATLSGAIDVVVVEQPNGEYKSTPFHVRFGKYGVFSYSDKYVDIAVNGVEI-DLKMKLADSGVAFFVEEAD 89          
BLAST of Phosphatidate phosphatase LPIN2 vs. Ensembl Fly
Match: Lpin (gene:FBgn0263593 transcript:FBtr0303580)

HSP 1 Score: 338.961 bits (868), Expect = 4.055e-101
Identity = 217/594 (36.53%), Postives = 317/594 (53.37%), Query Frame = 1
Query:  718 TWDWGNFPLDSRASSEKPTETTITVTNESVHTLVNN------KPNDLENSK------DVYLEDIMASGVSDELKRAYLYTEETKIRTR----HQSNENVTLTVDAGYRSDGEVSVLA-------ISPTYPIIQELKLSLCGDISVNDNISEETFFQHLVSFEDFIKDPDEXXXXXXXXXXXNGKYYNWGVAAPMILSIIAFKTELPINTVSNL--------------KETYMSQK----KRRSTWFSWRR------------HEPPNDKKEPVKPELSVI-----PPTPIV--------------ENKLTTVDSSEEIS-THNKV------YKKKIRLSSEEVSALNLKEGRNDIVFSMTTKYQGTTCCYATIYRWKWYDKIVISDVDGTITKSDVLGHVLPILGRDWTQAGVVKLYNKIFQNNYRFIYLSARAIGQAGITRTFLQDIVQEFSDKLPEGPILLSPTSLFQSLHREVIEKKPEYFKIQCLNDVRSLFPDSVHPLYAGFGNRINDVIAYKAVGIDPKRIFTVNPEGSLKNEYCQKWSTSYGNLFDVADHFFQFQSVHGISGIDYALEDYIDVNYWSLPINEVDIKE 2262
            +W WG  P   +A +E    +   V      ++++N      + N L   K      D+YL D+ A  +  E+   Y  +  +K  +      +S    +L        +G+ S+ +              +  + +S+CG        S+E F +HLV++ D  K P  +  + +LV+ LNGKYY W  A P+++++I F+  L  + +  L              K+  ++Q     + +  W+SWRR            H  P  K E    + +V      P +P +              EN    VD+ EE++   NK       YKK +RLSS  +  LNLKEG N+I FS+TT YQGTT C   ++RWK  DK+VISD+DGTITKSDVLGH+LP++G+DW Q GV +L++KI QN Y+ +YLSARAIGQ+ +TR +L+ I Q  +  LP+GP+LL+PTSL  + HREVIEKKPE FKI CL+D+R LFPD   P YAG+GNRINDV AY+AVGI   RIFT+N +G LK+E  Q + +SY ++  + D  F          +D A  ++ + NYW  PI +++I E
Sbjct:  357 SWKWGELPTPEQAKNE--AMSAAQVQQSEHQSMLSNMFSFMKRANRLRKEKGVGEVGDIYLSDLDAGSMDPEMAALYFPSPLSKAASPPEEDGESGNGTSLPHSPSSLEEGQKSIDSDFDETKQQRDNNRYLDFVAMSMCGMSEQGAPPSDEEFDRHLVNYPDVCKSP-SIFSSPNLVVRLNGKYYTWMAACPIVMTMITFQKPLTHDAIEQLMSQTVDGKCLPGDEKQEAVAQADNGGQTKRYWWSWRRSQDAAPNHLNNTHGMPLGKDEKDGDQAAVATQTSRPTSPDITDPTLSKSDSLVNAENTSALVDNLEELTMASNKSDEPKERYKKSLRLSSAAIKKLNLKEGMNEIEFSVTTAYQGTTRCKCYLFRWKHNDKVVISDIDGTITKSDVLGHILPMVGKDWAQLGVAQLFSKIEQNGYKLLYLSARAIGQSRVTREYLRSIRQ-GNVMLPDGPLLLNPTSLISAFHREVIEKKPEQFKIACLSDIRDLFPDK-EPFYAGYGNRINDVWAYRAVGIPIMRIFTINTKGELKHELTQTFQSSYCSMTYIVDQLFP------PVKLDEASAEFSNFNYWRDPIPDLEIPE 939          
BLAST of Phosphatidate phosphatase LPIN2 vs. Ensembl Fly
Match: Lpin (gene:FBgn0263593 transcript:FBtr0303573)

HSP 1 Score: 339.347 bits (869), Expect = 8.791e-101
Identity = 218/593 (36.76%), Postives = 319/593 (53.79%), Query Frame = 1
Query:  718 TWDWGNFPLDSRASSEKPTETTITVTNESVHTLVNN------KPNDLENSK------DVYLEDIMASGVSDELKRAYLYTEETKIRTR----HQSNENVTL-----TVDAGYRS-DGEVSVLAISPTYPIIQELKLSLCGDISVNDNISEETFFQHLVSFEDFIKDPDEXXXXXXXXXXXNGKYYNWGVAAPMILSIIAFKTELPINTVSNL--------------KETYMSQK----KRRSTWFSWRR------------HEPPNDKKEPVKPELSVI-----PPTPIV--------------ENKLTTVDSSEEIS-THNKV------YKKKIRLSSEEVSALNLKEGRNDIVFSMTTKYQGTTCCYATIYRWKWYDKIVISDVDGTITKSDVLGHVLPILGRDWTQAGVVKLYNKIFQNNYRFIYLSARAIGQAGITRTFLQDIVQEFSDKLPEGPILLSPTSLFQSLHREVIEKKPEYFKIQCLNDVRSLFPDSVHPLYAGFGNRINDVIAYKAVGIDPKRIFTVNPEGSLKNEYCQKWSTSYGNLFDVADHFFQFQSVHGISGIDYALEDYIDVNYWSLPINEVDIKE 2262
            +W WG  P   +A +E    +   V      ++++N      + N L   K      D+YL D+ A  +  E+   Y  +  +K  +      +S    +L     +++ G +S D +            +  + +S+CG        S+E F +HLV++ D  K P  +  + +LV+ LNGKYY W  A P+++++I F+  L  + +  L              K+  ++Q     + +  W+SWRR            H  P  K E    + +V      P +P +              EN    VD+ EE++   NK       YKK +RLSS  +  LNLKEG N+I FS+TT YQGTT C   ++RWK  DK+VISD+DGTITKSDVLGH+LP++G+DW Q GV +L++KI QN Y+ +YLSARAIGQ+ +TR +L+ I Q  +  LP+GP+LL+PTSL  + HREVIEKKPE FKI CL+D+R LFPD   P YAG+GNRINDV AY+AVGI   RIFT+N +G LK+E  Q + +SY ++  + D  F          +D A  ++ + NYW  PI +++I E
Sbjct:  430 SWKWGELPTPEQAKNE--AMSAAQVQQSEHQSMLSNMFSFMKRANRLRKEKGVGEVGDIYLSDLDAGSMDPEMAALYFPSPLSKAASPPEEDGESGNGTSLPHSPSSLEEGQKSIDSDFDETKQQRDNKYLDFVAMSMCGMSEQGAPPSDEEFDRHLVNYPDVCKSP-SIFSSPNLVVRLNGKYYTWMAACPIVMTMITFQKPLTHDAIEQLMSQTVDGKCLPGDEKQEAVAQADNGGQTKRYWWSWRRSQDAAPNHLNNTHGMPLGKDEKDGDQAAVATQTSRPTSPDITDPTLSKSDSLVNAENTSALVDNLEELTMASNKSDEPKERYKKSLRLSSAAIKKLNLKEGMNEIEFSVTTAYQGTTRCKCYLFRWKHNDKVVISDIDGTITKSDVLGHILPMVGKDWAQLGVAQLFSKIEQNGYKLLYLSARAIGQSRVTREYLRSIRQ-GNVMLPDGPLLLNPTSLISAFHREVIEKKPEQFKIACLSDIRDLFPDK-EPFYAGYGNRINDVWAYRAVGIPIMRIFTINTKGELKHELTQTFQSSYCSMTYIVDQLFP------PVKLDEASAEFSNFNYWRDPIPDLEIPE 1011          

HSP 2 Score: 107.842 bits (268), Expect = 1.903e-23
Identity = 57/132 (43.18%), Postives = 86/132 (65.15%), Query Frame = 1
Query:  127 KLISGIKYVYSDINPSTLTGAIDIIVVEQEDGSFTCGPFHVRFGKMGTLKPADKIVDIHLNGVYLENLHMKLGSAGEAYFIETVEPTLSETIDSSFIVSP----FHSDSEEVDDSEKTDLSGSRLNKKRSRK 510
            ++ S  +  Y+DIN +TLTGAID+IVVEQ DG F C PFHVRFGK+G L+  +K+VDI +NGV + ++ MKLG +GEA+F+E       E + ++   SP    F +  ++ +D+ + D+SG   +K  S +
Sbjct:    6 RVFSNFRDFYNDINAATLTGAIDVIVVEQRDGEFQCSPFHVRFGKLGVLRSREKVVDIEINGVPV-DIQMKLGDSGEAFFVEECLEDEDEELPANLATSPIPNSFLASRDKANDTME-DISGVVTDKNASEE 135          
BLAST of Phosphatidate phosphatase LPIN2 vs. Ensembl Fly
Match: Lpin (gene:FBgn0263593 transcript:FBtr0113055)

HSP 1 Score: 338.191 bits (866), Expect = 2.666e-100
Identity = 217/594 (36.53%), Postives = 317/594 (53.37%), Query Frame = 1
Query:  718 TWDWGNFPLDSRASSEKPTETTITVTNESVHTLVNN------KPNDLENSK------DVYLEDIMASGVSDELKRAYLYTEETKIRTR----HQSNENVTLTVDAGYRSDGEVSVLA-------ISPTYPIIQELKLSLCGDISVNDNISEETFFQHLVSFEDFIKDPDEXXXXXXXXXXXNGKYYNWGVAAPMILSIIAFKTELPINTVSNL--------------KETYMSQK----KRRSTWFSWRR------------HEPPNDKKEPVKPELSVI-----PPTPIV--------------ENKLTTVDSSEEIS-THNKV------YKKKIRLSSEEVSALNLKEGRNDIVFSMTTKYQGTTCCYATIYRWKWYDKIVISDVDGTITKSDVLGHVLPILGRDWTQAGVVKLYNKIFQNNYRFIYLSARAIGQAGITRTFLQDIVQEFSDKLPEGPILLSPTSLFQSLHREVIEKKPEYFKIQCLNDVRSLFPDSVHPLYAGFGNRINDVIAYKAVGIDPKRIFTVNPEGSLKNEYCQKWSTSYGNLFDVADHFFQFQSVHGISGIDYALEDYIDVNYWSLPINEVDIKE 2262
            +W WG  P   +A +E    +   V      ++++N      + N L   K      D+YL D+ A  +  E+   Y  +  +K  +      +S    +L        +G+ S+ +              +  + +S+CG        S+E F +HLV++ D  K P  +  + +LV+ LNGKYY W  A P+++++I F+  L  + +  L              K+  ++Q     + +  W+SWRR            H  P  K E    + +V      P +P +              EN    VD+ EE++   NK       YKK +RLSS  +  LNLKEG N+I FS+TT YQGTT C   ++RWK  DK+VISD+DGTITKSDVLGH+LP++G+DW Q GV +L++KI QN Y+ +YLSARAIGQ+ +TR +L+ I Q  +  LP+GP+LL+PTSL  + HREVIEKKPE FKI CL+D+R LFPD   P YAG+GNRINDV AY+AVGI   RIFT+N +G LK+E  Q + +SY ++  + D  F          +D A  ++ + NYW  PI +++I E
Sbjct:  430 SWKWGELPTPEQAKNE--AMSAAQVQQSEHQSMLSNMFSFMKRANRLRKEKGVGEVGDIYLSDLDAGSMDPEMAALYFPSPLSKAASPPEEDGESGNGTSLPHSPSSLEEGQKSIDSDFDETKQQRDNNRYLDFVAMSMCGMSEQGAPPSDEEFDRHLVNYPDVCKSP-SIFSSPNLVVRLNGKYYTWMAACPIVMTMITFQKPLTHDAIEQLMSQTVDGKCLPGDEKQEAVAQADNGGQTKRYWWSWRRSQDAAPNHLNNTHGMPLGKDEKDGDQAAVATQTSRPTSPDITDPTLSKSDSLVNAENTSALVDNLEELTMASNKSDEPKERYKKSLRLSSAAIKKLNLKEGMNEIEFSVTTAYQGTTRCKCYLFRWKHNDKVVISDIDGTITKSDVLGHILPMVGKDWAQLGVAQLFSKIEQNGYKLLYLSARAIGQSRVTREYLRSIRQ-GNVMLPDGPLLLNPTSLISAFHREVIEKKPEQFKIACLSDIRDLFPDK-EPFYAGYGNRINDVWAYRAVGIPIMRIFTINTKGELKHELTQTFQSSYCSMTYIVDQLFP------PVKLDEASAEFSNFNYWRDPIPDLEIPE 1012          

HSP 2 Score: 107.842 bits (268), Expect = 1.778e-23
Identity = 57/132 (43.18%), Postives = 86/132 (65.15%), Query Frame = 1
Query:  127 KLISGIKYVYSDINPSTLTGAIDIIVVEQEDGSFTCGPFHVRFGKMGTLKPADKIVDIHLNGVYLENLHMKLGSAGEAYFIETVEPTLSETIDSSFIVSP----FHSDSEEVDDSEKTDLSGSRLNKKRSRK 510
            ++ S  +  Y+DIN +TLTGAID+IVVEQ DG F C PFHVRFGK+G L+  +K+VDI +NGV + ++ MKLG +GEA+F+E       E + ++   SP    F +  ++ +D+ + D+SG   +K  S +
Sbjct:    6 RVFSNFRDFYNDINAATLTGAIDVIVVEQRDGEFQCSPFHVRFGKLGVLRSREKVVDIEINGVPV-DIQMKLGDSGEAFFVEECLEDEDEELPANLATSPIPNSFLASRDKANDTME-DISGVVTDKNASEE 135          
BLAST of Phosphatidate phosphatase LPIN2 vs. Ensembl Fly
Match: Lpin (gene:FBgn0263593 transcript:FBtr0303583)

HSP 1 Score: 338.191 bits (866), Expect = 2.666e-100
Identity = 217/594 (36.53%), Postives = 317/594 (53.37%), Query Frame = 1
Query:  718 TWDWGNFPLDSRASSEKPTETTITVTNESVHTLVNN------KPNDLENSK------DVYLEDIMASGVSDELKRAYLYTEETKIRTR----HQSNENVTLTVDAGYRSDGEVSVLA-------ISPTYPIIQELKLSLCGDISVNDNISEETFFQHLVSFEDFIKDPDEXXXXXXXXXXXNGKYYNWGVAAPMILSIIAFKTELPINTVSNL--------------KETYMSQK----KRRSTWFSWRR------------HEPPNDKKEPVKPELSVI-----PPTPIV--------------ENKLTTVDSSEEIS-THNKV------YKKKIRLSSEEVSALNLKEGRNDIVFSMTTKYQGTTCCYATIYRWKWYDKIVISDVDGTITKSDVLGHVLPILGRDWTQAGVVKLYNKIFQNNYRFIYLSARAIGQAGITRTFLQDIVQEFSDKLPEGPILLSPTSLFQSLHREVIEKKPEYFKIQCLNDVRSLFPDSVHPLYAGFGNRINDVIAYKAVGIDPKRIFTVNPEGSLKNEYCQKWSTSYGNLFDVADHFFQFQSVHGISGIDYALEDYIDVNYWSLPINEVDIKE 2262
            +W WG  P   +A +E    +   V      ++++N      + N L   K      D+YL D+ A  +  E+   Y  +  +K  +      +S    +L        +G+ S+ +              +  + +S+CG        S+E F +HLV++ D  K P  +  + +LV+ LNGKYY W  A P+++++I F+  L  + +  L              K+  ++Q     + +  W+SWRR            H  P  K E    + +V      P +P +              EN    VD+ EE++   NK       YKK +RLSS  +  LNLKEG N+I FS+TT YQGTT C   ++RWK  DK+VISD+DGTITKSDVLGH+LP++G+DW Q GV +L++KI QN Y+ +YLSARAIGQ+ +TR +L+ I Q  +  LP+GP+LL+PTSL  + HREVIEKKPE FKI CL+D+R LFPD   P YAG+GNRINDV AY+AVGI   RIFT+N +G LK+E  Q + +SY ++  + D  F          +D A  ++ + NYW  PI +++I E
Sbjct:  430 SWKWGELPTPEQAKNE--AMSAAQVQQSEHQSMLSNMFSFMKRANRLRKEKGVGEVGDIYLSDLDAGSMDPEMAALYFPSPLSKAASPPEEDGESGNGTSLPHSPSSLEEGQKSIDSDFDETKQQRDNNRYLDFVAMSMCGMSEQGAPPSDEEFDRHLVNYPDVCKSP-SIFSSPNLVVRLNGKYYTWMAACPIVMTMITFQKPLTHDAIEQLMSQTVDGKCLPGDEKQEAVAQADNGGQTKRYWWSWRRSQDAAPNHLNNTHGMPLGKDEKDGDQAAVATQTSRPTSPDITDPTLSKSDSLVNAENTSALVDNLEELTMASNKSDEPKERYKKSLRLSSAAIKKLNLKEGMNEIEFSVTTAYQGTTRCKCYLFRWKHNDKVVISDIDGTITKSDVLGHILPMVGKDWAQLGVAQLFSKIEQNGYKLLYLSARAIGQSRVTREYLRSIRQ-GNVMLPDGPLLLNPTSLISAFHREVIEKKPEQFKIACLSDIRDLFPDK-EPFYAGYGNRINDVWAYRAVGIPIMRIFTINTKGELKHELTQTFQSSYCSMTYIVDQLFP------PVKLDEASAEFSNFNYWRDPIPDLEIPE 1012          

HSP 2 Score: 107.842 bits (268), Expect = 1.778e-23
Identity = 57/132 (43.18%), Postives = 86/132 (65.15%), Query Frame = 1
Query:  127 KLISGIKYVYSDINPSTLTGAIDIIVVEQEDGSFTCGPFHVRFGKMGTLKPADKIVDIHLNGVYLENLHMKLGSAGEAYFIETVEPTLSETIDSSFIVSP----FHSDSEEVDDSEKTDLSGSRLNKKRSRK 510
            ++ S  +  Y+DIN +TLTGAID+IVVEQ DG F C PFHVRFGK+G L+  +K+VDI +NGV + ++ MKLG +GEA+F+E       E + ++   SP    F +  ++ +D+ + D+SG   +K  S +
Sbjct:    6 RVFSNFRDFYNDINAATLTGAIDVIVVEQRDGEFQCSPFHVRFGKLGVLRSREKVVDIEINGVPV-DIQMKLGDSGEAFFVEECLEDEDEELPANLATSPIPNSFLASRDKANDTME-DISGVVTDKNASEE 135          
BLAST of Phosphatidate phosphatase LPIN2 vs. Ensembl Fly
Match: Lpin (gene:FBgn0263593 transcript:FBtr0303577)

HSP 1 Score: 322.398 bits (825), Expect = 1.028e-94
Identity = 209/560 (37.32%), Postives = 300/560 (53.57%), Query Frame = 1
Query:  718 TWDWGNFPLDSRASSEKPTETTITVTNESVHTLVNN------KPNDLENSK------DVYLEDIMASGVSDELKRAYLYTEETKIRT----RHQSNENVTLTVDAGYRSDGEVSVLA-------ISPTYPIIQELKLSLCGDISVNDNISEETFFQHLVSFEDFIKDPDEXXXXXXXXXXXNGKYYNWGVAAPMILSIIAFKTELPINTVSNL--------------KETYMSQK----KRRSTWFSWRR------------HEPPNDKKEPVKPELSVI-----PPTPIV--------------ENKLTTVDSSEEIS-THNKV------YKKKIRLSSEEVSALNLKEGRNDIVFSMTTKYQGTTCCYATIYRWKWYDKIVISDVDGTITKSDVLGHVLPILGRDWTQAGVVKLYNKIFQNNYRFIYLSARAIGQAGITRTFLQDIVQEFSDKLPEGPILLSPTSLFQSLHREVIEKKPEYFKIQCLNDVRSLFPDSVHPLYAGFGNRINDVIAYKAVGIDPKRIFTVNPEGSLKNEYCQKW-STSYGNLFDVADHFF 2157
            +W WG  P   +A +E    +   V      ++++N      + N L   K      D+YL D+ A  +  E+   Y  +  +K  +      +S    +L        +G+ S+ +              +  + +S+CG        S+E F +HLV++ D  K P  +  + +LV+ LNGKYY W  A P+++++I F+  L  + +  L              K+  ++Q     + +  W+SWRR            H  P  K E    + +V      P +P +              EN    VD+ EE++   NK       YKK +RLSS  +  LNLKEG N+I FS+TT YQGTT C   ++RWK  DK+VISD+DGTITKSDVLGH+LP++G+DW Q GV +L++KI QN Y+ +YLSARAIGQ+ +TR +L+ I Q  +  LP+GP+LL+PTSL  + HREVIEKKPE FKI CL+D+R LFPD   P YAG+GNRINDV AY+AVGI   RIFT+N +G LK+E  Q + S+ Y N     D +F
Sbjct:  357 SWKWGELPTPEQAKNE--AMSAAQVQQSEHQSMLSNMFSFMKRANRLRKEKGVGEVGDIYLSDLDAGSMDPEMAALYFPSPLSKAASPPEEDGESGNGTSLPHSPSSLEEGQKSIDSDFDETKQQRDNNRYLDFVAMSMCGMSEQGAPPSDEEFDRHLVNYPDVCKSP-SIFSSPNLVVRLNGKYYTWMAACPIVMTMITFQKPLTHDAIEQLMSQTVDGKCLPGDEKQEAVAQADNGGQTKRYWWSWRRSQDAAPNHLNNTHGMPLGKDEKDGDQAAVATQTSRPTSPDITDPTLSKSDSLVNAENTSALVDNLEELTMASNKSDEPKERYKKSLRLSSAAIKKLNLKEGMNEIEFSVTTAYQGTTRCKCYLFRWKHNDKVVISDIDGTITKSDVLGHILPMVGKDWAQLGVAQLFSKIEQNGYKLLYLSARAIGQSRVTREYLRSIRQ-GNVMLPDGPLLLNPTSLISAFHREVIEKKPEQFKIACLSDIRDLFPDK-EPFYAGYGNRINDVWAYRAVGIPIMRIFTINTKGELKHELTQTFQSSGYINQSLEVDEYF 911          
BLAST of Phosphatidate phosphatase LPIN2 vs. Ensembl Zebrafish
Match: zgc:123305 (zgc:123305 [Source:ZFIN;Acc:ZDB-GENE-051120-171])

HSP 1 Score: 353.984 bits (907), Expect = 2.259e-106
Identity = 210/500 (42.00%), Postives = 302/500 (60.40%), Query Frame = 1
Query:  853 DVYLEDIMASGVSDELKRAYL---YTEETKIRTRH---QSNENVTLTVDAGYRSDGEVSVLAISPTYPIIQELKLSLCG--DISVNDNISEETFFQHLVSFEDFIKDPDEXXXXXXXXXXXNGKYYNWGVAAPMILSIIAFKTELPINTVSNLKETYMSQKKRRSTWFSWRRHE----PPNDKKEPVKPEL----SVIPPTPIVENKLTTVDSSEEISTH------------NKVYKKKIRLSSEEVSALNLKEGRNDIVFSMTTKYQGTTCCYATIYRWKWYDKIVISDVDGTITKSDVLGHVLPILGRDWTQAGVVKLYNKIFQNNYRFIYLSARAIGQAGITRTFLQDIVQEFSDKLPEGPILLSPTSLFQSLHREVIEKKPEYFKIQCLNDVRSLFPDSVHPLYAGFGNRINDVIAYKAVGIDPKRIFTVNPEGSLKNEYCQKWSTSYGNLFDVADHFFQFQSVHGISGIDYALEDYIDVNYWSLPINEVDIKEEI 2268
            D+YL+D+  S +  E+   Y      E + +R+ H    S  +  ++  +   ++ +     +S +     ++ +SLCG  DIS    IS+E F +HLV F+DF+ +P  ++++ +LV+ +N KYYNW VAAPMILS+ AF+  LP +T+  L +  M +K  R  WFSWRR +    P N K    + +L    SV  P+ +  +   + D    +S              +++Y+K +RL+SE++ +LNL+EG N +VFS+TT+YQGT  C A IY W + DKI+ISD+DGTITKSD LGH+LP LG+DWT  G+ KLY+KI QN Y+F+Y SARAIG A IT+ +LQ  V +    LP+GP+LL+P+SLF +LHREVIEKKPE FKI CL D+R LF     P YA FGNR ND  AYK VG+    IFTVNP+G L  E  +   +SY +L ++ DHFF     H  +  D    ++    +W  P+  +D++E I
Sbjct:  487 DIYLDDL--SSLDPEVAALYFPKSEAESSDLRSSHGPDPSPPSGQMSPQSQGSANADSGTEYLSDSTSDSLDVTMSLCGRGDIS---QISKEKFMEHLVKFQDFVNNPG-IIEDPNLVICINSKYYNWAVAAPMILSVQAFQKTLPKSTIEQLVKDKMPKKSGR-WWFSWRRKDLNNIPGNPKAGAEESQLEASASVAGPSTLKSSVELSSDEDGSVSVRKNTELMNTAQCISQMYRKSLRLTSEQIESLNLREGANKVVFSVTTQYQGTCRCEAAIYLWSYDDKIIISDIDGTITKSDALGHILPQLGKDWTHHGIAKLYHKIHQNGYKFLYCSARAIGMADITKGYLQ-WVNDRGTVLPKGPVLLAPSSLFSALHREVIEKKPEVFKIACLTDIRDLFSSVTQPFYAAFGNRTNDAYAYKEVGVPETHIFTVNPKGELIREKTKGNKSSYSHLSELVDHFFPLICKHPTTSFD--CPEFSHFTFWRAPLPPLDLQELI 976          

HSP 2 Score: 110.153 bits (274), Expect = 4.519e-24
Identity = 54/114 (47.37%), Postives = 74/114 (64.91%), Query Frame = 1
Query:  142 IKYVYSDINPSTLTGAIDIIVVEQEDGSFTCGPFHVRFGKMGTLKPADKIVDIHLNGVYLENLHMKLGSAGEAYFIETVEPTLSETIDSSFIVSPFHSDSEEVDDSEKTDLSGS 483
            +K +Y  +NP+TLTG ID+IVV Q DGSF C PFHVRFGK+G L+  +K+VDI +NG  + +LHMKLG  GEA+F+E  E      + +    SP  +D  E  +  ++ LS S
Sbjct:   15 VKELYRGLNPATLTGGIDVIVVRQPDGSFQCSPFHVRFGKLGVLRSKEKVVDIEINGEPV-SLHMKLGDNGEAFFVEENE-DFETRVPAHLCTSPIPTDVPEASEVTESQLSCS 126          
BLAST of Phosphatidate phosphatase LPIN2 vs. Ensembl Zebrafish
Match: zgc:123305 (zgc:123305 [Source:ZFIN;Acc:ZDB-GENE-051120-171])

HSP 1 Score: 353.984 bits (907), Expect = 2.259e-106
Identity = 210/500 (42.00%), Postives = 302/500 (60.40%), Query Frame = 1
Query:  853 DVYLEDIMASGVSDELKRAYL---YTEETKIRTRH---QSNENVTLTVDAGYRSDGEVSVLAISPTYPIIQELKLSLCG--DISVNDNISEETFFQHLVSFEDFIKDPDEXXXXXXXXXXXNGKYYNWGVAAPMILSIIAFKTELPINTVSNLKETYMSQKKRRSTWFSWRRHE----PPNDKKEPVKPEL----SVIPPTPIVENKLTTVDSSEEISTH------------NKVYKKKIRLSSEEVSALNLKEGRNDIVFSMTTKYQGTTCCYATIYRWKWYDKIVISDVDGTITKSDVLGHVLPILGRDWTQAGVVKLYNKIFQNNYRFIYLSARAIGQAGITRTFLQDIVQEFSDKLPEGPILLSPTSLFQSLHREVIEKKPEYFKIQCLNDVRSLFPDSVHPLYAGFGNRINDVIAYKAVGIDPKRIFTVNPEGSLKNEYCQKWSTSYGNLFDVADHFFQFQSVHGISGIDYALEDYIDVNYWSLPINEVDIKEEI 2268
            D+YL+D+  S +  E+   Y      E + +R+ H    S  +  ++  +   ++ +     +S +     ++ +SLCG  DIS    IS+E F +HLV F+DF+ +P  ++++ +LV+ +N KYYNW VAAPMILS+ AF+  LP +T+  L +  M +K  R  WFSWRR +    P N K    + +L    SV  P+ +  +   + D    +S              +++Y+K +RL+SE++ +LNL+EG N +VFS+TT+YQGT  C A IY W + DKI+ISD+DGTITKSD LGH+LP LG+DWT  G+ KLY+KI QN Y+F+Y SARAIG A IT+ +LQ  V +    LP+GP+LL+P+SLF +LHREVIEKKPE FKI CL D+R LF     P YA FGNR ND  AYK VG+    IFTVNP+G L  E  +   +SY +L ++ DHFF     H  +  D    ++    +W  P+  +D++E I
Sbjct:  487 DIYLDDL--SSLDPEVAALYFPKSEAESSDLRSSHGPDPSPPSGQMSPQSQGSANADSGTEYLSDSTSDSLDVTMSLCGRGDIS---QISKEKFMEHLVKFQDFVNNPG-IIEDPNLVICINSKYYNWAVAAPMILSVQAFQKTLPKSTIEQLVKDKMPKKSGR-WWFSWRRKDLNNIPGNPKAGAEESQLEASASVAGPSTLKSSVELSSDEDGSVSVRKNTELMNTAQCISQMYRKSLRLTSEQIESLNLREGANKVVFSVTTQYQGTCRCEAAIYLWSYDDKIIISDIDGTITKSDALGHILPQLGKDWTHHGIAKLYHKIHQNGYKFLYCSARAIGMADITKGYLQ-WVNDRGTVLPKGPVLLAPSSLFSALHREVIEKKPEVFKIACLTDIRDLFSSVTQPFYAAFGNRTNDAYAYKEVGVPETHIFTVNPKGELIREKTKGNKSSYSHLSELVDHFFPLICKHPTTSFD--CPEFSHFTFWRAPLPPLDLQELI 976          

HSP 2 Score: 110.153 bits (274), Expect = 4.519e-24
Identity = 54/114 (47.37%), Postives = 74/114 (64.91%), Query Frame = 1
Query:  142 IKYVYSDINPSTLTGAIDIIVVEQEDGSFTCGPFHVRFGKMGTLKPADKIVDIHLNGVYLENLHMKLGSAGEAYFIETVEPTLSETIDSSFIVSPFHSDSEEVDDSEKTDLSGS 483
            +K +Y  +NP+TLTG ID+IVV Q DGSF C PFHVRFGK+G L+  +K+VDI +NG  + +LHMKLG  GEA+F+E  E      + +    SP  +D  E  +  ++ LS S
Sbjct:   15 VKELYRGLNPATLTGGIDVIVVRQPDGSFQCSPFHVRFGKLGVLRSKEKVVDIEINGEPV-SLHMKLGDNGEAFFVEENE-DFETRVPAHLCTSPIPTDVPEASEVTESQLSCS 126          
BLAST of Phosphatidate phosphatase LPIN2 vs. Ensembl Zebrafish
Match: zgc:123305 (zgc:123305 [Source:ZFIN;Acc:ZDB-GENE-051120-171])

HSP 1 Score: 353.984 bits (907), Expect = 3.656e-106
Identity = 210/500 (42.00%), Postives = 302/500 (60.40%), Query Frame = 1
Query:  853 DVYLEDIMASGVSDELKRAYL---YTEETKIRTRH---QSNENVTLTVDAGYRSDGEVSVLAISPTYPIIQELKLSLCG--DISVNDNISEETFFQHLVSFEDFIKDPDEXXXXXXXXXXXNGKYYNWGVAAPMILSIIAFKTELPINTVSNLKETYMSQKKRRSTWFSWRRHE----PPNDKKEPVKPEL----SVIPPTPIVENKLTTVDSSEEISTH------------NKVYKKKIRLSSEEVSALNLKEGRNDIVFSMTTKYQGTTCCYATIYRWKWYDKIVISDVDGTITKSDVLGHVLPILGRDWTQAGVVKLYNKIFQNNYRFIYLSARAIGQAGITRTFLQDIVQEFSDKLPEGPILLSPTSLFQSLHREVIEKKPEYFKIQCLNDVRSLFPDSVHPLYAGFGNRINDVIAYKAVGIDPKRIFTVNPEGSLKNEYCQKWSTSYGNLFDVADHFFQFQSVHGISGIDYALEDYIDVNYWSLPINEVDIKEEI 2268
            D+YL+D+  S +  E+   Y      E + +R+ H    S  +  ++  +   ++ +     +S +     ++ +SLCG  DIS    IS+E F +HLV F+DF+ +P  ++++ +LV+ +N KYYNW VAAPMILS+ AF+  LP +T+  L +  M +K  R  WFSWRR +    P N K    + +L    SV  P+ +  +   + D    +S              +++Y+K +RL+SE++ +LNL+EG N +VFS+TT+YQGT  C A IY W + DKI+ISD+DGTITKSD LGH+LP LG+DWT  G+ KLY+KI QN Y+F+Y SARAIG A IT+ +LQ  V +    LP+GP+LL+P+SLF +LHREVIEKKPE FKI CL D+R LF     P YA FGNR ND  AYK VG+    IFTVNP+G L  E  +   +SY +L ++ DHFF     H  +  D    ++    +W  P+  +D++E I
Sbjct:  515 DIYLDDL--SSLDPEVAALYFPKSEAESSDLRSSHGPDPSPPSGQMSPQSQGSANADSGTEYLSDSTSDSLDVTMSLCGRGDIS---QISKEKFMEHLVKFQDFVNNPG-IIEDPNLVICINSKYYNWAVAAPMILSVQAFQKTLPKSTIEQLVKDKMPKKSGR-WWFSWRRKDLNNIPGNPKAGAEESQLEASASVAGPSTLKSSVELSSDEDGSVSVRKNTELMNTAQCISQMYRKSLRLTSEQIESLNLREGANKVVFSVTTQYQGTCRCEAAIYLWSYDDKIIISDIDGTITKSDALGHILPQLGKDWTHHGIAKLYHKIHQNGYKFLYCSARAIGMADITKGYLQ-WVNDRGTVLPKGPVLLAPSSLFSALHREVIEKKPEVFKIACLTDIRDLFSSVTQPFYAAFGNRTNDAYAYKEVGVPETHIFTVNPKGELIREKTKGNKSSYSHLSELVDHFFPLICKHPTTSFD--CPEFSHFTFWRAPLPPLDLQELI 1004          

HSP 2 Score: 105.916 bits (263), Expect = 1.014e-22
Identity = 47/80 (58.75%), Postives = 61/80 (76.25%), Query Frame = 1
Query:  142 IKYVYSDINPSTLTGAIDIIVVEQEDGSFTCGPFHVRFGKMGTLKPADKIVDIHLNGVYLENLHMKLGSAGEAYFIETVE 381
            +K +Y  +NP+TLTG ID+IVV Q DGSF C PFHVRFGK+G L+  +K+VDI +NG  + +LHMKLG  GEA+F+E  E
Sbjct:   15 VKELYRGLNPATLTGGIDVIVVRQPDGSFQCSPFHVRFGKLGVLRSKEKVVDIEINGEPV-SLHMKLGDNGEAFFVEENE 93          
BLAST of Phosphatidate phosphatase LPIN2 vs. Ensembl Zebrafish
Match: lpin1 (lipin 1 [Source:ZFIN;Acc:ZDB-GENE-080722-2])

HSP 1 Score: 338.191 bits (866), Expect = 2.359e-101
Identity = 195/495 (39.39%), Postives = 285/495 (57.58%), Query Frame = 1
Query:  844 NSKDVYLEDIMASGVSDELKRAYLYTEETKIRTRHQSNENVTLTVDAGYRSDG-EVSVLAISPTYPIIQELKLSLCGDISVNDNISEETFFQHLVSFEDFIKDPDEXXXXXXXXXXXNGKYYNWGVAAPMILSIIAFKTELPINTVSNLKETYMSQKKRRSTWFSWR------RHEPPNDKKEPVKPEL---SVIPPTPIVENKLTTVDSSEEISTHNK----------VYKKKIRLSSEEVSALNLKEGRNDIVFSMTTKYQGTTCCYATIYRWKWYDKIVISDVDGTITKSDVLGHVLPILGRDWTQAGVVKLYNKIFQNNYRFIYLSARAIGQAGITRTFLQDIVQEFSDKLPEGPILLSPTSLFQSLHREVIEKKPEYFKIQCLNDVRSLFPDSVHPLYAGFGNRINDVIAYKAVGIDPKRIFTVNPEGSLKNEYCQKWSTSYGNLFDVADHFFQFQSVHGISGIDYALED-YIDVNYWSLPINEVDIKEE 2265
             S  VYL+DI    +  E+   Y    +     R  ++            S G +  V + S     +  + +SLCG +S N  I+ E F +  +S+++F  +P  ++ + +LV+ +  KYYNW  AAP++L++  F+  LP  TV N+ +  M +K  R  WFSWR      + E   D+ E     +   SV        +       +++I+  N+           Y+K +RLS E++++LNLK+G ND+VFS+TT+YQGT  C  TIY W W DKIVISD+DGTIT+SD LGH+LP LG+DWT  G+ +LY+++ QN Y+F+Y SARAIG A +TR +L   V E    LP GP+LLSP+SLF + HREVIEKKPE FKI+CL D+++LF  +  P YA FGNR  DV +YK VG+   RIFTVNP+G L  E+ +   +SYG L +V DH F    + G +  D+   D +    +W   + EV+ +++
Sbjct:  405 GSDGVYLDDITE--LEPEVAALYFPKSDGATSLRSGADSRSANQSPQSVGSSGMDSGVESFSDQLGDLPHIAISLCGGLSENREITREEFEERAISYQEFADNP-AIIDDPNLVVKIGTKYYNWTTAAPIVLAMQVFQKPLPTATVENIMKEKMPKKGGR-WWFSWRGRNSSSKSESAADQIECGDESIRTGSVSRLKDESSSSEDDSGGAKQIAVMNQPEVLHSSGGHCYRKTLRLSPEQLASLNLKDGPNDVVFSVTTQYQGTCRCEGTIYLWNWDDKIVISDIDGTITRSDTLGHILPTLGKDWTHQGIARLYHRVSQNGYKFMYCSARAIGMADMTRGYLH-WVNERGTMLPMGPVLLSPSSLFSAFHREVIEKKPEKFKIECLTDIKNLFYPNAEPFYAAFGNRATDVYSYKEVGVPLNRIFTVNPKGELIQEHAKTNISSYGRLCEVVDHVFPLL-IRGNT-TDFPCSDTFSQFTFWREQLPEVEKQDQ 892          

HSP 2 Score: 103.219 bits (256), Expect = 7.104e-22
Identity = 54/122 (44.26%), Postives = 75/122 (61.48%), Query Frame = 1
Query:  142 IKYVYSDINPSTLTGAIDIIVVEQEDGSFTCGPFHVRFGKMGTLKPADKIVDIHLNGVYLENLHMKLGSAGEAYFIETVEPTLSETIDSSFIVSPFHSDSEEVDDSEKTDLSGSRLNKKRSR 507
            +K +Y  +NP+TL+G ID+IVV Q DG+  C PFHVRFGKMG L+  +K+VDI +NG  + +LHMKLG  GEA+F++  E    E + S    SP          SE + L  +++ K  SR
Sbjct:   15 VKELYRGLNPATLSGCIDVIVVRQPDGTLQCSPFHVRFGKMGVLRSREKVVDIEINGEPV-SLHMKLGENGEAFFVKETEDD-GEMVPSYLATSPII--------SEGSALMQAQMGKGTSR 126          
BLAST of Phosphatidate phosphatase LPIN2 vs. Ensembl Zebrafish
Match: lpin1 (lipin 1 [Source:ZFIN;Acc:ZDB-GENE-080722-2])

HSP 1 Score: 338.191 bits (866), Expect = 2.457e-101
Identity = 195/495 (39.39%), Postives = 285/495 (57.58%), Query Frame = 1
Query:  844 NSKDVYLEDIMASGVSDELKRAYLYTEETKIRTRHQSNENVTLTVDAGYRSDG-EVSVLAISPTYPIIQELKLSLCGDISVNDNISEETFFQHLVSFEDFIKDPDEXXXXXXXXXXXNGKYYNWGVAAPMILSIIAFKTELPINTVSNLKETYMSQKKRRSTWFSWR------RHEPPNDKKEPVKPEL---SVIPPTPIVENKLTTVDSSEEISTHNK----------VYKKKIRLSSEEVSALNLKEGRNDIVFSMTTKYQGTTCCYATIYRWKWYDKIVISDVDGTITKSDVLGHVLPILGRDWTQAGVVKLYNKIFQNNYRFIYLSARAIGQAGITRTFLQDIVQEFSDKLPEGPILLSPTSLFQSLHREVIEKKPEYFKIQCLNDVRSLFPDSVHPLYAGFGNRINDVIAYKAVGIDPKRIFTVNPEGSLKNEYCQKWSTSYGNLFDVADHFFQFQSVHGISGIDYALED-YIDVNYWSLPINEVDIKEE 2265
             S  VYL+DI    +  E+   Y    +     R  ++            S G +  V + S     +  + +SLCG +S N  I+ E F +  +S+++F  +P  ++ + +LV+ +  KYYNW  AAP++L++  F+  LP  TV N+ +  M +K  R  WFSWR      + E   D+ E     +   SV        +       +++I+  N+           Y+K +RLS E++++LNLK+G ND+VFS+TT+YQGT  C  TIY W W DKIVISD+DGTIT+SD LGH+LP LG+DWT  G+ +LY+++ QN Y+F+Y SARAIG A +TR +L   V E    LP GP+LLSP+SLF + HREVIEKKPE FKI+CL D+++LF  +  P YA FGNR  DV +YK VG+   RIFTVNP+G L  E+ +   +SYG L +V DH F    + G +  D+   D +    +W   + EV+ +++
Sbjct:  405 GSDGVYLDDITE--LEPEVAALYFPKSDGATSLRSGADSRSANQSPQSVGSSGMDSGVESFSDQLGDLPHIAISLCGGLSENREITREEFEERAISYQEFADNP-AIIDDPNLVVKIGTKYYNWTTAAPIVLAMQVFQKPLPTATVENIMKEKMPKKGGR-WWFSWRGRNSSSKSESAADQIECGDESIRTGSVSRLKDESSSSEDDSGGAKQIAVMNQPEVLHSSGGHCYRKTLRLSPEQLASLNLKDGPNDVVFSVTTQYQGTCRCEGTIYLWNWDDKIVISDIDGTITRSDTLGHILPTLGKDWTHQGIARLYHRVSQNGYKFMYCSARAIGMADMTRGYLH-WVNERGTMLPMGPVLLSPSSLFSAFHREVIEKKPEKFKIECLTDIKNLFYPNAEPFYAAFGNRATDVYSYKEVGVPLNRIFTVNPKGELIQEHAKTNISSYGRLCEVVDHVFPLL-IRGNT-TDFPCSDTFSQFTFWREQLPEVEKQDQ 892          

HSP 2 Score: 103.219 bits (256), Expect = 6.924e-22
Identity = 54/122 (44.26%), Postives = 75/122 (61.48%), Query Frame = 1
Query:  142 IKYVYSDINPSTLTGAIDIIVVEQEDGSFTCGPFHVRFGKMGTLKPADKIVDIHLNGVYLENLHMKLGSAGEAYFIETVEPTLSETIDSSFIVSPFHSDSEEVDDSEKTDLSGSRLNKKRSR 507
            +K +Y  +NP+TL+G ID+IVV Q DG+  C PFHVRFGKMG L+  +K+VDI +NG  + +LHMKLG  GEA+F++  E    E + S    SP          SE + L  +++ K  SR
Sbjct:   15 VKELYRGLNPATLSGCIDVIVVRQPDGTLQCSPFHVRFGKMGVLRSREKVVDIEINGEPV-SLHMKLGENGEAFFVKETEDD-GEMVPSYLATSPII--------SEGSALMQAQMGKGTSR 126          
BLAST of Phosphatidate phosphatase LPIN2 vs. Ensembl Xenopus
Match: adamts16 (ADAM metallopeptidase with thrombospondin type 1 motif 16 [Source:Xenbase;Acc:XB-GENE-986244])

HSP 1 Score: 389.423 bits (999), Expect = 9.769e-122
Identity = 266/763 (34.86%), Postives = 393/763 (51.51%), Query Frame = 1
Query:  142 IKYVYSDINPSTLTGAIDIIVVEQEDGSFTCGPFHVRFGKMGTLKPADKIVDIHLNGVYLENLHMKLGSAGEAYFIETVEPTLSETIDSSFIVSPFHSDSEEVDDSEKTDLSGSRLNKKRSRKNVKYKSEFYTQNGLNDESTTAECYNKRYHCLSDNDDFIQDDSAELLREGYNSDGAVDKITKEELNDINMTWDWGNFPLD-SRASSEK---PTETTITVTNESVHTLVNNKPNDLENSKDVYLEDIMASGVSDELKRAYLYTE--ETKIRTRHQSNENVTLTVDAGYRSDGEVSVLAISPTYPII---------------------------------QELKLSLCGDISVNDNISEETFFQHLVSFEDFIKDPDEXXXXXXXXXXXNGKYYNWGVAAPMILSIIAFKTELPINTVSNLKETYMSQKKRRSTWFSWRRHEPPNDKKEPVKPELSVIPPTPIVENKL---------------TTVDSSEEISTHNK----VYKKKIRLSSEEVSALNLKEGRNDIVFSMTTKYQGTTCCYATIYRWKWYDKIVISDVDGTITKSDVLGHVLPILGRDWTQAGVVKLYNKIFQNNYRFIYLSARAIGQAGITRTFLQDIVQEFSDKLPEGPILLSPTSLFQSLHREVIEKKPEYFKIQCLNDVRSLFPDSVHPLYAGFGNRINDVIAYKAVGIDPKRIFTVNPEGSLKNEYCQKWSTSYGNLFDVADHFFQFQSVHGISGIDYALED-YIDVNYWSLPINEVD 2253
            +K +Y  +NP+TL+G ID+IVV Q +G+  C PFHVRFGKMG L+  +K+VDI +NG  ++ LHMKLG  GEA+F+   E    E I S    SP   +   + +S+       R N     +++         + ++  ++ AE  N             + D+   L+   N D + D    E++  I+M+ D    PLD S+  S     P    + +    + +   ++P   ++  ++  + +     + EL   + + E  +   R+RH   + V L  D     D EV+ L     YP +                                   + +SLCG ++ N  I++E F +  V+++ F+ +P  +     ++ + N KYYNW  AAP++L++ AF+  LP  T+  L    M +K  R  WFSWR            K     I  +P    ++                ++ S +   THN      YKK +RL+S+++ +L LK G ND+VFS+TT+YQGT  C  TIY W W DKI+ISD+DGTIT+SD LGH+LP LG+DWT  G+ KLY+K+ QN Y+F+Y SARAIG A +TR +L   V E    LP+GP+LLSP+SLF +LHREVIEKKPE FKI+CL D+++LF  +  P YA FGNR  DV +YK VG+   RIFTVNP+G L  E+ +   +SY  L +V DH F        S  D+   D Y    +W  P+  V+
Sbjct:   15 VKELYRGLNPATLSGCIDVIVVRQPNGNMQCSPFHVRFGKMGVLRSREKVVDIEINGEPVD-LHMKLGDNGEAFFVTEQEEN-EEAIPSHLATSPILLEGAALMESQL------RRNSMDWPRSLDSSDPSQPSSSMHLAASGAE--NLSVKKRRKRRRKSKVDN---LKREDNCDTSED----EDMFTIDMSSDEECDPLDTSKCRSHGRACPLPHVLVLMMFPLLSPPGSRPATPKSDSELVSKPLERGLSTSELPMHWAWGELPQATKRSRHLGADGVYL--DDITCMDPEVAALYFPKRYPRLFNGGRSANQSPQSVGSSGVDSGVESISDGIRDLPSISISLCGGLTDNKEITKEQFIEQAVTYQQFVDNPAIIDDPNLVIKIGN-KYYNWPTAAPLLLAMQAFQKPLPKVTIDTLMRDKMPKKGGR-WWFSWRGRNTNIKSVSSAKCVFLTITWSPRCCFRIKDESSSSDEDPRGAKQSIGSLQSNQTHNSSPGITYKKTLRLTSDQLKSLKLKNGPNDVVFSVTTQYQGTCRCEGTIYLWNWDDKIIISDIDGTITRSDTLGHILPTLGKDWTHQGIAKLYHKVSQNGYKFLYCSARAIGMADMTRGYLH-WVNERGTVLPQGPVLLSPSSLFSALHREVIEKKPEKFKIECLTDIKNLFQPNEEPFYAAFGNRATDVYSYKEVGVSLNRIFTVNPKGELIQEHAKTNISSYVRLCEVVDHIFPLLKRSNSS--DFPCSDIYSHFTFWREPLPPVE 753          
BLAST of Phosphatidate phosphatase LPIN2 vs. Ensembl Xenopus
Match: acy1.1 (aminoacylase 1, gene 1 [Source:Xenbase;Acc:XB-GENE-972681])

HSP 1 Score: 370.933 bits (951), Expect = 1.818e-115
Identity = 259/749 (34.58%), Postives = 385/749 (51.40%), Query Frame = 1
Query:  142 IKYVYSDINPSTLTGAIDIIVVEQEDGSFTCGPFHVRFGKMGTLKPADKIVDIHLNGVYLENLHMKLGSAGEAYFI-ETVEPTLSETI--DSSFIVSPFHSDSEEVDDSEKTDLSGSRLNKKRSRKNVKYK-SEFYTQNGLNDESTTAECYNKRYHCLSDNDDFIQDDSAELLREG--YNSDGAVDKITKEELNDINMTWDWGNFPLDSRASSEKPTETTIT--------VTNESVHTLVNNKPN----------------DLENSKDVYLEDIMASGVSDELKRAYLYTEETKIRTRH----------QSNENVTLTVDAGYRSDGEVSVLAISPTYPIIQELKLSLCGDISVNDNISEETFFQHLVSFEDFIKDPDEXXXXXXXXXXXNGKYYNWGVAAPMILSIIAFKTELPINTVSNLKETYMSQK--KRRSTWFSWRRHEPPNDKKEPVKPELSVIPPTPIVENKLTTVDSSEEISTHNKVYKKKIRLSSEEVSALNLKEGRNDIVFSMTTKYQGTTCCYATIYRWKWYDKIVISDVDGTITKSDVLGHVLPILGRDWTQAGVVKLYNKIFQNNYRFIYLSARAIGQAGITRTFLQDIVQEFSDKLPEGPILLSPTSLFQSLHREVIEKKPEYFKIQCLNDVRSLFPDSVHPLYAGFGNRINDVIAYKAVGIDPKRIFTVNPEGSLKNEYCQKWSTSYGNLFDVADHFFQFQSVHGISGIDYALEDYIDVNYWSLPINEVDIKE 2262
            ++ +Y  IN +TL+G ID+IVV Q DG++ C PFHVRFGK+G L+  +K++DI +NG  + +LHMKLG  GEA+F+ ET E ++S  +     F    F   +    DSE    +G  +   R+   +K+   EF     ++ +  T           S+N  F    S  L+ E    + +G+V  + K E    ++        +D+    E  TE+ I+         + +S+  L   KP+                  +   D+YL+D+    +  E+   Y    E+   +R           QS ++V         +D     L+ SP    + ++ LSLCG +S N  IS+E F +H+++++ F ++P  +     +V + N +YYNW +AAPMILS+  F+  LP +T+    ET++ +K  K+ + W+ WR+                                                    E +  LNL++G ND+VFS+TT+YQGT  C ATIY W W DKI+ISD+DGTITKSD LG +LP LG+DWT  G+ KLY+ I +N Y+F+Y SARAIG A +TR +L   V +    LP GP+LLSP+SLF + HREVIEKKPE FKI+CLND+++LF  +  P YA FGNR NDV AY  VG+   RIFTVNP+G L  E  +   TSY  L ++ +H F        S   +   D+    YW  P+ E+++ +
Sbjct:   15 VRELYKGINQATLSGCIDVIVVRQRDGTYLCSPFHVRFGKLGVLRSKEKVIDIEINGTQV-DLHMKLGDNGEAFFVQETEEESVSVMVYLPYLFFQIGFSQSTGPKSDSELEVKAGESI--LRNEPQMKWTWGEFPESTKVSKKERTDHLRTATI-TPSENTHFRVISSEALVGEADEVSMEGSVCTVLKPEPRPCSI-----GVLMDTDQPPEPVTESGISSPFVPEENFSQDSIQNLPELKPSLKTDSPSKKKGVRKRSQHQGPGDIYLDDLNI--LEPEVAALYFPKSESDPGSRQWIECDPLSGSQSPQSV-----GSAAADSGTECLSDSPMD--LPDVTLSLCGGLSENGEISKEKFKEHVITYQQFSENPGIIDNPNLVVRIYN-RYYNWVLAAPMILSLQVFQKNLPKDTI----ETWVKEKMPKKSARWWFWRK---------------------------------------------------KENMEKLNLRDGPNDVVFSITTQYQGTCRCEATIYLWNWNDKIIISDIDGTITKSDALGQILPQLGKDWTHQGIAKLYHTIHENGYKFLYCSARAIGMADMTRGYLH-WVNDKGTILPRGPLLLSPSSLFSAFHREVIEKKPEKFKIECLNDIKNLFAPNRQPFYAAFGNRPNDVFAYMKVGVPDCRIFTVNPKGELIQERTKGNKTSYSRLSELVEHVFPLLDKEQNSA--FLCPDFSSFCYWREPVPELNMAD 686          
BLAST of Phosphatidate phosphatase LPIN2 vs. Ensembl Xenopus
Match: stxbp2 (syntaxin binding protein 2 [Source:Xenbase;Acc:XB-GENE-947644])

HSP 1 Score: 364.385 bits (934), Expect = 3.455e-112
Identity = 259/755 (34.30%), Postives = 380/755 (50.33%), Query Frame = 1
Query:  130 LISGIKYVYSDINPSTLTGAIDIIVVEQEDGSFTCGPFHVRFGKMGTLKPADKIVDIHLNGVYLENLHMKLGSAGEAYFIETVEPTLSETIDSSFIVSP-FHSDSEEVDDSEKTDLSG-------------SRLNKKRSRKNVKYKSEFYTQNGLNDESTTAECYNKRYHCLSDNDDFIQDDSAELLREGYNSDGAVDKITKE----------ELNDIN-------MTWDWGNFPL---------------DSRASSEKPTETTITVTNESVHTLVN-------------NKPNDLENSKDVYLEDIMASGVSDELKRAYLYTEETKIRTRHQSNENVTLTVDAGYRSDGEVSVLAISPTYPIIQELKLSLCGDISVNDNISEETFFQHLVSFEDFIKDPDEXXXXXXXXXXXNGKYYNWGVAAPMILSIIAFKTELPINTVSNLKETYMSQKKRRSTWFSWRRHE--PPNDKK---EPVKPELSVIPPTPIVENKLTTVDSSEEISTHNKV----YKKKIRLSSEEVSALNLKEGRNDIVFSMTTKYQGTTCCYATIYRWKWYDKIVISDVDGTITKSDVLGHVLPILGRDWTQAGVVKLYNKIFQNNYRFIYLSARAIGQAGITRTFLQDIVQEFSDKLPEGPILLSPTSLFQSLHREVIEKKPEYFKIQCLNDVRSLFPDSVHPLYAGFGNRINDVIAYKAVGIDPKRIFTVNPEGSLKNEYCQKWSTSYGNLFDVADHFFQFQSVHGISGI 2190
            ++  ++ +YS +NP+TL+GAID++VV Q DGSF   PFHVRFGK+G L  A+ +VDI +NG  + +L M+LG  GE +F++ V+   S    S  I  P  H  S  +    +T L+              +   ++R  K    + E  ++  ++DEST   C +  Y   +D    + +D +  L +G   D   +  +            E+  +N       M WDWG  P                 S  S E P      + N+ +  +V              N   DL N       D   S  S E+   +  ++   +    Q+N N    V+    + GE     I+          LSLCG ++ +  I E+ F +H +S+ +F ++P  +     ++ + N KYYNW  AAP+IL +  F  +LP   ++ L +  M   + R  WFSWR+ +  PP  K    E  K E S         N L       E      V    Y++ +RL+SE++  LNL  G ND+VFS+ TK+QGT    A IY W   D+I+ISD+DGT+T+SD LGH+LP LG+DWTQ G+V+LY+ I  N Y F+Y SAR++G A +T+++L   V E    LP GP+LLSP+SLF +LHREVIEK PE FKI CL+D+  LFPD   P +A FGNR NDV+AYK VG+   RIFTVN +G+L  E    + +SY  L ++ +  F   +    S +
Sbjct:   11 VLGRVRELYSGVNPATLSGAIDVVVVRQPDGSFRSSPFHVRFGKLGVLHSAEIVVDIEVNGEPV-DLQMRLGENGEGFFVQEVDRIESTEAPSISITLPTVHQPSTPLLGKNETSLTPKTPKSVHTTPDCDTPTRRQRWVKRKMKRKEDESEGDVDDESTLPAC-DSIYFSFAD----VPEDISHELSKGSFPDSEDEHRSSRSPSPKSDSELEMRPLNSSSSEQCMEWDWGRLPQVSWPDLGHQKTQSAPPSPTSREAPQLPCSELDNKDISPVVTEIREGEPHLSVLENHKEDLSNGPPALAPDTALSPASQEVSLYFPNSDPYPLPPPVQNNGNKDKHVE-DPEALGEPQEACIA----------LSLCGGLAQSWEIPEDWFQKHQISYSEFCQNPSIMEDPRLVLRIQN-KYYNWATAAPIILCMQVFNRQLPQEVINQLTQQKM--PRNRGWWFSWRKRDIGPPVTKPPECEEQKEEAS--------SNGLKEDGDVREAPVAAPVQPLTYQRSLRLTSEQIKRLNLHNGANDVVFSVCTKFQGTCRSRAQIYLWDSEDRIIISDIDGTVTRSDALGHILPQLGKDWTQPGIVRLYHAIHTNGYNFLYCSARSVGLAELTKSYLCG-VNEGGCTLPPGPLLLSPSSLFVALHREVIEKAPERFKISCLSDICQLFPDP-QPFHAAFGNRPNDVLAYKEVGVPESRIFTVNTKGALTQELNPCFKSSYSALSELVNVMFPPTTCRSASAL 735          
BLAST of Phosphatidate phosphatase LPIN2 vs. Ensembl Xenopus
Match: adamts16 (ADAM metallopeptidase with thrombospondin type 1 motif 16 [Source:Xenbase;Acc:XB-GENE-986244])

HSP 1 Score: 328.176 bits (840), Expect = 2.215e-99
Identity = 203/493 (41.18%), Postives = 285/493 (57.81%), Query Frame = 1
Query:  856 VYLEDIMASGVSDELKRAYL--YTEETKIRTRHQSNENVTLT-VDAGYRSDGEVSVLAISPTYPIIQELKLSLCGDISVNDNISEETFFQHLVSFEDFIKDPDEXXXXXXXXXXXNGKYYNWGVAAPMILSIIAFKTELPINTVSNLKETYMSQKKRRSTWFSWRRHEPPNDKKEPVKPELSVIPPTPIVENKLT-------------------TVDSSEEISTHNK----VYKKKIRLSSEEVSALNLKEGRNDIVFSMTTKYQGTTCCYATIYRWKWYDKIVISDVDGTITKSDVLGHVLPILGRDWTQAGVVKLYNKIFQNNYRFIYLSARAIGQAGITRTFLQDIVQEFSDKLPEGPILLSPTSLFQSLHREVIEKKPEYFKIQCLNDVRSLFPDSVHPLYAGFGNRINDVIAYKAVGIDPKRIFTVNPEGSLKNEYCQKWSTSYGNLFDVADHFFQFQSVHGISGIDYALED-YIDVNYWSLPINEVD 2253
            VYL+DI    +  E+   Y      E   R+ +QS ++V  + VD+G        V +IS     +  + +SLCG ++ N  I++E F +  V+++ F+ +P  +     ++ + N KYYNW  AAP++L++ AF+  LP  T+  L    M +K  R  WFSWR       +   +K   SV   TP+  N L+                   ++ S +   THN      YKK +RL+S+++ +L LK G ND+VFS+TT+YQGT  C  TIY W W DKI+ISD+DGTIT+SD LGH+LP LG+DWT  G+ KLY+K+ QN Y+F+Y SARAIG A +TR +L   V E    LP+GP+LLSP+SLF +LHREVIEKKPE FKI+CL D+++LF  +  P YA FGNR  DV +YK VG+   RIFTVNP+G L  E+ +   +SY  L +V DH F        S  D+   D Y    +W  P+  V+
Sbjct:  214 VYLDDITC--MDPEVAALYFPKSVNENGGRSANQSPQSVGSSGVDSG--------VESISDGIRDLPSISISLCGGLTDNKEITKEQFIEQAVTYQQFVDNPAIIDDPNLVIKIGN-KYYNWPTAAPLLLAMQAFQKPLPKVTIDTLMRDKMPKKGGR-WWFSWR------GRNTNIK---SVSSGTPMSLNNLSIRIKDESSSSDEDPRGAKQSIGSLQSNQTHNSSPGITYKKTLRLTSDQLKSLKLKNGPNDVVFSVTTQYQGTCRCEGTIYLWNWDDKIIISDIDGTITRSDTLGHILPTLGKDWTHQGIAKLYHKVSQNGYKFLYCSARAIGMADMTRGYLH-WVNERGTVLPQGPVLLSPSSLFSALHREVIEKKPEKFKIECLTDIKNLFQPNEEPFYAAFGNRATDVYSYKEVGVSLNRIFTVNPKGELIQEHAKTNISSYVRLCEVVDHIFPLLKRSNSS--DFPCSDIYSHFTFWREPLPPVE 682          

HSP 2 Score: 100.523 bits (249), Expect = 4.572e-21
Identity = 48/96 (50.00%), Postives = 64/96 (66.67%), Query Frame = 1
Query:  142 IKYVYSDINPSTLTGAIDIIVVEQEDGSFTCGPFHVRFGKMGTLKPADKIVDIHLNGVYLENLHMKLGSAGEAYFIETVEPTLSETIDSSFIVSPF 429
            +K +Y  +NP+TL+G ID+IVV Q +G+  C PFHVRFGKMG L+  +K+VDI +NG  ++ LHMKLG  GEA+F+   E    E I S    SP 
Sbjct:   15 VKELYRGLNPATLSGCIDVIVVRQPNGNMQCSPFHVRFGKMGVLRSREKVVDIEINGEPVD-LHMKLGDNGEAFFVTEQEEN-EEAIPSHLATSPI 108          
BLAST of Phosphatidate phosphatase LPIN2 vs. Ensembl Xenopus
Match: adamts16 (ADAM metallopeptidase with thrombospondin type 1 motif 16 [Source:Xenbase;Acc:XB-GENE-986244])

HSP 1 Score: 325.479 bits (833), Expect = 3.404e-99
Identity = 200/494 (40.49%), Postives = 280/494 (56.68%), Query Frame = 1
Query:  856 VYLEDIMASGVSDELKRAYLYTEETKIRTRHQSNENVTLTVDAGYRSDG----EVSVLAISPTYPIIQELKLSLCGDISVNDNISEETFFQHLVSFEDFIKDPDEXXXXXXXXXXXNGKYYNWGVAAPMILSIIAFKTELPINTVSNLKETYMSQKKRRSTWFSWRRHEPPNDKKEPVKPELSVIPPTPIVENKLT-------------------TVDSSEEISTHNK----VYKKKIRLSSEEVSALNLKEGRNDIVFSMTTKYQGTTCCYATIYRWKWYDKIVISDVDGTITKSDVLGHVLPILGRDWTQAGVVKLYNKIFQNNYRFIYLSARAIGQAGITRTFLQDIVQEFSDKLPEGPILLSPTSLFQSLHREVIEKKPEYFKIQCLNDVRSLFPDSVHPLYAGFGNRINDVIAYKAVGIDPKRIFTVNPEGSLKNEYCQKWSTSYGNLFDVADHFFQFQSVHGISGIDYALED-YIDVNYWSLPINEVD 2253
            VYL+DI    +  E+   Y              NEN   + +   +S G    +  V +IS     +  + +SLCG ++ N  I++E F +  V+++ F+ +P  +     ++ + N KYYNW  AAP++L++ AF+  LP  T+  L    M +K  R  WFSWR       +   +K   SV   TP+  N L+                   ++ S +   THN      YKK +RL+S+++ +L LK G ND+VFS+TT+YQGT  C  TIY W W DKI+ISD+DGTIT+SD LGH+LP LG+DWT  G+ KLY+K+ QN Y+F+Y SARAIG A +TR +L   V E    LP+GP+LLSP+SLF +LHREVIEKKPE FKI+CL D+++LF  +  P YA FGNR  DV +YK VG+   RIFTVNP+G L  E+ +   +SY  L +V DH F        S  D+   D Y    +W  P+  V+
Sbjct:  131 VYLDDITC--MDPEVAALYFPKSGDTAAPGKSVNENGGRSANQSPQSVGSSGVDSGVESISDGIRDLPSISISLCGGLTDNKEITKEQFIEQAVTYQQFVDNPAIIDDPNLVIKIGN-KYYNWPTAAPLLLAMQAFQKPLPKVTIDTLMRDKMPKKGGR-WWFSWR------GRNTNIK---SVSSGTPMSLNNLSIRIKDESSSSDEDPRGAKQSIGSLQSNQTHNSSPGITYKKTLRLTSDQLKSLKLKNGPNDVVFSVTTQYQGTCRCEGTIYLWNWDDKIIISDIDGTITRSDTLGHILPTLGKDWTHQGIAKLYHKVSQNGYKFLYCSARAIGMADMTRGYLH-WVNERGTVLPQGPVLLSPSSLFSALHREVIEKKPEKFKIECLTDIKNLFQPNEEPFYAAFGNRATDVYSYKEVGVSLNRIFTVNPKGELIQEHAKTNISSYVRLCEVVDHIFPLLKRSNSS--DFPCSDIYSHFTFWREPLPPVE 608          

HSP 2 Score: 99.3673 bits (246), Expect = 8.792e-21
Identity = 47/102 (46.08%), Postives = 67/102 (65.69%), Query Frame = 1
Query:   76 YYFPMQTFKQVISMGRDKLISGIKYVYSDINPSTLTGAIDIIVVEQEDGSFTCGPFHVRFGKMGTLKPADKIVDIHLNGVYLENLHMKLGSAGEAYFIETVE 381
            + F  QT   V  +     ++ +K +Y  +NP+TL+G ID+IVV Q +G+  C PFHVRFGKMG L+  +K+VDI +NG  ++ LHMKLG  GEA+F+   E
Sbjct:   19 FIFQAQTMNYVGQLAGQVFVT-VKELYRGLNPATLSGCIDVIVVRQPNGNMQCSPFHVRFGKMGVLRSREKVVDIEINGEPVD-LHMKLGDNGEAFFVTEQE 118          
BLAST of Phosphatidate phosphatase LPIN2 vs. Ensembl Mouse
Match: Lpin3 (lipin 3 [Source:MGI Symbol;Acc:MGI:1891342])

HSP 1 Score: 367.851 bits (943), Expect = 1.041e-112
Identity = 198/422 (46.92%), Postives = 269/422 (63.74%), Query Frame = 1
Query: 1042 IQELKLSLCGDISVNDNISEETFFQHLVSFEDFIKDPDEXXXXXXXXXXXNGKYYNWGVAAPMILSIIAFKTELPINTVSNLKETYMSQKKRRSTWFSWRRHEPPNDKKEPVKPELSV----------------IPPTPIVENKLTTVDSSEEISTHNKVYKKKIRLSSEEVSALNLKEGRNDIVFSMTTKYQGTTCCYATIYRWKWYDKIVISDVDGTITKSDVLGHVLPILGRDWTQAGVVKLYNKIFQNNYRFIYLSARAIGQAGITRTFLQDIVQEFSDKLPEGPILLSPTSLFQSLHREVIEKKPEYFKIQCLNDVRSLFPDSVHPLYAGFGNRINDVIAYKAVGIDPKRIFTVNPEGSLKNEYCQKWSTSYGNLFDVADHFFQFQSVHGISGIDYALEDYIDVNYWSLPINEVDIK 2259
            + +++LSLCG ++ N +IS E F QH+VS+ED  K+P  LL + +LV+ +N K+YNW VAAPMILS+ AF+  LP +TV  L++  M +K  R  WFSWRR + P ++    + + +                 +P +P++   L           +   YKK +RLSS+++  LNL EG ND+VFS+TT+YQGT  C ATIY W W DK+VISD+DGTITKSD LGH+LP LG+DWT  G+  LY+KI  N Y+F+Y SARAIG A +T+ +LQ  V E    LP+GPILLSP+SLF +LHREVIEKKPE FK+ CL+D++ LF     P +A FGNR NDV AY+ VG+   RIFTVNP G L  E  +   ++Y  L +V +  F    V G S  D A  +Y +++YW  P+  VD +
Sbjct:  432 VDKIELSLCGGLADNRDISLEKFTQHMVSYEDLTKNPG-LLDDPNLVVKINEKHYNWAVAAPMILSLQAFQKNLPESTVDKLEKEKMPRKGGR-WWFSWRRRDFPAEEHSSQREKAATRKQQGEKTEVLSSDDDVPDSPVI---LEVPPLPSSTPGYVPTYKKSLRLSSDQIRCLNLNEGANDVVFSVTTQYQGTCRCKATIYLWNWDDKVVISDIDGTITKSDALGHILPQLGKDWTHQGITSLYHKIHLNGYKFLYCSARAIGMADLTKGYLQ-WVSEHGCGLPKGPILLSPSSLFSALHREVIEKKPEVFKVACLSDIQQLFLPQRQPFHAAFGNRPNDVFAYRQVGLPESRIFTVNPRGELIQELIKSHKSTYQRLGEVVELLFP-PVVRGPS-TDLASPEYSNLSYWRKPLPYVDFE 845          

HSP 2 Score: 105.145 bits (261), Expect = 1.684e-22
Identity = 55/118 (46.61%), Postives = 75/118 (63.56%), Query Frame = 1
Query:  142 IKYVYSDINPSTLTGAIDIIVVEQEDGSFTCGPFHVRFGKMGTLKPADKIVDIHLNGVYLENLHMKLGSAGEAYFI-------ETVEPTLSETIDSSFIVSPFHSDSEEVDDSEKTDL 474
            +K +Y  +NP+TL+G ID++VV Q DGSF C PFHVRFGK+G L+  +K+VDI +NG  + +LHMKLG +GEA+F+       E V P L  +      +S F SDS+    SE   L
Sbjct:   15 VKELYRGLNPATLSGGIDVLVVRQRDGSFRCSPFHVRFGKLGVLRSREKVVDIEINGEPV-DLHMKLGDSGEAFFVQELDSDEEDVPPRLCTSPIPWGGLSGFPSDSQIGTASEPEGL 131          
BLAST of Phosphatidate phosphatase LPIN2 vs. Ensembl Mouse
Match: Lpin3 (lipin 3 [Source:MGI Symbol;Acc:MGI:1891342])

HSP 1 Score: 367.851 bits (943), Expect = 1.041e-112
Identity = 198/422 (46.92%), Postives = 269/422 (63.74%), Query Frame = 1
Query: 1042 IQELKLSLCGDISVNDNISEETFFQHLVSFEDFIKDPDEXXXXXXXXXXXNGKYYNWGVAAPMILSIIAFKTELPINTVSNLKETYMSQKKRRSTWFSWRRHEPPNDKKEPVKPELSV----------------IPPTPIVENKLTTVDSSEEISTHNKVYKKKIRLSSEEVSALNLKEGRNDIVFSMTTKYQGTTCCYATIYRWKWYDKIVISDVDGTITKSDVLGHVLPILGRDWTQAGVVKLYNKIFQNNYRFIYLSARAIGQAGITRTFLQDIVQEFSDKLPEGPILLSPTSLFQSLHREVIEKKPEYFKIQCLNDVRSLFPDSVHPLYAGFGNRINDVIAYKAVGIDPKRIFTVNPEGSLKNEYCQKWSTSYGNLFDVADHFFQFQSVHGISGIDYALEDYIDVNYWSLPINEVDIK 2259
            + +++LSLCG ++ N +IS E F QH+VS+ED  K+P  LL + +LV+ +N K+YNW VAAPMILS+ AF+  LP +TV  L++  M +K  R  WFSWRR + P ++    + + +                 +P +P++   L           +   YKK +RLSS+++  LNL EG ND+VFS+TT+YQGT  C ATIY W W DK+VISD+DGTITKSD LGH+LP LG+DWT  G+  LY+KI  N Y+F+Y SARAIG A +T+ +LQ  V E    LP+GPILLSP+SLF +LHREVIEKKPE FK+ CL+D++ LF     P +A FGNR NDV AY+ VG+   RIFTVNP G L  E  +   ++Y  L +V +  F    V G S  D A  +Y +++YW  P+  VD +
Sbjct:  432 VDKIELSLCGGLADNRDISLEKFTQHMVSYEDLTKNPG-LLDDPNLVVKINEKHYNWAVAAPMILSLQAFQKNLPESTVDKLEKEKMPRKGGR-WWFSWRRRDFPAEEHSSQREKAATRKQQGEKTEVLSSDDDVPDSPVI---LEVPPLPSSTPGYVPTYKKSLRLSSDQIRCLNLNEGANDVVFSVTTQYQGTCRCKATIYLWNWDDKVVISDIDGTITKSDALGHILPQLGKDWTHQGITSLYHKIHLNGYKFLYCSARAIGMADLTKGYLQ-WVSEHGCGLPKGPILLSPSSLFSALHREVIEKKPEVFKVACLSDIQQLFLPQRQPFHAAFGNRPNDVFAYRQVGLPESRIFTVNPRGELIQELIKSHKSTYQRLGEVVELLFP-PVVRGPS-TDLASPEYSNLSYWRKPLPYVDFE 845          

HSP 2 Score: 105.145 bits (261), Expect = 1.684e-22
Identity = 55/118 (46.61%), Postives = 75/118 (63.56%), Query Frame = 1
Query:  142 IKYVYSDINPSTLTGAIDIIVVEQEDGSFTCGPFHVRFGKMGTLKPADKIVDIHLNGVYLENLHMKLGSAGEAYFI-------ETVEPTLSETIDSSFIVSPFHSDSEEVDDSEKTDL 474
            +K +Y  +NP+TL+G ID++VV Q DGSF C PFHVRFGK+G L+  +K+VDI +NG  + +LHMKLG +GEA+F+       E V P L  +      +S F SDS+    SE   L
Sbjct:   15 VKELYRGLNPATLSGGIDVLVVRQRDGSFRCSPFHVRFGKLGVLRSREKVVDIEINGEPV-DLHMKLGDSGEAFFVQELDSDEEDVPPRLCTSPIPWGGLSGFPSDSQIGTASEPEGL 131          
BLAST of Phosphatidate phosphatase LPIN2 vs. Ensembl Mouse
Match: Lpin3 (lipin 3 [Source:MGI Symbol;Acc:MGI:1891342])

HSP 1 Score: 359.762 bits (922), Expect = 1.356e-109
Identity = 198/432 (45.83%), Postives = 269/432 (62.27%), Query Frame = 1
Query: 1042 IQELKLSLCGDISVNDNISEETFFQHLVSFEDFIKDPDEXXXXXXXXXXXNGKYYNWGVAAPMILSIIAFKTELP----------INTVSNLKETYMSQKKRRSTWFSWRRHEPPNDKKEPVKPELSV----------------IPPTPIVENKLTTVDSSEEISTHNKVYKKKIRLSSEEVSALNLKEGRNDIVFSMTTKYQGTTCCYATIYRWKWYDKIVISDVDGTITKSDVLGHVLPILGRDWTQAGVVKLYNKIFQNNYRFIYLSARAIGQAGITRTFLQDIVQEFSDKLPEGPILLSPTSLFQSLHREVIEKKPEYFKIQCLNDVRSLFPDSVHPLYAGFGNRINDVIAYKAVGIDPKRIFTVNPEGSLKNEYCQKWSTSYGNLFDVADHFFQFQSVHGISGIDYALEDYIDVNYWSLPINEVDIK 2259
            + +++LSLCG ++ N +IS E F QH+VS+ED  K+P  LL + +LV+ +N K+YNW VAAPMILS+ AF+  LP           +TV  L++  M +K  R  WFSWRR + P ++    + + +                 +P +P++   L           +   YKK +RLSS+++  LNL EG ND+VFS+TT+YQGT  C ATIY W W DK+VISD+DGTITKSD LGH+LP LG+DWT  G+  LY+KI  N Y+F+Y SARAIG A +T+ +LQ  V E    LP+GPILLSP+SLF +LHREVIEKKPE FK+ CL+D++ LF     P +A FGNR NDV AY+ VG+   RIFTVNP G L  E  +   ++Y  L +V +  F    V G S  D A  +Y +++YW  P+  VD +
Sbjct:  432 VDKIELSLCGGLADNRDISLEKFTQHMVSYEDLTKNPG-LLDDPNLVVKINEKHYNWAVAAPMILSLQAFQKNLPEKELVATIYPQSTVDKLEKEKMPRKGGR-WWFSWRRRDFPAEEHSSQREKAATRKQQGEKTEVLSSDDDVPDSPVI---LEVPPLPSSTPGYVPTYKKSLRLSSDQIRCLNLNEGANDVVFSVTTQYQGTCRCKATIYLWNWDDKVVISDIDGTITKSDALGHILPQLGKDWTHQGITSLYHKIHLNGYKFLYCSARAIGMADLTKGYLQ-WVSEHGCGLPKGPILLSPSSLFSALHREVIEKKPEVFKVACLSDIQQLFLPQRQPFHAAFGNRPNDVFAYRQVGLPESRIFTVNPRGELIQELIKSHKSTYQRLGEVVELLFP-PVVRGPS-TDLASPEYSNLSYWRKPLPYVDFE 855          

HSP 2 Score: 104.76 bits (260), Expect = 1.908e-22
Identity = 55/118 (46.61%), Postives = 75/118 (63.56%), Query Frame = 1
Query:  142 IKYVYSDINPSTLTGAIDIIVVEQEDGSFTCGPFHVRFGKMGTLKPADKIVDIHLNGVYLENLHMKLGSAGEAYFI-------ETVEPTLSETIDSSFIVSPFHSDSEEVDDSEKTDL 474
            +K +Y  +NP+TL+G ID++VV Q DGSF C PFHVRFGK+G L+  +K+VDI +NG  + +LHMKLG +GEA+F+       E V P L  +      +S F SDS+    SE   L
Sbjct:   15 VKELYRGLNPATLSGGIDVLVVRQRDGSFRCSPFHVRFGKLGVLRSREKVVDIEINGEPV-DLHMKLGDSGEAFFVQELDSDEEDVPPRLCTSPIPWGGLSGFPSDSQIGTASEPEGL 131          
BLAST of Phosphatidate phosphatase LPIN2 vs. Ensembl Mouse
Match: Lpin3 (lipin 3 [Source:MGI Symbol;Acc:MGI:1891342])

HSP 1 Score: 353.984 bits (907), Expect = 6.272e-108
Identity = 191/406 (47.04%), Postives = 256/406 (63.05%), Query Frame = 1
Query: 1042 IQELKLSLCGDISVNDNISEETFFQHLVSFEDFIKDPDEXXXXXXXXXXXNGKYYNWGVAAPMILSIIAFKTELPINTVSNLKETYMSQKKRRSTWFSWRRHEPPNDKKEPVKPELSVIPPTPIVENKLTTVDSSEEISTHNKVYKKKIRLSSEEVSALNLKEGRNDIVFSMTTKYQGTTCCYATIYRWKWYDKIVISDVDGTITKSDVLGHVLPILGRDWTQAGVVKLYNKIFQNNYRFIYLSARAIGQAGITRTFLQDIVQEFSDKLPEGPILLSPTSLFQSLHREVIEKKPEYFKIQCLNDVRSLFPDSVHPLYAGFGNRINDVIAYKAVGIDPKRIFTVNPEGSLKNEYCQKWSTSYGNLFDVADHFFQFQSVHGISGIDYALEDYIDVNYWSLPINEVDIK 2259
            + +++LSLCG ++ N +IS E F QH+VS+ED  K+P  LL + +LV+ +N K+YNW VAAPMILS+ AF+  LP ++    K     Q+  ++   S       +D   P  P +  +PP P                 +   YKK +RLSS+++  LNL EG ND+VFS+TT+YQGT  C ATIY W W DK+VISD+DGTITKSD LGH+LP LG+DWT  G+  LY+KI  N Y+F+Y SARAIG A +T+ +LQ  V E    LP+GPILLSP+SLF +LHREVIEKKPE FK+ CL+D++ LF     P +A FGNR NDV AY+ VG+   RIFTVNP G L  E  +   ++Y  L +V +  F    V G S  D A  +Y +++YW  P+  VD +
Sbjct:  432 VDKIELSLCGGLADNRDISLEKFTQHMVSYEDLTKNPG-LLDDPNLVVKINEKHYNWAVAAPMILSLQAFQKNLPEHSSQREKAATRKQQGEKTEVLS-------SDDDVPDSPVILEVPPLP------------SSTPGYVPTYKKSLRLSSDQIRCLNLNEGANDVVFSVTTQYQGTCRCKATIYLWNWDDKVVISDIDGTITKSDALGHILPQLGKDWTHQGITSLYHKIHLNGYKFLYCSARAIGMADLTKGYLQ-WVSEHGCGLPKGPILLSPSSLFSALHREVIEKKPEVFKVACLSDIQQLFLPQRQPFHAAFGNRPNDVFAYRQVGLPESRIFTVNPRGELIQELIKSHKSTYQRLGEVVELLFP-PVVRGPS-TDLASPEYSNLSYWRKPLPYVDFE 814          

HSP 2 Score: 104.76 bits (260), Expect = 2.071e-22
Identity = 55/118 (46.61%), Postives = 75/118 (63.56%), Query Frame = 1
Query:  142 IKYVYSDINPSTLTGAIDIIVVEQEDGSFTCGPFHVRFGKMGTLKPADKIVDIHLNGVYLENLHMKLGSAGEAYFI-------ETVEPTLSETIDSSFIVSPFHSDSEEVDDSEKTDL 474
            +K +Y  +NP+TL+G ID++VV Q DGSF C PFHVRFGK+G L+  +K+VDI +NG  + +LHMKLG +GEA+F+       E V P L  +      +S F SDS+    SE   L
Sbjct:   15 VKELYRGLNPATLSGGIDVLVVRQRDGSFRCSPFHVRFGKLGVLRSREKVVDIEINGEPV-DLHMKLGDSGEAFFVQELDSDEEDVPPRLCTSPIPWGGLSGFPSDSQIGTASEPEGL 131          
BLAST of Phosphatidate phosphatase LPIN2 vs. Ensembl Mouse
Match: Lpin2 (lipin 2 [Source:MGI Symbol;Acc:MGI:1891341])

HSP 1 Score: 348.206 bits (892), Expect = 6.346e-105
Identity = 202/527 (38.33%), Postives = 295/527 (55.98%), Query Frame = 1
Query:  757 SSEKPTETTITVTNESVHTLVNNKPNDLENSKDVYLEDIMASGVSDELKRAYLYTEETKIRTRHQSNENVTLTVDAGYRSDGEVSV----LAISPTYPIIQELKLSLCGDISVNDNISEETFFQHLVSFEDFIKDPDEXXXXXXXXXXXNGKYYNWGVAAPMILSIIAFKTELPINTVSNLKETYMSQKKRRSTWFSWRRHEPPNDKKEPVKPELSVIPPT---------PI----VENKLTTVDSSEEISTHNKV---------------YKKKIRLSSEEVSALNLKEGRNDIVFSMTTKYQGTTCCYATIYRWKWYDKIVISDVDGTITKSDVLGHVLPILGRDWTQAGVVKLYNKIFQNNYRFIYLSARAIGQAGITRTFLQDIVQEFSDKLPEGPILLSPTSLFQSLHREVIEKKPEYFKIQCLNDVRSLFPDSVHPLYAGFGNRINDVIAYKAVGIDPKRIFTVNPEGSLKNEYCQKWSTSYGNLFDVADHFFQFQSVHGISGIDYALEDYIDVNYWSLPI 2241
            S+E P+E      +        +K +  +   D+YL+D+ A  +  E+   Y    +T   +R Q  E+ T +     +S G  +       +S +   + ++ LSLCG +S N  IS+E F +H++++ +F ++P  +     ++ + N +YYNW +AAPMILS+  F+  LP  TV +  +  M +K  R  W+ WR+ E    +    K   S +PP          P      EN  ++ + S+E+    KV               YKK +RLSS++++ L L +G ND+VFS+TT+YQGT  C  TIY W W DK++ISD+DGTITKSD LG +LP LG+DWT  G+ +LY+ I +N Y+F+Y SARAIG A +TR +L   V +    LP GP++LSP+SLF + HREVIEKKPE FKI+CLND+++LF  S  P YA FGNR NDV AY  VG+   RIFTVNP+G L  E  +   +SY  L ++ +H F   S    S   +   ++    YW  PI
Sbjct:  367 SAEAPSEPKPAAKDSPTKKKGVHKRSQHQGPDDIYLDDLKA--LEPEVAALYFPKSDTDPGSR-QWPESDTFSGSQSPQSVGSAAADSGTECLSDSAMDLPDVTLSLCGGLSENGEISKEKFMEHIITYHEFAENPGLIDNPNLVIRIYN-RYYNWALAAPMILSLQVFQKSLPKATVESWVKDKMPKKSGR--WWFWRKKESMIKQLPETKEGKSEVPPANDLPSNAEEPTSARPAENDTSSDEGSQELEESIKVDPITVETLSHCGTASYKKSLRLSSDQIAKLKLHDGPNDVVFSITTQYQGTCRCAGTIYLWNWNDKVIISDIDGTITKSDALGQILPQLGKDWTHQGIARLYHSINENGYKFLYCSARAIGMADMTRGYLH-WVNDKGTILPRGPLMLSPSSLFSAFHREVIEKKPEKFKIECLNDIKNLFAPSRQPFYAAFGNRPNDVYAYTQVGVPDCRIFTVNPKGELIQERTKGNKSSYHRLSELVEHVFPLLSKEQNSA--FPCPEFSSFCYWRDPI 884          

HSP 2 Score: 99.7525 bits (247), Expect = 8.835e-21
Identity = 41/81 (50.62%), Postives = 62/81 (76.54%), Query Frame = 1
Query:  127 KLISGIKYVYSDINPSTLTGAIDIIVVEQEDGSFTCGPFHVRFGKMGTLKPADKIVDIHLNGVYLENLHMKLGSAGEAYFI 369
            +++  +K +Y  IN +TL+G ID++VV Q+DGS+ C PFHVRFGK+G L+  +K++DI +NG  + +LHMKLG  GEA+F+
Sbjct:   10 QVLVTVKELYKGINQATLSGCIDVVVVRQQDGSYQCSPFHVRFGKLGVLRSKEKVIDIEINGSAV-DLHMKLGDNGEAFFV 89          
BLAST of Phosphatidate phosphatase LPIN2 vs. UniProt/SwissProt
Match: sp|Q99PI4|LPIN3_MOUSE (Phosphatidate phosphatase LPIN3 OS=Mus musculus OX=10090 GN=Lpin3 PE=1 SV=1)

HSP 1 Score: 367.851 bits (943), Expect = 7.281e-112
Identity = 198/422 (46.92%), Postives = 269/422 (63.74%), Query Frame = 1
Query: 1042 IQELKLSLCGDISVNDNISEETFFQHLVSFEDFIKDPDEXXXXXXXXXXXNGKYYNWGVAAPMILSIIAFKTELPINTVSNLKETYMSQKKRRSTWFSWRRHEPPNDKKEPVKPELSV----------------IPPTPIVENKLTTVDSSEEISTHNKVYKKKIRLSSEEVSALNLKEGRNDIVFSMTTKYQGTTCCYATIYRWKWYDKIVISDVDGTITKSDVLGHVLPILGRDWTQAGVVKLYNKIFQNNYRFIYLSARAIGQAGITRTFLQDIVQEFSDKLPEGPILLSPTSLFQSLHREVIEKKPEYFKIQCLNDVRSLFPDSVHPLYAGFGNRINDVIAYKAVGIDPKRIFTVNPEGSLKNEYCQKWSTSYGNLFDVADHFFQFQSVHGISGIDYALEDYIDVNYWSLPINEVDIK 2259
            + +++LSLCG ++ N +IS E F QH+VS+ED  K+P  LL + +LV+ +N K+YNW VAAPMILS+ AF+  LP +TV  L++  M +K  R  WFSWRR + P ++    + + +                 +P +P++   L           +   YKK +RLSS+++  LNL EG ND+VFS+TT+YQGT  C ATIY W W DK+VISD+DGTITKSD LGH+LP LG+DWT  G+  LY+KI  N Y+F+Y SARAIG A +T+ +LQ  V E    LP+GPILLSP+SLF +LHREVIEKKPE FK+ CL+D++ LF     P +A FGNR NDV AY+ VG+   RIFTVNP G L  E  +   ++Y  L +V +  F    V G S  D A  +Y +++YW  P+  VD +
Sbjct:  432 VDKIELSLCGGLADNRDISLEKFTQHMVSYEDLTKNPG-LLDDPNLVVKINEKHYNWAVAAPMILSLQAFQKNLPESTVDKLEKEKMPRKGGR-WWFSWRRRDFPAEEHSSQREKAATRKQQGEKTEVLSSDDDVPDSPVI---LEVPPLPSSTPGYVPTYKKSLRLSSDQIRCLNLNEGANDVVFSVTTQYQGTCRCKATIYLWNWDDKVVISDIDGTITKSDALGHILPQLGKDWTHQGITSLYHKIHLNGYKFLYCSARAIGMADLTKGYLQ-WVSEHGCGLPKGPILLSPSSLFSALHREVIEKKPEVFKVACLSDIQQLFLPQRQPFHAAFGNRPNDVFAYRQVGLPESRIFTVNPRGELIQELIKSHKSTYQRLGEVVELLFP-PVVRGPS-TDLASPEYSNLSYWRKPLPYVDFE 845          

HSP 2 Score: 105.145 bits (261), Expect = 1.178e-21
Identity = 55/118 (46.61%), Postives = 75/118 (63.56%), Query Frame = 1
Query:  142 IKYVYSDINPSTLTGAIDIIVVEQEDGSFTCGPFHVRFGKMGTLKPADKIVDIHLNGVYLENLHMKLGSAGEAYFI-------ETVEPTLSETIDSSFIVSPFHSDSEEVDDSEKTDL 474
            +K +Y  +NP+TL+G ID++VV Q DGSF C PFHVRFGK+G L+  +K+VDI +NG  + +LHMKLG +GEA+F+       E V P L  +      +S F SDS+    SE   L
Sbjct:   15 VKELYRGLNPATLSGGIDVLVVRQRDGSFRCSPFHVRFGKLGVLRSREKVVDIEINGEPV-DLHMKLGDSGEAFFVQELDSDEEDVPPRLCTSPIPWGGLSGFPSDSQIGTASEPEGL 131          
BLAST of Phosphatidate phosphatase LPIN2 vs. UniProt/SwissProt
Match: sp|Q7TNN8|LPIN3_MUSSP (Phosphatidate phosphatase LPIN3 OS=Mus spretus OX=10096 GN=Lpin3 PE=2 SV=1)

HSP 1 Score: 367.081 bits (941), Expect = 1.471e-111
Identity = 198/422 (46.92%), Postives = 269/422 (63.74%), Query Frame = 1
Query: 1042 IQELKLSLCGDISVNDNISEETFFQHLVSFEDFIKDPDEXXXXXXXXXXXNGKYYNWGVAAPMILSIIAFKTELPINTVSNLKETYMSQKKRRSTWFSWRRHEPPNDKKEPVKPELSV----------------IPPTPIVENKLTTVDSSEEISTHNKVYKKKIRLSSEEVSALNLKEGRNDIVFSMTTKYQGTTCCYATIYRWKWYDKIVISDVDGTITKSDVLGHVLPILGRDWTQAGVVKLYNKIFQNNYRFIYLSARAIGQAGITRTFLQDIVQEFSDKLPEGPILLSPTSLFQSLHREVIEKKPEYFKIQCLNDVRSLFPDSVHPLYAGFGNRINDVIAYKAVGIDPKRIFTVNPEGSLKNEYCQKWSTSYGNLFDVADHFFQFQSVHGISGIDYALEDYIDVNYWSLPINEVDIK 2259
            + +++LSLCG ++ N +IS E F QH+VS+ED  K+P  LL + +LV+ +N K+YNW VAAPMILS+ AF+  LP +TV  L++  M +K  R  WFSWRR + P ++    + + +                 +P +P++   L           +   YKK +RLSS+++  LNL EG ND+VFS+TT+YQGT  C ATIY W W DK+VISD+DGTITKSD LGH+LP LG+DWT  G+  LY+KI  N Y+F+Y SARAIG A +T+ +LQ  V E    LP+GPILLSP+SLF +LHREVIEKKPE FK+ CL+D++ LF     P +A FGNR NDV AY+ VG+   RIFTVNP G L  E  +   ++Y  L +V +  F    V G S  D A  +Y +++YW  P+  VD +
Sbjct:  431 VDKIELSLCGGLADNRDISLEKFTQHMVSYEDLTKNPG-LLDDPNLVVKINEKHYNWAVAAPMILSMQAFQKNLPESTVDKLEKEKMPRKGGR-WWFSWRRKDFPAEEHSSQREKAATRKQQGEKTEVLSSDDDVPDSPVI---LEVPPLPSSTPGYVPTYKKSLRLSSDQIRCLNLNEGANDVVFSVTTQYQGTCRCKATIYLWNWDDKVVISDIDGTITKSDALGHILPQLGKDWTHQGITSLYHKIHLNGYKFLYCSARAIGMADLTKGYLQ-WVSEHGCGLPKGPILLSPSSLFSALHREVIEKKPEVFKVACLSDIQQLFLPQRQPFHAAFGNRPNDVFAYRQVGLPESRIFTVNPRGELIQELIKSHKSTYQRLGEVVELLFP-PVVRGPS-TDLASPEYSNLSYWRKPLPYVDFE 844          

HSP 2 Score: 104.76 bits (260), Expect = 1.339e-21
Identity = 55/118 (46.61%), Postives = 75/118 (63.56%), Query Frame = 1
Query:  142 IKYVYSDINPSTLTGAIDIIVVEQEDGSFTCGPFHVRFGKMGTLKPADKIVDIHLNGVYLENLHMKLGSAGEAYFI-------ETVEPTLSETIDSSFIVSPFHSDSEEVDDSEKTDL 474
            +K +Y  +NP+TL+G ID++VV Q DGSF C PFHVRFGK+G L+  +K+VDI +NG  + +LHMKLG +GEA+F+       E V P L  +      +S F SDS+    SE   L
Sbjct:   15 VKELYRGLNPATLSGGIDVLVVRQRDGSFRCSPFHVRFGKLGVLRSREKVVDIEINGEPV-DLHMKLGDSGEAFFVQELDSDEEDVPPRLCTSPIPWGGLSGFPSDSQIGTASEPEGL 131          
BLAST of Phosphatidate phosphatase LPIN2 vs. UniProt/SwissProt
Match: sp|Q9BQK8|LPIN3_HUMAN (Phosphatidate phosphatase LPIN3 OS=Homo sapiens OX=9606 GN=LPIN3 PE=1 SV=3)

HSP 1 Score: 362.459 bits (929), Expect = 7.176e-110
Identity = 198/426 (46.48%), Postives = 264/426 (61.97%), Query Frame = 1
Query: 1027 PTYPIIQELKLSLCGDISVNDNISEETFFQHLVSFEDFIKDPDEXXXXXXXXXXXNGKYYNWGVAAPMILSIIAFKTELPINTVSNLKETYMSQKKRRSTWFSWRRHEPPNDKKEPVKPELSV----------------IPPTPIVENKLTTVDSSEEISTHNKVYKKKIRLSSEEVSALNLKEGRNDIVFSMTTKYQGTTCCYATIYRWKWYDKIVISDVDGTITKSDVLGHVLPILGRDWTQAGVVKLYNKIFQNNYRFIYLSARAIGQAGITRTFLQDIVQEFSDKLPEGPILLSPTSLFQSLHREVIEKKPEYFKIQCLNDVRSLFPDSVHPLYAGFGNRINDVIAYKAVGIDPKRIFTVNPEGSLKNEYCQKWSTSYGNLFDVADHFFQFQSVHGISGIDYALEDYIDVNYWSLPINEVDI 2256
            PT   +  + LSLCG ++ + +IS E F QH VS++D  K+P  LL + +LV+ +NGK+YNW VAAPMILS+ AF+  LP +T+  L+   M +K  R  WFSWRR +   +++   K + +                  P +P++   L               YKK +RLSS+++  LNL+EG ND+VFS+TT+YQGT  C ATIY WKW DK+VISD+DGTITKSD LGH+LP LG+DWT  G+  LY+KI  N Y+F+Y SARAIG A +T+ +LQ  V E    LP+GPILLSP+SLF +LHREVIEKKPE FK+ CL+D++ LF     P YA FGNR NDV AY+ VG+   RIFTVNP G L  E  +   ++Y  L +V +    F  V      D A  +Y +  YW  P+  VD+
Sbjct:  430 PTLDTVDTIALSLCGGLADSRDISLEKFNQHSVSYQDLTKNPG-LLDDPNLVVKINGKHYNWAVAAPMILSLQAFQKNLPKSTMDKLEREKMPRKGGR-WWFSWRRRDFLAEERSAQKEKTAAKEQQGEKTEVLSSDDDAPDSPVI---LEIPSLPPSTPPSTPTYKKSLRLSSDQIRRLNLQEGANDVVFSVTTQYQGTCRCKATIYLWKWDDKVVISDIDGTITKSDALGHILPQLGKDWTHQGITSLYHKIQLNGYKFLYCSARAIGMADLTKGYLQ-WVSEGGCSLPKGPILLSPSSLFSALHREVIEKKPEVFKVACLSDIQQLFLPHGQPFYAAFGNRPNDVFAYRQVGLPESRIFTVNPRGELIQELIKNHKSTYERLGEVVE--LLFPPVARGPSTDLANPEYSNFCYWREPLPAVDL 847          

HSP 2 Score: 107.071 bits (266), Expect = 2.986e-22
Identity = 55/119 (46.22%), Postives = 77/119 (64.71%), Query Frame = 1
Query:  142 IKYVYSDINPSTLTGAIDIIVVEQEDGSFTCGPFHVRFGKMGTLKPADKIVDIHLNGVYLENLHMKLGSAGEAYFIETVEPTLSETIDSSFIVSP--------FHSDSEEVDDSEKTDL 474
            +K +Y  +NP+TL+G ID++VV+Q DGSF C PFHVRFGK+G L+  +K+VDI LNG  + +LHMKLG +GEA+F++ +E +  E +      SP        F SDS+    SE   L
Sbjct:   15 VKELYRGLNPATLSGGIDVLVVKQVDGSFRCSPFHVRFGKLGVLRSREKVVDIELNGEPV-DLHMKLGDSGEAFFVQELE-SDDEHVPPGLCTSPIPWGGLSGFPSDSQLGTASEPEGL 131          
BLAST of Phosphatidate phosphatase LPIN2 vs. UniProt/SwissProt
Match: sp|Q92539|LPIN2_HUMAN (Phosphatidate phosphatase LPIN2 OS=Homo sapiens OX=9606 GN=LPIN2 PE=1 SV=1)

HSP 1 Score: 355.14 bits (910), Expect = 1.211e-106
Identity = 208/538 (38.66%), Postives = 307/538 (57.06%), Query Frame = 1
Query:  742 LDSRASSEKPTETTITVTNESVHTLVN-NKPNDLENSKDVYLEDIMASGVSDELKRAYLYTEETKIRTRHQSNENVTLTVDAGYRSDGEVSV----LAISPTYPIIQELKLSLCGDISVNDNISEETFFQHLVSFEDFIKDPDEXXXXXXXXXXXNGKYYNWGVAAPMILSIIAFKTELPINTVSNLKETYMSQKKRRSTWFSWRRHE------PPNDKKEPVKPELSVIPPTP-------IVENKLTTVDSSEEIS-------------THNKV--YKKKIRLSSEEVSALNLKEGRNDIVFSMTTKYQGTTCCYATIYRWKWYDKIVISDVDGTITKSDVLGHVLPILGRDWTQAGVVKLYNKIFQNNYRFIYLSARAIGQAGITRTFLQDIVQEFSDKLPEGPILLSPTSLFQSLHREVIEKKPEYFKIQCLNDVRSLFPDSVHPLYAGFGNRINDVIAYKAVGIDPKRIFTVNPEGSLKNEYCQKWSTSYGNLFDVADHFFQFQSVHGISGIDYALEDYIDVNYWSLPINEVDI 2256
            L + A +E P+E+      +S       +K +  +   D+YL+D+   G+  E+   Y    E++  +R Q  E+ TL+     +S G  +       +S +   + ++ LSLCG +S N  IS+E F +H++++ +F ++P  +     ++ + N +YYNW +AAPMILS+  F+  LP  TV +  +  M +K  R  W+ WR+ E      P + + +   P  S +P +          EN  ++ + S+E+              +H     YKK +RLSS++++ L L +G ND+VFS+TT+YQGT  C  TIY W W DKI+ISD+DGTITKSD LG +LP LG+DWT  G+ KLY+ I +N Y+F+Y SARAIG A +TR +L   V +    LP GP++LSP+SLF + HREVIEKKPE FKI+CLND+++LF  S  P YA FGNR NDV AY  VG+   RIFTVNP+G L  E  +   +SY  L ++ +H F   S    S   +   ++    YW  PI EVD+
Sbjct:  364 LPNAALAEAPSESKPAAKVDSPSKKKGVHKRSQHQGPDDIYLDDL--KGLEPEVAALYFPKSESEPGSR-QWPESDTLSGSQSPQSVGSAAADSGTECLSDSAMDLPDVTLSLCGGLSENGEISKEKFMEHIITYHEFAENPGLIDNPNLVIRIYN-RYYNWALAAPMILSLQVFQKSLPKATVESWVKDKMPKKSGR--WWFWRKRESMTKQLPESKEGKSEAPPASDLPSSSKEPAGARPAENDSSSDEGSQELEESITVDPIPTEPLSHGSTTSYKKSLRLSSDQIAKLKLHDGPNDVVFSITTQYQGTCRCAGTIYLWNWNDKIIISDIDGTITKSDALGQILPQLGKDWTHQGIAKLYHSINENGYKFLYCSARAIGMADMTRGYLH-WVNDKGTILPRGPLMLSPSSLFSAFHREVIEKKPEKFKIECLNDIKNLFAPSKQPFYAAFGNRPNDVYAYTQVGVPDCRIFTVNPKGELIQERTKGNKSSYHRLSELVEHVFPLLSKEQNSA--FPCPEFSSFCYWRDPIPEVDL 892          

HSP 2 Score: 101.679 bits (252), Expect = 1.518e-20
Identity = 43/81 (53.09%), Postives = 63/81 (77.78%), Query Frame = 1
Query:  127 KLISGIKYVYSDINPSTLTGAIDIIVVEQEDGSFTCGPFHVRFGKMGTLKPADKIVDIHLNGVYLENLHMKLGSAGEAYFI 369
            ++I  +K +Y  IN +TL+G ID+IVV+Q+DGS+ C PFHVRFGK+G L+  +K++DI +NG  + +LHMKLG  GEA+F+
Sbjct:   10 QVIVTVKELYKGINQATLSGCIDVIVVQQQDGSYQCSPFHVRFGKLGVLRSKEKVIDIEINGSAV-DLHMKLGDNGEAFFV 89          
BLAST of Phosphatidate phosphatase LPIN2 vs. UniProt/SwissProt
Match: sp|Q99PI5|LPIN2_MOUSE (Phosphatidate phosphatase LPIN2 OS=Mus musculus OX=10090 GN=Lpin2 PE=1 SV=2)

HSP 1 Score: 348.206 bits (892), Expect = 4.439e-104
Identity = 202/527 (38.33%), Postives = 295/527 (55.98%), Query Frame = 1
Query:  757 SSEKPTETTITVTNESVHTLVNNKPNDLENSKDVYLEDIMASGVSDELKRAYLYTEETKIRTRHQSNENVTLTVDAGYRSDGEVSV----LAISPTYPIIQELKLSLCGDISVNDNISEETFFQHLVSFEDFIKDPDEXXXXXXXXXXXNGKYYNWGVAAPMILSIIAFKTELPINTVSNLKETYMSQKKRRSTWFSWRRHEPPNDKKEPVKPELSVIPPT---------PI----VENKLTTVDSSEEISTHNKV---------------YKKKIRLSSEEVSALNLKEGRNDIVFSMTTKYQGTTCCYATIYRWKWYDKIVISDVDGTITKSDVLGHVLPILGRDWTQAGVVKLYNKIFQNNYRFIYLSARAIGQAGITRTFLQDIVQEFSDKLPEGPILLSPTSLFQSLHREVIEKKPEYFKIQCLNDVRSLFPDSVHPLYAGFGNRINDVIAYKAVGIDPKRIFTVNPEGSLKNEYCQKWSTSYGNLFDVADHFFQFQSVHGISGIDYALEDYIDVNYWSLPI 2241
            S+E P+E      +        +K +  +   D+YL+D+ A  +  E+   Y    +T   +R Q  E+ T +     +S G  +       +S +   + ++ LSLCG +S N  IS+E F +H++++ +F ++P  +     ++ + N +YYNW +AAPMILS+  F+  LP  TV +  +  M +K  R  W+ WR+ E    +    K   S +PP          P      EN  ++ + S+E+    KV               YKK +RLSS++++ L L +G ND+VFS+TT+YQGT  C  TIY W W DK++ISD+DGTITKSD LG +LP LG+DWT  G+ +LY+ I +N Y+F+Y SARAIG A +TR +L   V +    LP GP++LSP+SLF + HREVIEKKPE FKI+CLND+++LF  S  P YA FGNR NDV AY  VG+   RIFTVNP+G L  E  +   +SY  L ++ +H F   S    S   +   ++    YW  PI
Sbjct:  367 SAEAPSEPKPAAKDSPTKKKGVHKRSQHQGPDDIYLDDLKA--LEPEVAALYFPKSDTDPGSR-QWPESDTFSGSQSPQSVGSAAADSGTECLSDSAMDLPDVTLSLCGGLSENGEISKEKFMEHIITYHEFAENPGLIDNPNLVIRIYN-RYYNWALAAPMILSLQVFQKSLPKATVESWVKDKMPKKSGR--WWFWRKKESMIKQLPETKEGKSEVPPANDLPSNAEEPTSARPAENDTSSDEGSQELEESIKVDPITVETLSHCGTASYKKSLRLSSDQIAKLKLHDGPNDVVFSITTQYQGTCRCAGTIYLWNWNDKVIISDIDGTITKSDALGQILPQLGKDWTHQGIARLYHSINENGYKFLYCSARAIGMADMTRGYLH-WVNDKGTILPRGPLMLSPSSLFSAFHREVIEKKPEKFKIECLNDIKNLFAPSRQPFYAAFGNRPNDVYAYTQVGVPDCRIFTVNPKGELIQERTKGNKSSYHRLSELVEHVFPLLSKEQNSA--FPCPEFSSFCYWRDPI 884          

HSP 2 Score: 99.7525 bits (247), Expect = 6.180e-20
Identity = 41/81 (50.62%), Postives = 62/81 (76.54%), Query Frame = 1
Query:  127 KLISGIKYVYSDINPSTLTGAIDIIVVEQEDGSFTCGPFHVRFGKMGTLKPADKIVDIHLNGVYLENLHMKLGSAGEAYFI 369
            +++  +K +Y  IN +TL+G ID++VV Q+DGS+ C PFHVRFGK+G L+  +K++DI +NG  + +LHMKLG  GEA+F+
Sbjct:   10 QVLVTVKELYKGINQATLSGCIDVVVVRQQDGSYQCSPFHVRFGKLGVLRSKEKVIDIEINGSAV-DLHMKLGDNGEAFFV 89          
BLAST of Phosphatidate phosphatase LPIN2 vs. TrEMBL
Match: A0A430QID9 (Phosphatidate phosphatase LPIN OS=Schistosoma bovis OX=6184 GN=DC041_0010566 PE=4 SV=1)

HSP 1 Score: 542.732 bits (1397), Expect = 1.403e-177
Identity = 314/708 (44.35%), Postives = 434/708 (61.30%), Query Frame = 1
Query:  112 SMGRDKLISGIKYVYSDINPSTLTGAIDIIVVEQEDGSFTCGPFHVRFGKMGTLKPADKIVDIHLNGVYLENLHMKLGSAGEAYFIETVEPTLSETIDSSFIVSPFHSDSEEVDDSEKTDLSGSRLNKKRSRKNVKYKSEFYTQNGLNDESTTAECYNKRYHCLSDNDDFIQDDSAELLREGYNSDG---AVDKITKEELNDI--NMTWDWGNFPLDSRASSEKPTETTITVTNESVHTLVNNKPNDLENSKDVYLEDIMASGVSDELKRAYLYT-EETKIRTRHQSNENVTLT--VDAGYRSDGEVSVLAISPTYPIIQELKLSLCGDISVNDNISEETFFQHLVSFEDFIKDPDEXXXXXXXXXXXNGKYYNWGVAAPMILSIIAFKTELPINTVSNLKETYMSQKK-RRSTWFSWRRHEPPNDKKEPVKPELSVIPPTPIVENKLTTVDSSEEISTHNKVYKKKIRLSSEEVSALNLKEGRNDIVFSMTTKYQGTTCCYATIYRWKWYDKIVISDVDGTITKSDVLGHVLPILGRDWTQAGVVKLYNKIFQNNYRFIYLSARAIGQAGITRTFLQDIVQEFSDKLPEGPILLSPTSLFQSLHREVIEKKPEYFKIQCLNDVRSLFPDSVHPLYAGFGNRINDVIAYKAVGIDPKRIFTVNPEGSLKNEYCQKWSTSYGNLFDVADHFF----QFQSVHGISGIDY 2196
            S+GR  L+SGIK  Y+DINP+TLTGAID+IVVEQ+DGSFTCGPFHVRFGK+    P DK V++++NG +++ L M LGSAG+AYF+++       T D      P        DDS  +++   R ++K  R +    SE  T++    E     C    Y   SD +     D     R+  NS G     D    E L D   N ++DW       R SS      +  V + +   + +    +  + K+VYLE+++ S V   +K  Y+Y      I ++ Q + N T +  VD GYRSD E S  ++SP +P    L+LSLCG +S ++  SE  F +H+VS+E+FI+DP+ +L N +LV+  NG+Y NW V AP I+S++AF+T+LP  T+  L+  Y+ +K+ RR++WFSW   +        V P   V     + E +L +     ++ T ++V K   RLSS EVS L LK GRNDI F +TTKYQGT  C A+IY W WYDKIV+SDVDGTIT+SD+LGH+LP++GRDWT +GV +LYN++  N Y+F+YLSARA+GQAGITR++L+ +VQ+ S +LP+GPILLSP SL  + H+EVI  KPE FK +CL DV  LFP    PLYAGFGN++NDV AY+  GI+  RIFTVNP G ++NEY    STSY  L D+ D  F    ++Q+ H    +DY
Sbjct:    5 SLGR--LLSGIKGAYNDINPATLTGAIDVIVVEQKDGSFTCGPFHVRFGKLTAFSPTDKAVEVYVNGEFVDFLQMSLGSAGDAYFVDSS----GSTTDEFLTADPNDCPGFTYDDSW-SEIPVRRHSRKVRRDSAM--SEPGTESNSIKEDIDELC-GTSYEVSSDCE--ASSDRLRDCRKCRNSVGDKFGSDSQLDESLKDTVSNYSYDWNLTKYQPRGSS------SCVVKDVTKSDVQDPHLKNFTHEKEVYLEELVTSEVDQNIKEVYIYPPSHGNIPSQCQGSCNTTDSNCVDYGYRSDNEHSPRSMSPIHPHDLSLRLSLCGGLSSDNPCSEGKFVEHIVSYEEFIRDPNTILSNPNLVVYFNGRYCNWQVTAPSIVSLLAFQTQLPYLTLQKLENQYLPKKQSRRTSWFSWGASQTQTVATNSVIPAKEV---DNVEEKRLDSSSQPPQVHTTHRVTKIN-RLSSSEVSRLKLKPGRNDIEFRVTTKYQGTCTCSASIYYWHWYDKIVVSDVDGTITRSDLLGHLLPMVGRDWTHSGVARLYNRVKNNGYQFLYLSARALGQAGITRSYLRQVVQDSSSRLPDGPILLSPNSLLHAFHQEVIINKPEVFKTKCLQDVCCLFPKGSSPLYAGFGNKVNDVFAYQKAGIELCRIFTVNPRGEVRNEYQSLRSTSYHELGDLVDLHFPPLCKYQTTHIPHPVDY 690          
BLAST of Phosphatidate phosphatase LPIN2 vs. TrEMBL
Match: A0A183NJ86 (LNS2 domain-containing protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS2172 PE=4 SV=1)

HSP 1 Score: 540.806 bits (1392), Expect = 7.754e-177
Identity = 308/710 (43.38%), Postives = 440/710 (61.97%), Query Frame = 1
Query:  112 SMGRDKLISGIKYVYSDINPSTLTGAIDIIVVEQEDGSFTCGPFHVRFGKMGTLKPADKIVDIHLNGVYLENLHMKLGSAGEAYFIETVEPTLSETIDSSFIVSPFHSDSEEVDDSEKTDLSGSRLNKKRSRKNVKYKSEFYTQNGLNDESTTAECYNKRYHCLSD---NDDFIQDD--SAELLREGYNSDGAVDKITKEELNDINMTWDWGNFPLDSRASSEKPTETTITVTNESVHTLVNNKPN--DLENSKDVYLEDIMASGVSDELKRAYLYT-EETKIRTRHQSNENVTLT--VDAGYRSDGEVSVLAISPTYPIIQELKLSLCGDISVNDNISEETFFQHLVSFEDFIKDPDEXXXXXXXXXXXNGKYYNWGVAAPMILSIIAFKTELPINTVSNLKETYMSQKK-RRSTWFSWRRHEPPNDKKEPVKPELSVIPPTPIVENKLTTVDSSEEISTHNKVYKKKIRLSSEEVSALNLKEGRNDIVFSMTTKYQGTTCCYATIYRWKWYDKIVISDVDGTITKSDVLGHVLPILGRDWTQAGVVKLYNKIFQNNYRFIYLSARAIGQAGITRTFLQDIVQEFSDKLPEGPILLSPTSLFQSLHREVIEKKPEYFKIQCLNDVRSLFPDSVHPLYAGFGNRINDVIAYKAVGIDPKRIFTVNPEGSLKNEYCQKWSTSYGNLFDVADHFF----QFQSVHGISGIDY 2196
            S+GR  L+SGIK  Y+DINP+TLTGAID+IVVEQ+DGSFTCGPF+VRFGK+    P DK V++++NG +++ L M LGSAG+AYF+++       T D      P        DDS  T++   R ++K  R +    SE  T++ L  E     C    Y   SD   + D ++D       + + + SD  +D+  K+ +++ +  W+  N+         +P  ++  V  +   + V   P+  +  + K+VYLE+++ S V   +K  Y+Y        ++ Q + N T +  VD GYRSD E S  ++SP +P    L+LSLCG +S ++  SE  F +H+VS+E+FI+DP+ +L N +LV+  NG+Y NW V AP I+S++AF+T+LP  T+  L+  Y+ +K+ RR++WFSW   +        V P   V     + E +L +     ++S   K+     RLSS EVS L LK GRNDI F +TTKYQGT  C A+IY W+W+DKIV+SDVDGTIT+SD+LGH+LP++GRDWT  GV +LYN++  N Y+F+YLSARA+GQAGITR++L+ +VQ+ S +LP+GPILLSP SL  + H+EVI  KPE FK +CL DV  LFP    PLYAGFGN++NDV AY+  GI+  RIFTVNP G ++NEY    STSY  L D+ D  F    ++Q+ H    +DY
Sbjct:    5 SLGR--LLSGIKGAYNDINPATLTGAIDVIVVEQKDGSFTCGPFYVRFGKLTAFSPTDKAVEVYVNGEFVDFLQMSLGSAGDAYFVDSS----GSTTDEFLTADPNDCPGFTYDDSW-TEIPVRRHSRKVRRDSAM--SEPGTESNLIKEDIDELC-GTSYEVSSDCEASSDRLRDSRKCRNSVGDKFGSDSQLDESLKDTVSNYSYDWNLANY---------QPRGSSSCVVKDVTKSDVVRDPHLKNFTHEKEVYLEELVTSEVDQNIKEVYIYPPSHGNFPSQCQGSCNTTDSNCVDYGYRSDNEHSPRSMSPIHPHDLSLRLSLCGGLSSDNPCSEGKFVEHIVSYEEFIRDPNTILSNPNLVIYFNGRYCNWQVTAPSIVSLLAFQTQLPYLTLQKLENQYLPKKQSRRTSWFSWGASQTRTVATNSVIPAKEV---DNVEEKRLDSSSQPPQVSLVTKIN----RLSSSEVSRLKLKPGRNDIEFRVTTKYQGTCTCSASIYYWRWHDKIVVSDVDGTITRSDLLGHLLPMVGRDWTHPGVARLYNRVQNNGYQFLYLSARALGQAGITRSYLRQVVQDSSSRLPDGPILLSPNSLLHAFHQEVIINKPEVFKTKCLQDVCCLFPKGSSPLYAGFGNKVNDVFAYQKAGIELCRIFTVNPRGEVRNEYQSLRSTSYHELGDLVDLHFPPLCKYQTTHIPHPVDY 688          
BLAST of Phosphatidate phosphatase LPIN2 vs. TrEMBL
Match: A0A183AZE8 (LNS2 domain-containing protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS12333 PE=4 SV=1)

HSP 1 Score: 541.576 bits (1394), Expect = 9.100e-177
Identity = 323/727 (44.43%), Postives = 441/727 (60.66%), Query Frame = 1
Query:  112 SMGRDKLISGIKYVYSDINPSTLTGAIDIIVVEQEDGSFTCGPFHVRFGKMGTLKPADKIVDIHLNGVYLENLHMKLGSAGEAYFIETVEPTLSETIDSSFIVSPFHSDSEEVDDSEKTDLSGSRLNKKRSRKNVKYKSEFYTQNGLNDESTTAECYNKRYHCLSD--NDDFIQDDSAEL---------LREGYNSDGAVDKITKEELNDI--NMTWDWGNFPLDSRASSEKPTETTITVTNESVHT----------LVNNKPNDLENSKDVYLEDIMASGVSDELKRAYLYTEETKIRTR--------HQSNENVTLTVDAGYRSDGEVSVLAISPTYPIIQELKLSLCGDISVNDNISEETFFQHLVSFEDFIKDPDEXXXXXXXXXXXNGKYYNWGVAAPMILSIIAFKTELPINTVSNLKETYMSQKK-RRSTWFSW--RRHEPPNDKKEPVKPELSVIPP---------TPIVENKLTTVDSSEEISTHNKVYKKKIRLSSEEVSALNLKEGRNDIVFSMTTKYQGTTCCYATIYRWKWYDKIVISDVDGTITKSDVLGHVLPILGRDWTQAGVVKLYNKIFQNNYRFIYLSARAIGQAGITRTFLQDIVQEFSDKLPEGPILLSPTSLFQSLHREVIEKKPEYFKIQCLNDVRSLFPDSVHPLYAGFGNRINDVIAYKAVGIDPKRIFTVNPEGSLKNEYCQKWSTSYGNLFDVADHFFQF 2163
            S+GR  + SGIK  Y+DINPSTLTGAID+IVVEQ DG++ CGP +VRFGK+  + PADK+V++++NG Y++ L M+LG+AG+AYF++                    SD+   DD EK     S   + R   N+K+      +        +A         + D  +DD I+ DS +L         L   Y SDG +     + LN I  +++W +G   L  R+  + PT        ++ HT            +NKPN L+   +VYLED++ S +   +K  Y+Y       +         H+S   V  +VDAGYRSDGE S  ++SP YP I  LKLSLCG  S++  IS+E F +HLVSFE+FI DP+ +L N +L + LN KY  W +AAP I+SI+A++TELP  TV +L+  + S+K+ RR++WFSW  RR E  +  +  +   +++            TP   N     D  +   TH+ +  KK RLS+ ++S LNLK+GRND+ F +TTKYQGT  C A+I+ W W D+IVISDVDGTIT+SD+LGH+LP+LG DWT  GV  LY++I +N YRF+YLSARA+GQAGITR++L+ +VQE   KLP+GPILLSP SL  +LH+EVIEKKPE FKI+CL+DV +LFP    PLYAGFGN++NDV AY+  GI+  RIFTVNP G L+NEY    STSY  L +  D  F  
Sbjct:    6 SLGR--IFSGIKGAYNDINPSTLTGAIDVIVVEQPDGTYECGPLYVRFGKLTAISPADKVVEVYVNGRYVDFLRMRLGAAGDAYFVD--------------------SDACSSDD-EKYPTGDS---ESRRVANIKWPESVTRRRRRKVRRDSAMSEPDSPTLIDDLNDDDAIRSDSEQLDVTEHDRSNLLNHYGSDGFL----IDSLNSIGEDLSWAYGGL-LHRRSECQPPTFKKSESIPDTGHTDSPKIFENEDKKDNKPNPLKKD-EVYLEDLVTSEMDPTVKETYIYPPTHHNYSGVSRSDNFLHRSAAEVN-SVDAGYRSDGEQSPRSLSPIYPSIYGLKLSLCGSPSMDAQISDEKFVEHLVSFEEFIHDPEAILSNPNLTVQLNNKYMCWPLAAPSIISILAYQTELPHRTVRHLESVHQSKKQTRRTSWFSWGSRRAEAEDHDETKIAETVALPEVVEEPVVVMDTPRTINDNPDHDEKKTPKTHSTL--KKNRLSTSDISRLNLKKGRNDLEFRVTTKYQGTCICSASIFLWHWSDRIVISDVDGTITRSDLLGHLLPMLGHDWTHDGVACLYDRIARNGYRFVYLSARALGQAGITRSYLRHVVQE-ELKLPDGPILLSPNSLLHALHQEVIEKKPENFKIKCLSDVTALFPKGCQPLYAGFGNKVNDVFAYEQAGIERCRIFTVNPRGELRNEYHSVKSTSYRELIESVDLHFPL 696          
BLAST of Phosphatidate phosphatase LPIN2 vs. TrEMBL
Match: A0A183L137 (LNS2 domain-containing protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS21037 PE=4 SV=1)

HSP 1 Score: 540.806 bits (1392), Expect = 9.697e-177
Identity = 313/708 (44.21%), Postives = 433/708 (61.16%), Query Frame = 1
Query:  112 SMGRDKLISGIKYVYSDINPSTLTGAIDIIVVEQEDGSFTCGPFHVRFGKMGTLKPADKIVDIHLNGVYLENLHMKLGSAGEAYFIETVEPTLSETIDSSFIVSPFHSDSEEVDDSEKTDLSGSRLNKKRSRKNVKYKSEFYTQNGLNDESTTAECYNKRYHCLSDNDDFIQDDSAELLREGYNSDG---AVDKITKEELNDI--NMTWDWGNFPLDSRASSEKPTETTITVTNESVHTLVNNKPNDLENSKDVYLEDIMASGVSDELKRAYLYT-EETKIRTRHQSNENVTLT--VDAGYRSDGEVSVLAISPTYPIIQELKLSLCGDISVNDNISEETFFQHLVSFEDFIKDPDEXXXXXXXXXXXNGKYYNWGVAAPMILSIIAFKTELPINTVSNLKETYMSQKK-RRSTWFSWRRHEPPNDKKEPVKPELSVIPPTPIVENKLTTVDSSEEISTHNKVYKKKIRLSSEEVSALNLKEGRNDIVFSMTTKYQGTTCCYATIYRWKWYDKIVISDVDGTITKSDVLGHVLPILGRDWTQAGVVKLYNKIFQNNYRFIYLSARAIGQAGITRTFLQDIVQEFSDKLPEGPILLSPTSLFQSLHREVIEKKPEYFKIQCLNDVRSLFPDSVHPLYAGFGNRINDVIAYKAVGIDPKRIFTVNPEGSLKNEYCQKWSTSYGNLFDVADHFF----QFQSVHGISGIDY 2196
            S+GR  L+SGIK  Y+DINP+TLTGAID+IVVEQ+DGSFTCGPFHVRFGK+    P DK V++++NG +++ L M LGSAG+AYF+++       T D      P        DDS  +++   R ++K  R +    SE  T++    E     C    Y   SD +     D     R+  NS G     D    E L D   N ++DW       R SS      +  V + +   + +    +  + K+VYLE+++ S V   +K  Y+Y        ++ Q + N T +  VD GYRSD E S  ++SP +P    L+LSLCG +S ++  SE  F +H+VS+E+FI+DP+ +L N +LV+  NG+Y NW V AP I+S++AF+T+LP  T+  L+  Y+ +K+ RR++WFSW   +        V P   V     + E +L +     ++ T ++V K   RLSS EVS L LK GRNDI F +TTKYQGT  C A+IY W WYDKIV+SDVDGTIT+SD+LGH+LP++GRDWT +GV +LYN++  N Y+F+YLSARA+GQAGITR++L+ +VQ+ S +LP+GPILLSP SL  + H+EVI  KPE FK +CL DV  LFP    PLYAGFGN++NDV AY+  GI+  RIFTVNP G ++NEY    STSY  L D+ D  F    ++Q+ H    +DY
Sbjct:    5 SLGR--LLSGIKGAYNDINPATLTGAIDVIVVEQKDGSFTCGPFHVRFGKLTAFSPTDKAVEVYVNGEFVDFLQMSLGSAGDAYFVDSS----GSTTDEFLTADPNDCPGFTYDDSW-SEIPVRRHSRKVRRDSAM--SEPGTESNSIKEDIDELC-GTSYEVSSDCE--ASSDRLRDCRKCRNSVGDKFGSDSQLDESLKDTVSNYSYDWNLTKYQPRGSS------SCVVKDVTKSDVQDPHLKNFTHEKEVYLEELVTSEVDQNIKEVYIYPPSHGNFPSQCQGSCNTTDSNCVDYGYRSDNEHSPRSMSPIHPHDLSLRLSLCGGLSSDNPCSEGKFVEHIVSYEEFIRDPNTILSNPNLVVYFNGRYCNWQVTAPSIVSLLAFQTQLPYLTLQKLENQYLPKKQSRRTSWFSWGASQTRTVATNSVIPAKEV---DNVEEKRLDSSSQPPQVHTTHRVTKIN-RLSSSEVSRLKLKPGRNDIEFRVTTKYQGTCTCSASIYYWHWYDKIVVSDVDGTITRSDLLGHLLPMVGRDWTHSGVARLYNRVKNNGYQFLYLSARALGQAGITRSYLRQVVQDSSSRLPDGPILLSPNSLLHAFHQEVIINKPEVFKTKCLQDVCCLFPKGSSPLYAGFGNKVNDVFAYQKAGIELCRIFTVNPRGEVRNEYQSLRSTSYHELGDLVDLHFPPLCKYQTTHIPHPVDY 690          
BLAST of Phosphatidate phosphatase LPIN2 vs. TrEMBL
Match: G4V8V6 (Putative lipin OS=Schistosoma mansoni OX=6183 GN=Smp_147940.2 PE=4 SV=1)

HSP 1 Score: 540.806 bits (1392), Expect = 1.148e-176
Identity = 312/711 (43.88%), Postives = 437/711 (61.46%), Query Frame = 1
Query:  112 SMGRDKLISGIKYVYSDINPSTLTGAIDIIVVEQEDGSFTCGPFHVRFGKMGTLKPADKIVDIHLNGVYLENLHMKLGSAGEAYFIETVEPTLSETIDSSFIVSPFHSDSEEVDDSEKTDLSGSRLNKKRSRKNVKYKSEFYTQNGLNDESTTAECYNKRYHCLSDNDDFIQDDSAELLREGYNSDG---AVDKITKEELNDI--NMTWDWGNFPLDSRASSEKPTETTITVTNESVHTLVNNKPN--DLENSKDVYLEDIMASGVSDELKRAYLYTEETKI---RTRHQSNENVTLTVDAGYRSDGEVSVLAISPTYPIIQELKLSLCGDISVNDNISEETFFQHLVSFEDFIKDPDEXXXXXXXXXXXNGKYYNWGVAAPMILSIIAFKTELPINTVSNLKETYMSQKK-RRSTWFSWRRHEPPNDKKEPVKPELSVIPPTPIVENKLTTVDSSEEISTHNKVYKKKI-RLSSEEVSALNLKEGRNDIVFSMTTKYQGTTCCYATIYRWKWYDKIVISDVDGTITKSDVLGHVLPILGRDWTQAGVVKLYNKIFQNNYRFIYLSARAIGQAGITRTFLQDIVQEFSDKLPEGPILLSPTSLFQSLHREVIEKKPEYFKIQCLNDVRSLFPDSVHPLYAGFGNRINDVIAYKAVGIDPKRIFTVNPEGSLKNEYCQKWSTSYGNLFDVADHFF----QFQSVHGISGIDY 2196
            S+GR  L+SGIK  Y+DINP+TLTGAID+IVV+ +DGSFTCGPFHVRFGK+    P DK V++++NG +++ L M LGSAG+AYF++      S +    F+ +      E   D   ++LS  R ++K  R +    SE  T++ L  E     C    Y   SD +  I  D     R+ +NS G   A D    E L D   N ++DW         +   P +++  V  +   + V  +P+     + K+VYLE+++ + V   +K  Y+Y     I   + +   N + +  VD GYRSD E S  ++SP Y     L+LSLCG +S ++  SE  F +H+VS+E+FI+DP+ +L N +LV+  NG+Y NW VAAP I+S++AF+T+LP  T+  L+  Y+ +K+ RR++WFSW   +        V P   V       E +L +  SS+    H      KI RLSS EV+ LNLK GRNDI F +TTKYQGT  C A+IY W WYDKIV+SDVDGTIT+SD+LGH+LP++GRDWT +GV +LYN++  N Y+F+YLSARA+GQAGITR++L+ +VQ+ + +LP+GPILLSP SL  + H+EVI  KPE FK +CL DV  LFP    PLYAGFGN++NDV AY+  GI+  RIFT+NP G ++NEY    STSY  L D+ D  F    ++++ H    +DY
Sbjct:    5 SLGR--LLSGIKGAYNDINPATLTGAIDVIVVQHKDGSFTCGPFHVRFGKLTAFSPTDKTVEVYVNGEFVDFLQMSLGSAGDAYFVD-----CSSSATDEFLTTDPDDCPEFTYDDSWSELSVRRHSRKVRRDSAM--SEPGTESNLIKEDIDELC-GTSYEVSSDCEASI--DRVRDSRKCWNSVGDKFASDSQLDESLKDTVSNYSYDWN-------LTKYHPRDSSSRVVKDVTKSDVVREPHLKSFTHEKEVYLEELVTAEVDQNIKEVYIYPPSHGIFPPQCQGSYNTSDSNCVDYGYRSDNEHSPRSMSPVYAHDLSLRLSLCGGLSSDNPCSEGKFVEHIVSYEEFIRDPNAILSNPNLVVYFNGRYCNWQVAAPSIVSLLAFQTQLPYLTLQKLENQYLPKKQSRRTSWFSWGASQTRTAATNSVIPAKEV---DNAEEKRLDSSSSSQPPQVHTTHRVNKINRLSSSEVARLNLKPGRNDIEFRITTKYQGTCTCSASIYYWHWYDKIVVSDVDGTITRSDLLGHLLPMVGRDWTHSGVARLYNRVQNNGYQFLYLSARALGQAGITRSYLRQVVQDSASRLPDGPILLSPNSLLHAFHQEVIINKPEVFKTKCLQDVCCLFPKGSSPLYAGFGNKVNDVFAYQKAGIELCRIFTINPRGEVRNEYQSLRSTSYHELGDLVDLHFPPLCKYRTTHIPHPVDY 693          
BLAST of Phosphatidate phosphatase LPIN2 vs. Ensembl Cavefish
Match: LPIN2 (lipin 2 [Source:HGNC Symbol;Acc:HGNC:14450])

HSP 1 Score: 428.328 bits (1100), Expect = 6.387e-136
Identity = 283/834 (33.93%), Postives = 412/834 (49.40%), Query Frame = 1
Query:  127 KLISGIKYVYSDINPSTLTGAIDIIVVEQEDGSFTCGPFHVRFGKMGTLKPADKIVDIHLNGVYLENLHMKLGSAGEAYFIETVEPTLSETIDSSFIVSPFHS-----------------DSEEVDDSE--------------------KTDLSGSRLNKKRSRKNVKYKSEFYTQNGLNDESTTAECYNKRYH------CLSDNDDFIQD-DSAELLREGYNSDGAVDKITKEELNDINMTWDWGNFPLDSRASSEKPTETTITVTNESVHTLVNNKPNDLENSKDVYLEDIMAS------------------------GVSDELKRA----------YLYTEETKIRTRHQSNE--------------------------NVTLTVDAGYRS---------DGEVSVLAISPTYPIIQELKLSLCGDISVNDNISEETFFQHLVSFEDFIKDPDEXXXXXXXXXXXNGKYYNWGVAAPMILSIIAFKTELPINTVSNLKETYMSQKKRRSTWFSWRRHEPPNDKKEPVKP-----ELSVIPPTPIVENKLTTVDSSE----EISTHNKVYKKKIRLSSEEVSALNLKEGRNDIVFSMTTKYQGTTCCYATIYRWKWYDKIVISDVDGTITKSDVLGHVLPILGRDWTQAGVVKLYNKIFQNNYRFIYLSARAIGQAGITRTFLQDIVQEFSDKLPEGPILLSPTSLFQSLHREVIEKKPEYFKIQCLNDVRSLFPDSVHPLYAGFGNRINDVIAYKAVGIDPKRIFTVNPEGSLKNEYCQKWSTSYGNLFDVADHFFQFQSVHGISGIDYALEDYIDVNYWSLPINEVDIKE 2262
            +++  ++ +Y  +N +TL+G ID++VV+Q DGSF C PFHVRFGK+G L+  +K++DI +NGV ++ LHMKLG  GEA+F++    T  ETI +  + SP  +                 DS   +D E                    K + S +  N       +K    F+     +   +TAE      H       LSD D   ++ +  E      +S+ AV        N  +M W WG  P   +  S KP+E+T        H  V N    +    DV ++ ++                               + R           ++Y E  + R++HQ  E                          N  L V +G +S         D     L+ SP    +  + LSLCG +  N ++++E F +H+V+++ F  +P  +     +V + N +YYNW +AAP+ILS+ AF+  LP        +  M +K  R  W+ WR+ +   +     KP     +++    T     +L T   +E    E   H   YKK +RLSS+++++L LKEG ND+VFS+TT+YQGT  C  TIY W W DKIVISD+DGTITKSDVLG  LP LG+DWT  G+ KLY+ I +N Y+F+Y SARAIG AG+TR +L   V +    LP GP++LSP+SLF + HREVIEKKPE FKI+CL D+++LFP +  P YA FGNR NDV AYK V +   RIFTVNP+G +  E  +   TSY  L ++ DH F        +   + L ++    YW  PI +V ++E
Sbjct:   10 QVLVTVRELYKGLNQATLSGCIDVVVVQQPDGSFQCSPFHVRFGKLGVLRSREKVIDIEVNGVPVD-LHMKLGDNGEAFFVQE---TKQETIPAHLVTSPIPTEEPVFWGRDSRVSESCLDSRVTEDGENGVVKKKKRRRRKHKTTEQKKEEQSSASANLPNVNFMLKLCCCFFNVCRASPSFSTAELRQNLPHRHLDSYPLSDGDWSTENRNVPEPSSPKSDSELAVRFSESVMRNHSHMQWSWGELPEPLKTVSIKPSEST--------HFRVINNTETVAAGTDVIVQPVIVKPQPRTPVPQLQPHTSSSNSKSSSPDSPGPVGRGRLPVCVPHTVFVYDEGVRKRSQHQGPEDIYLDDLTALEPHVAARYFPKRKKYINSILCVCSGSQSPQSVGSAAADSGTECLSDSPVD--LPAVSLSLCGGLGDNAHVNKEKFLEHIVTYQQFADNPAIIDNPNLVVRIDN-RYYNWTLAAPLILSMQAFQKNLPKAAEDAWVKDKMPKKTNR--WWFWRKIDSSVNSHVSFKPFFLLRQVAADSSTDEDSKELNTAALAECTQKEGQAHTHSYKKSLRLSSDQIASLGLKEGPNDVVFSITTQYQGTCRCEGTIYLWHWNDKIVISDIDGTITKSDVLGQFLPQLGKDWTHRGIAKLYHTIHENGYKFLYCSARAIGMAGMTRGYLH-WVNDRGTILPRGPLMLSPSSLFSAFHREVIEKKPEKFKIECLTDIKNLFPPNSQPFYAAFGNRSNDVFAYKHVHVPTCRIFTVNPKGEVIQELTKGNKTSYSRLSELVDHVFPLADKKQCAA--FVLPEFSSFCYWRQPIAQVCLEE 823          
BLAST of Phosphatidate phosphatase LPIN2 vs. Ensembl Cavefish
Match: lpin1 (lipin 1 [Source:ZFIN;Acc:ZDB-GENE-080722-2])

HSP 1 Score: 349.747 bits (896), Expect = 6.976e-109
Identity = 202/482 (41.91%), Postives = 287/482 (59.54%), Query Frame = 1
Query:  844 NSKDVYLEDIMASGVSDELKRAYLY---TEETKIRTRHQSNENVTLT-VDAGYRSDGEVSVLAISPTYPIIQELKLSLCGDISVNDNISEETFFQHLVSFEDFIKDPDEXXXXXXXXXXXNGKYYNWGVAAPMILSIIAFKTELPINTVSNLKETYMSQKKRRSTWFSWRRHEPP----NDKKEPVKPELSVIPPTPIVENKLTTVDSSEEISTHNKVYKKKIRLSSEEVSALNLKEGRNDIVFSMTTKYQGTTCCYATIYRWKWYDKIVISDVDGTITKSDVLGHVLPILGRDWTQAGVVKLYNKIFQNNYRFIYLSARAIGQAGITRTFLQDIVQEFSDKLPEGPILLSPTSLFQSLHREVIEKKPEYFKIQCLNDVRSLFPDSVHPLYAGFGNRINDVIAYKAVGIDPKRIFTVNPEGSLKNEYCQKWSTSYGNLFDVADHFFQFQSVHGISGIDYALEDYIDVNYWSLPINEVDIKEE 2265
             S  VYL+D+       E + A LY   + + K R+ +QS ++V  + +D+G        V   S     +  + +SLCG ++ N  I E  F +  +S++DF+ +P  ++ + +LV+ +  KYYNW  AAP++L++  F+  LP   V N+ +  M +K  R  WFSWR          D+      +      TP    K          S  +  Y+K +RLSSE++++L LKEG ND+VFS+TT+YQGT  C  TIY WKW DK+VISD+DGTIT+SD LGH+LP LG+DWT  G+ +LY+K+ QN Y+F+Y SARAIG AG+TR +L   V E    LP+GP+LLSP+SLF +LHREVIEKKPE FKI+CL D+++LF  ++ P YA FGNR  DV +YK VG+   RIFTVNP+G L  E+ +   +SYG L +V DH F    + G +      + Y    YW   + E+D  E+
Sbjct:  125 GSDGVYLDDL----TELEPEVAALYFPKSSDNKPRSANQSPQSVGSSGMDSG--------VDTFSEHLGDLPNIAISLCGGLTENQEIKE--FQERAISYQDFVDNP-AIIDDPNLVVKIGTKYYNWSTAAPLMLAMQVFQKPLPKAAVENIMKEKMPKKGGR-WWFSWRGETAALSRLKDESSSSDEDNRTAEQTPPCAQK------QHPHSPASICYRKTLRLSSEQLASLQLKEGPNDVVFSVTTQYQGTCRCEGTIYLWKWDDKLVISDIDGTITRSDTLGHILPTLGKDWTHQGIARLYHKVSQNGYKFMYCSARAIGMAGMTRGYLH-WVNERGTMLPQGPVLLSPSSLFSALHREVIEKKPEKFKIECLTDIKNLFHPNIEPFYAAFGNRATDVYSYKEVGVPLNRIFTVNPKGELIQEHAKTNISSYGRLCEVVDHVFPLL-LRGNTSDFPCCDTYSQFTYWREQLPELDKPEQ 582          
BLAST of Phosphatidate phosphatase LPIN2 vs. Ensembl Cavefish
Match: LPIN2 (lipin 2 [Source:HGNC Symbol;Acc:HGNC:14450])

HSP 1 Score: 352.443 bits (903), Expect = 2.261e-107
Identity = 207/528 (39.20%), Postives = 292/528 (55.30%), Query Frame = 1
Query:  772 TETTITVTNESVHTLVN-----NKPNDLENSKDVYLEDIMASGVSDELKRAYL-------YTEETKIRTRHQSNENV-TLTVDAGYR--SDGEVSVLAISPTYPIIQELKLSLCGDISVNDNISEETFFQHLVSFEDFIKDPDEXXXXXXXXXXXNGKYYNWGVAAPMILSIIAFKTELPINTVSNLKETYMSQKKRRSTWFSWRRHEPPNDKKEPVKPELSVIPP----TPIVENKLTTVDSSE------------EISTHNKVYKKKIRLSSEEVSALNLKEGRNDIVFSMTTKYQGTTCCYATIYRWKWYDKIVISDVDGTITKSDVLGHVLPILGRDWTQAGVVKLYNKIFQNNYRFIYLSARAIGQAGITRTFLQDIVQEFSDKLPEGPILLSPTSLFQSLHREVIEKKPEYFKIQCLNDVRSLFPDSVHPLYAGFGNRINDVIAYKAVGIDPKRIFTVNPEGSLKNEYCQKWSTSYGNLFDVADHFFQFQSVHGISGIDYALEDYIDVNYWSLPINEVDIKE 2262
            +E  + V     H   N      K +  +  +D+YL+D+ A  +   +   Y          EE  + +  QS ++V +   D+G    SD  V + A+S          LSLCG +  N ++++E F +H+V+++ F  +P  +     +V + N +YYNW +AAP+ILS+ AF+  LP        +  M +K  R  W+ WR+      K E  +       P      +  +  T  DS E            E   H   YKK +RLSS+++++L LKEG ND+VFS+TT+YQGT  C  TIY W W DKIVISD+DGTITKSDVLG  LP LG+DWT  G+ KLY+ I +N Y+F+Y SARAIG AG+TR +L   V +    LP GP++LSP+SLF + HREVIEKKPE FKI+CL D+++LFP +  P YA FGNR NDV AYK V +   RIFTVNP+G +  E  +   TSY  L ++ DH F        +   + L ++    YW  PI +V ++E
Sbjct:  305 SEAHVNVKGSDPHIFPNKHQSVRKRSQHQGPEDIYLDDLTA--LEPHVAARYFPKSETVGQCEEVCVCSGSQSPQSVGSAAADSGTECLSDSPVDLPAVS----------LSLCGGLGDNAHVNKEKFLEHIVTYQQFADNPAIIDNPNLVVRIDN-RYYNWTLAAPLILSMQAFQKNLPKAAEDAWVKDKMPKKTNR--WWFWRKSSTRQRKTEAKRDSHVSFKPFFLLRQVAADSSTDEDSKELNTAALAECTQKEGQAHTHSYKKSLRLSSDQIASLGLKEGPNDVVFSITTQYQGTCRCEGTIYLWHWNDKIVISDIDGTITKSDVLGQFLPQLGKDWTHRGIAKLYHTIHENGYKFLYCSARAIGMAGMTRGYLH-WVNDRGTILPRGPLMLSPSSLFSAFHREVIEKKPEKFKIECLTDIKNLFPPNSQPFYAAFGNRSNDVFAYKHVHVPTCRIFTVNPKGEVIQELTKGNKTSYSRLSELVDHVFPLADKKQCAA--FVLPEFSSFCYWRQPIAQVCLEE 814          

HSP 2 Score: 114.005 bits (284), Expect = 2.162e-25
Identity = 85/321 (26.48%), Postives = 150/321 (46.73%), Query Frame = 1
Query:  127 KLISGIKYVYSDINPSTLTGAIDIIVVEQEDGSFTCGPFHVRFGKMGTLKPADKIVDIHLNGVYLENLHMKLGSAGEAYFIETVEPTLSETIDSSFIVSPFHS-----------------DSEEVDDSEKTDLSGSRLNKKRSRKNVKYKSEFYTQNGLNDESTTAECYNKRYHCLSDNDDFIQDDSAELLREGYNSDGAVDKITKEELNDINMTWDWGNFPLDSRASSE---KPTETTITVTNESVHTLVNNKPNDLENSKDVYLEDIMASGVSDELKRAYLYTEETKIRTRHQSNENVTLTVDAGYRSDGEVSVLAISP 1029
            +++  ++ +Y  +N +TL+G ID++VV+Q DGSF C PFHVRFGK+G L+  +K++DI +NGV + +LHMKLG  GEA+F++  +   +ETI +  + SP  +                 DS   +D E   +   +  +++ +   + K E  + +  +  + T      R H +     F   +  E      +S+ AV        N  +M W WG  P  ++ S     +P +T     +ES H  V N    +    DV ++ ++   V  + +      +   ++  HQ+  +      A +RS+  V+V    P
Sbjct:   10 QVLVTVRELYKGLNQATLSGCIDVVVVQQPDGSFQCSPFHVRFGKLGVLRSREKVIDIEVNGVPV-DLHMKLGDNGEAFFVQETK-QANETIPAHLVTSPIPTEEPVFWGRDSRVSESCLDSRVTEDGENGVVKKKKRRRRKHKTTEQKKEEQSSASSNSSHALTL----IRTHTIMFLVCFFSRNVPEPSSPKSDSELAVRFSESVMRNHSHMQWSWGELPEATKFSCRDWPEPLKTVSIKPSESTHFRVINNTETVAAGTDVIVQPVI---VKPQPRTPVPQLQPHTVKPEHQTQPH-----PASHRSEAHVNVKGSDP 316          
BLAST of Phosphatidate phosphatase LPIN2 vs. Ensembl Cavefish
Match: lpin1 (lipin 1 [Source:ZFIN;Acc:ZDB-GENE-080722-2])

HSP 1 Score: 350.517 bits (898), Expect = 3.804e-106
Identity = 188/426 (44.13%), Postives = 264/426 (61.97%), Query Frame = 1
Query: 1042 IQELKLSLCGDISVNDNISEETFFQHLVSFEDFIKDPDEXXXXXXXXXXXNGKYYNWGVAAPMILSIIAFKTELPINTVSNLKETYMSQKKRRSTWFSWRRH-EPPNDKKEPVKPELSVIPPTPIVENKLTTVDSSEE-----------------ISTHNKVYKKKIRLSSEEVSALNLKEGRNDIVFSMTTKYQGTTCCYATIYRWKWYDKIVISDVDGTITKSDVLGHVLPILGRDWTQAGVVKLYNKIFQNNYRFIYLSARAIGQAGITRTFLQDIVQEFSDKLPEGPILLSPTSLFQSLHREVIEKKPEYFKIQCLNDVRSLFPDSVHPLYAGFGNRINDVIAYKAVGIDPKRIFTVNPEGSLKNEYCQKWSTSYGNLFDVADHFFQFQSVHGISGIDYALEDYIDVNYWSLPINEVDIKEE 2265
            +  + +SLCG ++ N  IS E F +  +S++DF+ +P  ++ + +LV+ +  KYYNW  AAP++L++  F+  LP   V N+ +  M +K  R  WFSWR   E   D+ E  +  +  I      +       SS+E                  S  +  Y+K +RLSSE++++L LKEG ND+VFS+TT+YQGT  C  TIY WKW DK+VISD+DGTIT+SD LGH+LP LG+DWT  G+ +LY+K+ QN Y+F+Y SARAIG AG+TR +L   V E    LP+GP+LLSP+SLF +LHREVIEKKPE FKI+CL D+++LF  ++ P YA FGNR  DV +YK VG+   RIFTVNP+G L  E+ +   +SYG L +V DH F    + G +      + Y    YW   + E+D  E+
Sbjct:  451 LPNIAISLCGGLTENQEISREEFQERAISYQDFVDNP-AIIDDPNLVVKIGTKYYNWSTAAPLMLAMQVFQKPLPKAAVENIMKEKMPKKGGR-WWFSWRGETESAADQVESDEHNVLNIVGCWFCKRLKDESSSSDEDNRTAEQTPPCAQKQHPHSPASICYRKTLRLSSEQLASLQLKEGPNDVVFSVTTQYQGTCRCEGTIYLWKWDDKLVISDIDGTITRSDTLGHILPTLGKDWTHQGIARLYHKVSQNGYKFMYCSARAIGMAGMTRGYLH-WVNERGTMLPQGPVLLSPSSLFSALHREVIEKKPEKFKIECLTDIKNLFHPNIEPFYAAFGNRATDVYSYKEVGVPLNRIFTVNPKGELIQEHAKTNISSYGRLCEVVDHVFPLL-LRGNTSDFPCCDTYSQFTYWREQLPELDKPEQ 872          

HSP 2 Score: 105.531 bits (262), Expect = 1.015e-22
Identity = 50/107 (46.73%), Postives = 71/107 (66.36%), Query Frame = 1
Query:  142 IKYVYSDINPSTLTGAIDIIVVEQEDGSFTCGPFHVRFGKMGTLKPADKIVDIHLNGVYLENLHMKLGSAGEAYFIETVEPTLSETIDSSFIVSPFHSDSEEVDDSE 462
            +K +Y  +NP+TL+G ID+IVV Q DGS  C PFHVRFGKMG L+  +K+VDI +NG  + +LHMKLG  GEA+F++  E  + E +      SP  +D   + +S+
Sbjct:   15 VKELYRGLNPATLSGCIDVIVVRQPDGSLQCSPFHVRFGKMGVLRSREKVVDIEINGEPV-SLHMKLGENGEAFFVKETESDM-EMVPPYLATSPIITDGSALMESQ 119          
BLAST of Phosphatidate phosphatase LPIN2 vs. Ensembl Cavefish
Match: lpin2 (phosphatidate phosphatase LPIN2-like [Source:NCBI gene;Acc:103030941])

HSP 1 Score: 342.043 bits (876), Expect = 7.851e-103
Identity = 190/500 (38.00%), Postives = 287/500 (57.40%), Query Frame = 1
Query:  841 ENSKDVYLEDIMASGVSDELKRAYLYTEETKIRTRH----------QSNENV-TLTVDAGYRSDGEVSVLAISPTYPIIQELKLSLCGDISVNDNISEETFFQHLVSFEDFIKDPDEXXXXXXXXXXXNGKYYNWGVAAPMILSIIAFKTELPINTVSNLKETYMSQKKRRSTWFSWRR------------------HEPPNDKKEPVKPELSVIPPTPIVENKLTTVDSSEEISTHNKVYKKKIRLSSEEVSALNLKEGRNDIVFSMTTKYQGTTCCYATIYRWKWYDKIVISDVDGTITKSDVLGHVLPILGRDWTQAGVVKLYNKIFQNNYRFIYLSARAIGQAGITRTFLQDIVQEFSDKLPEGPILLSPTSLFQSLHREVIEKKPEYFKIQCLNDVRSLFPDSVHPLYAGFGNRINDVIAYKAVGIDPKRIFTVNPEGSLKNEYCQKWSTSYGNLFDVADHFFQFQSVHGISGIDYALEDYIDVNYWSLPINEVD 2253
            +  +D+YL+D+    +  ++   Y    E++  ++H          QS ++V +   D+G           +S +   + ++ LSLCG +S N  IS+E F +H++++ +F ++P  +     +V + N +YYNW +AAP+ILS+ AF+  LP  T     +  M +K  R  W+ WR+                  HE   +       E   +        +    +   + STH+  Y+K +RLSS+++++L LKEG ND++FS+TT+YQGT  C  TIY W W DK++ISD+DGTITKSDV G +LP LG+DWT  G+ KLY+ + +N Y+F+Y SARAIG A +TR +LQ  V +    LP GP++LSP+SLF + HREVIEKKPE FKI+CL D+++LF  + HP YA FGNR NDV AYK VG+   RIFTVNP+G L  E  +   +SY  L ++ +H F   S    S  ++   ++    +W  PI E++
Sbjct:  404 QGPEDIYLDDLNV--LEPDVAARYFPKSESEAASKHWIDSGTHSGSQSPQSVGSAAADSGTE--------CLSDSASDLPDVTLSLCGGLSENAEISKEKFMEHIITYHEFAENPAIIDNPNLVVKIAN-RYYNWALAAPLILSLQAFQKNLPKATEEAWVKERMPKKSGR--WWFWRKRADSTIKQVMLRIIDIMSHESYANVDSSSDEEGKEVSAAAASLERSAQTEPQPQPSTHS--YRKSLRLSSDQIASLKLKEGPNDVMFSITTQYQGTCRCEGTIYLWNWDDKVIISDIDGTITKSDVFGQILPQLGKDWTHQGIAKLYHSVAENGYKFLYCSARAIGMADMTRGYLQ-WVNDGGTILPRGPLMLSPSSLFSAFHREVIEKKPEIFKIECLTDIKNLFYPNKHPFYAAFGNRTNDVFAYKEVGVPVCRIFTVNPKGELIQEQTKGNKSSYSRLSELVEHVFPLVSKEQSSAFNFP--EFSTFCFWRQPIPEMN 885          

HSP 2 Score: 101.679 bits (252), Expect = 1.541e-21
Identity = 45/104 (43.27%), Postives = 72/104 (69.23%), Query Frame = 1
Query:  127 KLISGIKYVYSDINPSTLTGAIDIIVVEQEDGSFTCGPFHVRFGKMGTLKPADKIVDIHLNGVYLENLHMKLGSAGEAYFIETVEPTLSETIDSSFIVSPFHSD 438
            +++  +K +Y  IN +TL+G ID++VV Q+DG++ C PFHVRFGK+G L+  +K++DI +NG  +E LHMKLG  GEA+F++  E   +E + +    SP  ++
Sbjct:   10 QVLVTVKELYKGINQATLSGCIDVVVVRQKDGTYQCSPFHVRFGKLGVLRSKEKVIDIEINGEPVE-LHMKLGDNGEAFFVQETE-VQNEVVPAHLATSPIPTE 111          
BLAST of Phosphatidate phosphatase LPIN2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006569.1 (pep scaffold:Pmarinus_7.0:GL488977:141:7536:-1 gene:ENSPMAG00000005929.1 transcript:ENSPMAT00000006569.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.4185 bits (202), Expect = 8.157e-17
Identity = 46/100 (46.00%), Postives = 63/100 (63.00%), Query Frame = 1
Query: 1051 LKLSLCGDISVNDNISEETFFQHLVSFEDFIKDPDEXXXXXXXXXXXNGKYYNWGVAAPMILSIIAFKTELPINTVSNLKETYMSQKKRRSTWFSWRRHE 1350
            + LSLCG ++ + NIS+E F  H VSF+ F+++P  +     +VL+ N KYYNW VAAPM+LS+ AF   LP   V  L +  M +K  R  WFSWRR +
Sbjct:  317 VALSLCGGLAESCNISQEKFEAHRVSFQQFLENPALIDDLNLVVLIGN-KYYNWAVAAPMLLSMQAFHKPLPKLAVEALMKEKMPKKSNR-WWFSWRRRD 414          
BLAST of Phosphatidate phosphatase LPIN2 vs. Ensembl Yeast
Match: PAH1 (Mg2+-dependent phosphatidate (PA) phosphatase; dephosphorylates PA to yield diacylglycerol; regulates phospholipid synthesis, nuclear/ER membrane growth, lipid droplet formation, triacylglycerol synthesis, vacuolar homeostasis and cell wall integrity; phosphorylated by Pho85p/Pho80p, Cdc28p/Cyclin B, PKA, PKC, and CKII, regulating activity, localization, and proteosomal degradation; homolog of mammalian lipins 1 and 2; human homologs LPIN1, LPIN2, LPIN3 complement the null [Source:SGD;Acc:S000004775])

HSP 1 Score: 227.639 bits (579), Expect = 6.751e-63
Identity = 115/242 (47.52%), Postives = 159/242 (65.70%), Query Frame = 1
Query: 1468 KVYKKKIRLSSEEVSALNLKEGRNDIVFSMTTKYQGTTCCYATIYRWKWYDKIVISDVDGTITKSDVLGHVLPILGRDWTQAGVVKLYNKIFQNNYRFIYLSARAIGQAGITRTFLQDIVQEFSDKLPEGPILLSPTSLFQSLHREVIEKKPEYFKIQCLNDVRSL-FPDSVH---------PLYAGFGNRINDVIAYKAVGIDPKRIFTVNPEGSLKNEYCQ--KWSTSYGNLFDVADHFF 2157
            K Y + IRL+++++  LNL  G ND+ FS+     G     + ++ W+W   IVISD+DGTITKSD LGHVL ++G+DWT  GV KL+++I +N Y  +YL+AR+ GQA  TR++L+ I Q  S KLP GP++LSP     +L REVI KKPE FKI CLND+RSL F DS +         P +AGFGNRI D ++Y+ VGI   RIFT+N EG +  E  +   + +SY ++ ++ DHFF
Sbjct:  345 KRYIRTIRLTNDQLKCLNLTYGENDLKFSVD---HGKAIVTSKLFVWRWDVPIVISDIDGTITKSDALGHVLAMIGKDWTHLGVAKLFSEISRNGYNILYLTARSAGQADSTRSYLRSIEQNGS-KLPNGPVILSPDRTMAALRREVILKKPEVFKIACLNDIRSLYFEDSDNEVDTEEKSTPFFAGFGNRITDALSYRTVGIPSSRIFTINTEGEVHMELLELAGYRSSYIHINELVDHFF 582          

HSP 2 Score: 93.5893 bits (231), Expect = 6.017e-20
Identity = 48/116 (41.38%), Postives = 70/116 (60.34%), Query Frame = 1
Query:  127 KLISGIKYVYSDINPSTLTGAIDIIVVEQEDGSFTCGPFHVRFGKMGTLKPADKIVDIHLNGVYLENLHMKLGSAGEAYFIETVEPTLSETIDSSFIVSPFHSDSEEVDDSEKTDL 474
            + +  +   +S INP+TL+GAID+IVVE  DG  +C PFHVRFGK   LKP+ K V + +N   L N+ MKL  +GEAYF+  +   +++  D   +VSP  S +     S +T +
Sbjct:    6 RALGSVSKTWSSINPATLSGAIDVIVVEHPDGRLSCSPFHVRFGKFQILKPSQKKVQVFINE-KLSNMPMKLSDSGEAYFVFEMGDQVTDVPD-ELLVSPVMSATSSPPQSPETSI 119          
BLAST of Phosphatidate phosphatase LPIN2 vs. Ensembl Nematostella
Match: EDO33441 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SS75])

HSP 1 Score: 231.491 bits (589), Expect = 8.586e-70
Identity = 116/234 (49.57%), Postives = 157/234 (67.09%), Query Frame = 1
Query: 1570 QGTTCCYATIYRWKWYDKIVISDVDGTITKSDVLGHVLPILGRDWTQAGVVKLYNKIFQNNYRFIYLSARAIGQAGITRTFLQDIVQEFSDKLPEGPILLSPTSLFQSLHREVIEKKPEYFKIQCLNDVRSLFPDSVHPLYAGFGNRINDVIAYKAVGIDPKRIFTVNPEGSLKNEYCQKWSTSYGNLFDVADHFF----QFQSVHGISGIDYALEDYIDVNYWSLPINEVDIK 2259
            QGT  C ATIY W + D+IVISD+DGTITKSDVLG +LP++G  W Q+GV   +N I  N Y+ +YLSARAIGQA +TR +L+  V++    LP+GP+LLSP SL ++ HREVIEKKPE FKI  L D+ SLFP+  +P Y GFGN+INDV +Y+AVG+   RIFT+N +G + NE    + +SY  L D+ D  F    + Q     +G+  A +++    YW  P+  V+I+
Sbjct:    2 QGTAACQATIYLWNYDDRIVISDIDGTITKSDVLGQILPVVGSSWAQSGVAHFFNSIQSNGYKLLYLSARAIGQAQLTRDYLKS-VKQGQICLPDGPLLLSPASLIKAFHREVIEKKPEEFKISALRDILSLFPNK-NPFYGGFGNKINDVYSYRAVGVSVSRIFTINHKGEVTNELTTTFQSSYLRLSDLVDQMFPPYKKQQDSMRPTGL-VAPDEFSSFTYWRNPLPHVEIE 232          
BLAST of Phosphatidate phosphatase LPIN2 vs. Ensembl Nematostella
Match: EDO33443 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SS77])

HSP 1 Score: 108.612 bits (270), Expect = 2.537e-28
Identity = 49/85 (57.65%), Postives = 67/85 (78.82%), Query Frame = 1
Query:  127 KLISGIKYVYSDINPSTLTGAIDIIVVEQEDGSFTCGPFHVRFGKMGTLKPADKIVDIHLNGVYLENLHMKLGSAGEAYFIETVE 381
            +L++ ++  YS+IN +TLTGAID++V+ QEDGSF   PFHVRFGK+G L+  +KIVDI +NG  +  LHMKLG AGEA+F+E +E
Sbjct:    6 RLVTNVRGFYSEINSATLTGAIDVVVIRQEDGSFVASPFHVRFGKLGVLRSREKIVDIEVNGNPVP-LHMKLGDAGEAFFVEEIE 89          
BLAST of Phosphatidate phosphatase LPIN2 vs. Ensembl Nematostella
Match: EDO33442 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SS76])

HSP 1 Score: 71.633 bits (174), Expect = 8.085e-16
Identity = 28/47 (59.57%), Postives = 39/47 (82.98%), Query Frame = 1
Query:  127 KLISGIKYVYSDINPSTLTGAIDIIVVEQEDGSFTCGPFHVRFGKMG 267
            +L++ ++  YS+IN +TLTGAID++V+ QEDGSF   PFHVRFGK+G
Sbjct:    6 RLVTNVRGFYSEINSATLTGAIDVVVIRQEDGSFVASPFHVRFGKLG 52          
BLAST of Phosphatidate phosphatase LPIN2 vs. Ensembl Medaka
Match: zgc:123305 (phosphatidate phosphatase LPIN2 [Source:NCBI gene;Acc:101174419])

HSP 1 Score: 362.459 bits (929), Expect = 1.386e-109
Identity = 201/502 (40.04%), Postives = 288/502 (57.37%), Query Frame = 1
Query:  853 DVYLEDIMASGVSDELKRAYLYTEETKIRTRHQ------SNENVTLTVDAGYRSDGEVSVLAISPTYPIIQELKLSLCGDISVNDNISEETFFQHLVSFEDFIKDPDEXXXXXXXXXXXNGKYYNWGVAAPMILSIIAFKTELPINTVSNLKETYMSQKKRRSTWFSWRRHE---------------PPNDKKEPVKPELSVIP-------------PTPIVENKLTTVDSSEEISTHNKVYKKKIRLSSEEVSALNLKEGRNDIVFSMTTKYQGTTCCYATIYRWKWYDKIVISDVDGTITKSDVLGHVLPILGRDWTQAGVVKLYNKIFQNNYRFIYLSARAIGQAGITRTFLQDIVQEFSDKLPEGPILLSPTSLFQSLHREVIEKKPEYFKIQCLNDVRSLFPDSVHPLYAGFGNRINDVIAYKAVGIDPKRIFTVNPEGSLKNEYCQKWSTSYGNLFDVADHFFQFQSVHGISGIDYALEDYIDVNYWSLPINEVDI 2256
            D+YL+D+ +  +  E+   Y    +T+            S  +   +V +G    G    L+ S  Y    ++ +SLCG +     I+ E F +HLV+++DF  +P  ++++ SLV+ +N  YYNW VAAPMILS+ AF+  LP + +  L +  M +K  R  W SWRR +               P      PV+  L  I              P+ +  + L    S       ++VY+K +RL+S+++  LNL++G N +VFS+TT+YQGT  C A IY WKW D++VISD+DGTITKSD LGH+LP  G+DWT  G+ KLY+KI QN Y+F+Y SARAIG A IT+ +LQ  V +    LP+GP+LL+P+SLF +LHREVIEKKPE FK+ CLND+R LF     P YA FGNR ND  AYK VG+   RIFTVNP+G L  E  +   +SY +L ++ +HFF   S    +       ++   +YW  P+ E+++
Sbjct:  495 DIYLDDLTS--LDPEVAARYFPKSDTEAACLQGAEPSSCSGSHTPQSVGSGAMDSG-TEYLSDSACYST--DVSMSLCGRVGDTSQITTEKFKEHLVTYQDFASNPG-IIEDPSLVICVNSNYYNWAVAAPMILSMTAFQKNLPKSAIERLVKDKMPKKSGR-WWLSWRRRDMADSQQEQSKEEQEEPLAGAASPVRATLDDIDSDEAAGLGRKATLPSSLSSDTLAAAQSV------SQVYRKSLRLTSQQIERLNLRQGANKVVFSVTTQYQGTCRCEAAIYLWKWDDRVVISDIDGTITKSDALGHILPQFGKDWTHKGIAKLYHKIHQNGYKFLYCSARAIGMAAITKDYLQ-WVNDKGTVLPKGPVLLAPSSLFSALHREVIEKKPEVFKVACLNDIRDLFNPGRRPFYAAFGNRTNDAYAYKKVGVPETRIFTVNPKGELTQEMTKGNKSSYTHLSELVEHFFPTLSACSSTSSVLDCPEFSSFSYWKEPLPELEL 982          

HSP 2 Score: 107.457 bits (267), Expect = 2.932e-23
Identity = 47/77 (61.04%), Postives = 60/77 (77.92%), Query Frame = 1
Query:  142 IKYVYSDINPSTLTGAIDIIVVEQEDGSFTCGPFHVRFGKMGTLKPADKIVDIHLNGVYLENLHMKLGSAGEAYFIE 372
            +K +Y  +NP+TLTG ID+IVV Q DGSF C PFHVRFGK+G L+  +KIVDI +NG  + +LHMKLG  GEA+F+E
Sbjct:   15 VKELYRGLNPATLTGGIDVIVVRQPDGSFQCSPFHVRFGKLGVLRSKEKIVDIEINGEAV-DLHMKLGDNGEAFFVE 90          
BLAST of Phosphatidate phosphatase LPIN2 vs. Ensembl Medaka
Match: zgc:123305 (phosphatidate phosphatase LPIN2 [Source:NCBI gene;Acc:101174419])

HSP 1 Score: 362.459 bits (929), Expect = 1.386e-109
Identity = 201/502 (40.04%), Postives = 288/502 (57.37%), Query Frame = 1
Query:  853 DVYLEDIMASGVSDELKRAYLYTEETKIRTRHQ------SNENVTLTVDAGYRSDGEVSVLAISPTYPIIQELKLSLCGDISVNDNISEETFFQHLVSFEDFIKDPDEXXXXXXXXXXXNGKYYNWGVAAPMILSIIAFKTELPINTVSNLKETYMSQKKRRSTWFSWRRHE---------------PPNDKKEPVKPELSVIP-------------PTPIVENKLTTVDSSEEISTHNKVYKKKIRLSSEEVSALNLKEGRNDIVFSMTTKYQGTTCCYATIYRWKWYDKIVISDVDGTITKSDVLGHVLPILGRDWTQAGVVKLYNKIFQNNYRFIYLSARAIGQAGITRTFLQDIVQEFSDKLPEGPILLSPTSLFQSLHREVIEKKPEYFKIQCLNDVRSLFPDSVHPLYAGFGNRINDVIAYKAVGIDPKRIFTVNPEGSLKNEYCQKWSTSYGNLFDVADHFFQFQSVHGISGIDYALEDYIDVNYWSLPINEVDI 2256
            D+YL+D+ +  +  E+   Y    +T+            S  +   +V +G    G    L+ S  Y    ++ +SLCG +     I+ E F +HLV+++DF  +P  ++++ SLV+ +N  YYNW VAAPMILS+ AF+  LP + +  L +  M +K  R  W SWRR +               P      PV+  L  I              P+ +  + L    S       ++VY+K +RL+S+++  LNL++G N +VFS+TT+YQGT  C A IY WKW D++VISD+DGTITKSD LGH+LP  G+DWT  G+ KLY+KI QN Y+F+Y SARAIG A IT+ +LQ  V +    LP+GP+LL+P+SLF +LHREVIEKKPE FK+ CLND+R LF     P YA FGNR ND  AYK VG+   RIFTVNP+G L  E  +   +SY +L ++ +HFF   S    +       ++   +YW  P+ E+++
Sbjct:  495 DIYLDDLTS--LDPEVAARYFPKSDTEAACLQGAEPSSCSGSHTPQSVGSGAMDSG-TEYLSDSACYST--DVSMSLCGRVGDTSQITTEKFKEHLVTYQDFASNPG-IIEDPSLVICVNSNYYNWAVAAPMILSMTAFQKNLPKSAIERLVKDKMPKKSGR-WWLSWRRRDMADSQQEQSKEEQEEPLAGAASPVRATLDDIDSDEAAGLGRKATLPSSLSSDTLAAAQSV------SQVYRKSLRLTSQQIERLNLRQGANKVVFSVTTQYQGTCRCEAAIYLWKWDDRVVISDIDGTITKSDALGHILPQFGKDWTHKGIAKLYHKIHQNGYKFLYCSARAIGMAAITKDYLQ-WVNDKGTVLPKGPVLLAPSSLFSALHREVIEKKPEVFKVACLNDIRDLFNPGRRPFYAAFGNRTNDAYAYKKVGVPETRIFTVNPKGELTQEMTKGNKSSYTHLSELVEHFFPTLSACSSTSSVLDCPEFSSFSYWKEPLPELEL 982          

HSP 2 Score: 107.457 bits (267), Expect = 2.932e-23
Identity = 47/77 (61.04%), Postives = 60/77 (77.92%), Query Frame = 1
Query:  142 IKYVYSDINPSTLTGAIDIIVVEQEDGSFTCGPFHVRFGKMGTLKPADKIVDIHLNGVYLENLHMKLGSAGEAYFIE 372
            +K +Y  +NP+TLTG ID+IVV Q DGSF C PFHVRFGK+G L+  +KIVDI +NG  + +LHMKLG  GEA+F+E
Sbjct:   15 VKELYRGLNPATLTGGIDVIVVRQPDGSFQCSPFHVRFGKLGVLRSKEKIVDIEINGEAV-DLHMKLGDNGEAFFVE 90          
BLAST of Phosphatidate phosphatase LPIN2 vs. Ensembl Medaka
Match: zgc:123305 (phosphatidate phosphatase LPIN2 [Source:NCBI gene;Acc:101174419])

HSP 1 Score: 362.459 bits (929), Expect = 2.244e-109
Identity = 201/502 (40.04%), Postives = 288/502 (57.37%), Query Frame = 1
Query:  853 DVYLEDIMASGVSDELKRAYLYTEETKIRTRHQ------SNENVTLTVDAGYRSDGEVSVLAISPTYPIIQELKLSLCGDISVNDNISEETFFQHLVSFEDFIKDPDEXXXXXXXXXXXNGKYYNWGVAAPMILSIIAFKTELPINTVSNLKETYMSQKKRRSTWFSWRRHE---------------PPNDKKEPVKPELSVIP-------------PTPIVENKLTTVDSSEEISTHNKVYKKKIRLSSEEVSALNLKEGRNDIVFSMTTKYQGTTCCYATIYRWKWYDKIVISDVDGTITKSDVLGHVLPILGRDWTQAGVVKLYNKIFQNNYRFIYLSARAIGQAGITRTFLQDIVQEFSDKLPEGPILLSPTSLFQSLHREVIEKKPEYFKIQCLNDVRSLFPDSVHPLYAGFGNRINDVIAYKAVGIDPKRIFTVNPEGSLKNEYCQKWSTSYGNLFDVADHFFQFQSVHGISGIDYALEDYIDVNYWSLPINEVDI 2256
            D+YL+D+ +  +  E+   Y    +T+            S  +   +V +G    G    L+ S  Y    ++ +SLCG +     I+ E F +HLV+++DF  +P  ++++ SLV+ +N  YYNW VAAPMILS+ AF+  LP + +  L +  M +K  R  W SWRR +               P      PV+  L  I              P+ +  + L    S       ++VY+K +RL+S+++  LNL++G N +VFS+TT+YQGT  C A IY WKW D++VISD+DGTITKSD LGH+LP  G+DWT  G+ KLY+KI QN Y+F+Y SARAIG A IT+ +LQ  V +    LP+GP+LL+P+SLF +LHREVIEKKPE FK+ CLND+R LF     P YA FGNR ND  AYK VG+   RIFTVNP+G L  E  +   +SY +L ++ +HFF   S    +       ++   +YW  P+ E+++
Sbjct:  522 DIYLDDLTS--LDPEVAARYFPKSDTEAACLQGAEPSSCSGSHTPQSVGSGAMDSG-TEYLSDSACYST--DVSMSLCGRVGDTSQITTEKFKEHLVTYQDFASNPG-IIEDPSLVICVNSNYYNWAVAAPMILSMTAFQKNLPKSAIERLVKDKMPKKSGR-WWLSWRRRDMADSQQEQSKEEQEEPLAGAASPVRATLDDIDSDEAAGLGRKATLPSSLSSDTLAAAQSV------SQVYRKSLRLTSQQIERLNLRQGANKVVFSVTTQYQGTCRCEAAIYLWKWDDRVVISDIDGTITKSDALGHILPQFGKDWTHKGIAKLYHKIHQNGYKFLYCSARAIGMAAITKDYLQ-WVNDKGTVLPKGPVLLAPSSLFSALHREVIEKKPEVFKVACLNDIRDLFNPGRRPFYAAFGNRTNDAYAYKKVGVPETRIFTVNPKGELTQEMTKGNKSSYTHLSELVEHFFPTLSACSSTSSVLDCPEFSSFSYWKEPLPELEL 1009          

HSP 2 Score: 107.457 bits (267), Expect = 3.158e-23
Identity = 47/77 (61.04%), Postives = 60/77 (77.92%), Query Frame = 1
Query:  142 IKYVYSDINPSTLTGAIDIIVVEQEDGSFTCGPFHVRFGKMGTLKPADKIVDIHLNGVYLENLHMKLGSAGEAYFIE 372
            +K +Y  +NP+TLTG ID+IVV Q DGSF C PFHVRFGK+G L+  +KIVDI +NG  + +LHMKLG  GEA+F+E
Sbjct:   42 VKELYRGLNPATLTGGIDVIVVRQPDGSFQCSPFHVRFGKLGVLRSKEKIVDIEINGEAV-DLHMKLGDNGEAFFVE 117          
BLAST of Phosphatidate phosphatase LPIN2 vs. Ensembl Medaka
Match: lpin2 (phosphatidate phosphatase LPIN2 [Source:NCBI gene;Acc:101161835])

HSP 1 Score: 335.88 bits (860), Expect = 2.200e-100
Identity = 188/512 (36.72%), Postives = 285/512 (55.66%), Query Frame = 1
Query:  841 ENSKDVYLEDIMASGVSDELKRAYLYTEETKIRTRHQSNENVTLTVDAGYRSDGEVSVLA-------ISPTYPIIQELKLSLCGDISVNDNISEETFFQHLVSFEDFIKDPDEXXXXXXXXXXXNGKYYNWGVAAPMILSIIAFKTELPINTVSNLKETYMSQK--KRRSTWFSWRRHEPPNDKKEPVKPEL----------SVIPPTPI----------------------VENKLTTVDSSEEISTHNKVYKKKIRLSSEEVSALNLKEGRNDIVFSMTTKYQGTTCCYATIYRWKWYDKIVISDVDGTITKSDVLGHVLPILGRDWTQAGVVKLYNKIFQNNYRFIYLSARAIGQAGITRTFLQDIVQEFSDKLPEGPILLSPTSLFQSLHREVIEKKPEYFKIQCLNDVRSLFPDSVHPLYAGFGNRINDVIAYKAVGIDPKRIFTVNPEGSLKNEYCQKWSTSYGNLFDVADHFFQFQSVHGISGIDYALEDYIDVNYWSLPINEVD 2253
            +  +D+YL+D+    +  ++   Y    E++   +H  +  +     +G +S   V   A       +S +   + ++ LSLCG +S N  IS+E F +H++++ +F ++P  +     +V + N +YYNW +AAP+ILS+ AF+  LP  T    +E ++ +K  K+   W+ WR+      K+   K E           + +P   +                       + +L   D       H   Y+K +RLSSE+++ L LKEG ND+ FS+TT+YQGT  C  TIY W W D+++ISD+DGTITKSDV G +LP LG+DWT  G+ KLY+ + +N Y+F+Y SARAIG A +TR +L   V +    LP GP++LSP+SLF + HREVIEKKPE FKI+CL D+++LF  +  P YA FGNR NDV AYK VG+   RIFTVNP+G L  E  +   +SYG L ++ +H F   S        + + ++    YW  P+ E++
Sbjct:  412 QGPEDIYLDDLNV--LEPDVAARYFPKSESEAANKHWMDSEIC----SGSQSPQSVGSAAADSGTECMSDSAGDLPDVTLSLCGGLSENAEISKERFMEHIITYHEFAENPAIIDNPNLVVKIGN-RYYNWTLAAPLILSLQAFQKNLPKAT----EEAWVKEKMPKKSGRWWFWRKRADSTIKQSETKLEAKEECQSMDEGASVPQEKLDLPSKAGDTSSDEEAKEVSAVSCQERLQAADGQLHAGVH--TYRKSLRLSSEQIANLKLKEGPNDVTFSITTQYQGTCRCEGTIYLWNWDDRVIISDIDGTITKSDVFGQILPQLGKDWTHQGIAKLYHSVAENGYKFLYCSARAIGMADMTRGYLH-WVNDGGIILPRGPLMLSPSSLFSAFHREVIEKKPEIFKIECLTDIKNLFQHNKRPFYAAFGNRTNDVFAYKEVGVPVCRIFTVNPKGELIQEQTKGNKSSYGRLSELVEHVFPLLSKEQNEA--FLMPEFSSFCYWRQPLPEIN 907          

HSP 2 Score: 102.449 bits (254), Expect = 8.447e-22
Identity = 47/105 (44.76%), Postives = 71/105 (67.62%), Query Frame = 1
Query:  127 KLISGIKYVYSDINPSTLTGAIDIIVVEQEDGSFTCGPFHVRFGKMGTLKPADKIVDIHLNGVYLENLHMKLGSAGEAYFIETVEPTLSETIDSSFIVSPFHSDS 441
            +++  +K +Y  IN +TL+G ID++VV Q DG+F C PFHVRFGK+G L+  +K++DI +NG  + +LHMKLG  GEA+F++  E T    I +    SP  ++S
Sbjct:   10 QVLVTVKELYKGINQATLSGCIDVVVVRQRDGTFQCSPFHVRFGKLGVLRSKEKVIDIEVNGEPV-DLHMKLGDNGEAFFVQETEQT--NIIPAHLATSPIPTES 111          
BLAST of Phosphatidate phosphatase LPIN2 vs. Ensembl Medaka
Match: lpin2 (phosphatidate phosphatase LPIN2 [Source:NCBI gene;Acc:101161835])

HSP 1 Score: 336.265 bits (861), Expect = 3.824e-100
Identity = 188/512 (36.72%), Postives = 285/512 (55.66%), Query Frame = 1
Query:  841 ENSKDVYLEDIMASGVSDELKRAYLYTEETKIRTRHQSNENVTLTVDAGYRSDGEVSVLA-------ISPTYPIIQELKLSLCGDISVNDNISEETFFQHLVSFEDFIKDPDEXXXXXXXXXXXNGKYYNWGVAAPMILSIIAFKTELPINTVSNLKETYMSQK--KRRSTWFSWRRHEPPNDKKEPVKPEL----------SVIPPTPI----------------------VENKLTTVDSSEEISTHNKVYKKKIRLSSEEVSALNLKEGRNDIVFSMTTKYQGTTCCYATIYRWKWYDKIVISDVDGTITKSDVLGHVLPILGRDWTQAGVVKLYNKIFQNNYRFIYLSARAIGQAGITRTFLQDIVQEFSDKLPEGPILLSPTSLFQSLHREVIEKKPEYFKIQCLNDVRSLFPDSVHPLYAGFGNRINDVIAYKAVGIDPKRIFTVNPEGSLKNEYCQKWSTSYGNLFDVADHFFQFQSVHGISGIDYALEDYIDVNYWSLPINEVD 2253
            +  +D+YL+D+    +  ++   Y    E++   +H  +  +     +G +S   V   A       +S +   + ++ LSLCG +S N  IS+E F +H++++ +F ++P  +     +V + N +YYNW +AAP+ILS+ AF+  LP  T    +E ++ +K  K+   W+ WR+      K+   K E           + +P   +                       + +L   D       H   Y+K +RLSSE+++ L LKEG ND+ FS+TT+YQGT  C  TIY W W D+++ISD+DGTITKSDV G +LP LG+DWT  G+ KLY+ + +N Y+F+Y SARAIG A +TR +L   V +    LP GP++LSP+SLF + HREVIEKKPE FKI+CL D+++LF  +  P YA FGNR NDV AYK VG+   RIFTVNP+G L  E  +   +SYG L ++ +H F   S        + + ++    YW  P+ E++
Sbjct:  453 QGPEDIYLDDLNV--LEPDVAARYFPKSESEAANKHWMDSEIC----SGSQSPQSVGSAAADSGTECMSDSAGDLPDVTLSLCGGLSENAEISKERFMEHIITYHEFAENPAIIDNPNLVVKIGN-RYYNWTLAAPLILSLQAFQKNLPKAT----EEAWVKEKMPKKSGRWWFWRKRADSTIKQSETKLEAKEECQSMDEGASVPQEKLDLPSKAGDTSSDEEAKEVSAVSCQERLQAADGQLHAGVH--TYRKSLRLSSEQIANLKLKEGPNDVTFSITTQYQGTCRCEGTIYLWNWDDRVIISDIDGTITKSDVFGQILPQLGKDWTHQGIAKLYHSVAENGYKFLYCSARAIGMADMTRGYLH-WVNDGGIILPRGPLMLSPSSLFSAFHREVIEKKPEIFKIECLTDIKNLFQHNKRPFYAAFGNRTNDVFAYKEVGVPVCRIFTVNPKGELIQEQTKGNKSSYGRLSELVEHVFPLLSKEQNEA--FLMPEFSSFCYWRQPLPEIN 948          

HSP 2 Score: 103.219 bits (256), Expect = 6.339e-22
Identity = 47/105 (44.76%), Postives = 71/105 (67.62%), Query Frame = 1
Query:  127 KLISGIKYVYSDINPSTLTGAIDIIVVEQEDGSFTCGPFHVRFGKMGTLKPADKIVDIHLNGVYLENLHMKLGSAGEAYFIETVEPTLSETIDSSFIVSPFHSDS 441
            +++  +K +Y  IN +TL+G ID++VV Q DG+F C PFHVRFGK+G L+  +K++DI +NG  + +LHMKLG  GEA+F++  E T    I +    SP  ++S
Sbjct:   51 QVLVTVKELYKGINQATLSGCIDVVVVRQRDGTFQCSPFHVRFGKLGVLRSKEKVIDIEVNGEPV-DLHMKLGDNGEAFFVQETEQT--NIIPAHLATSPIPTES 152          
BLAST of Phosphatidate phosphatase LPIN2 vs. Planmine SMEST
Match: SMESG000013641.1 (SMESG000013641.1)

HSP 1 Score: 1490.32 bits (3857), Expect = 0.000e+0
Identity = 734/734 (100.00%), Postives = 734/734 (100.00%), Query Frame = 1
Query:   88 MQTFKQVISMGRDKLISGIKYVYSDINPSTLTGAIDIIVVEQEDGSFTCGPFHVRFGKMGTLKPADKIVDIHLNGVYLENLHMKLGSAGEAYFIETVEPTLSETIDSSFIVSPFHSDSEEVDDSEKTDLSGSRLNKKRSRKNVKYKSEFYTQNGLNDESTTAECYNKRYHCLSDNDDFIQDDSAELLREGYNSDGAVDKITKEELNDINMTWDWGNFPLDSRASSEKPTETTITVTNESVHTLVNNKPNDLENSKDVYLEDIMASGVSDELKRAYLYTEETKIRTRHQSNENVTLTVDAGYRSDGEVSVLAISPTYPIIQELKLSLCGDISVNDNISEETFFQHLVSFEDFIKDPDEXXXXXXXXXXXNGKYYNWGVAAPMILSIIAFKTELPINTVSNLKETYMSQKKRRSTWFSWRRHEPPNDKKEPVKPELSVIPPTPIVENKLTTVDSSEEISTHNKVYKKKIRLSSEEVSALNLKEGRNDIVFSMTTKYQGTTCCYATIYRWKWYDKIVISDVDGTITKSDVLGHVLPILGRDWTQAGVVKLYNKIFQNNYRFIYLSARAIGQAGITRTFLQDIVQEFSDKLPEGPILLSPTSLFQSLHREVIEKKPEYFKIQCLNDVRSLFPDSVHPLYAGFGNRINDVIAYKAVGIDPKRIFTVNPEGSLKNEYCQKWSTSYGNLFDVADHFFQFQSVHGISGIDYALEDYIDVNYWSLPINEVDIKEEINKSKPAI 2289
            MQTFKQVISMGRDKLISGIKYVYSDINPSTLTGAIDIIVVEQEDGSFTCGPFHVRFGKMGTLKPADKIVDIHLNGVYLENLHMKLGSAGEAYFIETVEPTLSETIDSSFIVSPFHSDSEEVDDSEKTDLSGSRLNKKRSRKNVKYKSEFYTQNGLNDESTTAECYNKRYHCLSDNDDFIQDDSAELLREGYNSDGAVDKITKEELNDINMTWDWGNFPLDSRASSEKPTETTITVTNESVHTLVNNKPNDLENSKDVYLEDIMASGVSDELKRAYLYTEETKIRTRHQSNENVTLTVDAGYRSDGEVSVLAISPTYPIIQELKLSLCGDISVNDNISEETFFQHLVSFEDFIKDPDELLKNTSLVLLLNGKYYNWGVAAPMILSIIAFKTELPINTVSNLKETYMSQKKRRSTWFSWRRHEPPNDKKEPVKPELSVIPPTPIVENKLTTVDSSEEISTHNKVYKKKIRLSSEEVSALNLKEGRNDIVFSMTTKYQGTTCCYATIYRWKWYDKIVISDVDGTITKSDVLGHVLPILGRDWTQAGVVKLYNKIFQNNYRFIYLSARAIGQAGITRTFLQDIVQEFSDKLPEGPILLSPTSLFQSLHREVIEKKPEYFKIQCLNDVRSLFPDSVHPLYAGFGNRINDVIAYKAVGIDPKRIFTVNPEGSLKNEYCQKWSTSYGNLFDVADHFFQFQSVHGISGIDYALEDYIDVNYWSLPINEVDIKEEINKSKPAI
Sbjct:    1 MQTFKQVISMGRDKLISGIKYVYSDINPSTLTGAIDIIVVEQEDGSFTCGPFHVRFGKMGTLKPADKIVDIHLNGVYLENLHMKLGSAGEAYFIETVEPTLSETIDSSFIVSPFHSDSEEVDDSEKTDLSGSRLNKKRSRKNVKYKSEFYTQNGLNDESTTAECYNKRYHCLSDNDDFIQDDSAELLREGYNSDGAVDKITKEELNDINMTWDWGNFPLDSRASSEKPTETTITVTNESVHTLVNNKPNDLENSKDVYLEDIMASGVSDELKRAYLYTEETKIRTRHQSNENVTLTVDAGYRSDGEVSVLAISPTYPIIQELKLSLCGDISVNDNISEETFFQHLVSFEDFIKDPDELLKNTSLVLLLNGKYYNWGVAAPMILSIIAFKTELPINTVSNLKETYMSQKKRRSTWFSWRRHEPPNDKKEPVKPELSVIPPTPIVENKLTTVDSSEEISTHNKVYKKKIRLSSEEVSALNLKEGRNDIVFSMTTKYQGTTCCYATIYRWKWYDKIVISDVDGTITKSDVLGHVLPILGRDWTQAGVVKLYNKIFQNNYRFIYLSARAIGQAGITRTFLQDIVQEFSDKLPEGPILLSPTSLFQSLHREVIEKKPEYFKIQCLNDVRSLFPDSVHPLYAGFGNRINDVIAYKAVGIDPKRIFTVNPEGSLKNEYCQKWSTSYGNLFDVADHFFQFQSVHGISGIDYALEDYIDVNYWSLPINEVDIKEEINKSKPAI 734          
BLAST of Phosphatidate phosphatase LPIN2 vs. Planmine SMEST
Match: SMESG000013641.1 (SMESG000013641.1)

HSP 1 Score: 1471.83 bits (3809), Expect = 0.000e+0
Identity = 725/725 (100.00%), Postives = 725/725 (100.00%), Query Frame = 1
Query:  115 MGRDKLISGIKYVYSDINPSTLTGAIDIIVVEQEDGSFTCGPFHVRFGKMGTLKPADKIVDIHLNGVYLENLHMKLGSAGEAYFIETVEPTLSETIDSSFIVSPFHSDSEEVDDSEKTDLSGSRLNKKRSRKNVKYKSEFYTQNGLNDESTTAECYNKRYHCLSDNDDFIQDDSAELLREGYNSDGAVDKITKEELNDINMTWDWGNFPLDSRASSEKPTETTITVTNESVHTLVNNKPNDLENSKDVYLEDIMASGVSDELKRAYLYTEETKIRTRHQSNENVTLTVDAGYRSDGEVSVLAISPTYPIIQELKLSLCGDISVNDNISEETFFQHLVSFEDFIKDPDEXXXXXXXXXXXNGKYYNWGVAAPMILSIIAFKTELPINTVSNLKETYMSQKKRRSTWFSWRRHEPPNDKKEPVKPELSVIPPTPIVENKLTTVDSSEEISTHNKVYKKKIRLSSEEVSALNLKEGRNDIVFSMTTKYQGTTCCYATIYRWKWYDKIVISDVDGTITKSDVLGHVLPILGRDWTQAGVVKLYNKIFQNNYRFIYLSARAIGQAGITRTFLQDIVQEFSDKLPEGPILLSPTSLFQSLHREVIEKKPEYFKIQCLNDVRSLFPDSVHPLYAGFGNRINDVIAYKAVGIDPKRIFTVNPEGSLKNEYCQKWSTSYGNLFDVADHFFQFQSVHGISGIDYALEDYIDVNYWSLPINEVDIKEEINKSKPAI 2289
            MGRDKLISGIKYVYSDINPSTLTGAIDIIVVEQEDGSFTCGPFHVRFGKMGTLKPADKIVDIHLNGVYLENLHMKLGSAGEAYFIETVEPTLSETIDSSFIVSPFHSDSEEVDDSEKTDLSGSRLNKKRSRKNVKYKSEFYTQNGLNDESTTAECYNKRYHCLSDNDDFIQDDSAELLREGYNSDGAVDKITKEELNDINMTWDWGNFPLDSRASSEKPTETTITVTNESVHTLVNNKPNDLENSKDVYLEDIMASGVSDELKRAYLYTEETKIRTRHQSNENVTLTVDAGYRSDGEVSVLAISPTYPIIQELKLSLCGDISVNDNISEETFFQHLVSFEDFIKDPDELLKNTSLVLLLNGKYYNWGVAAPMILSIIAFKTELPINTVSNLKETYMSQKKRRSTWFSWRRHEPPNDKKEPVKPELSVIPPTPIVENKLTTVDSSEEISTHNKVYKKKIRLSSEEVSALNLKEGRNDIVFSMTTKYQGTTCCYATIYRWKWYDKIVISDVDGTITKSDVLGHVLPILGRDWTQAGVVKLYNKIFQNNYRFIYLSARAIGQAGITRTFLQDIVQEFSDKLPEGPILLSPTSLFQSLHREVIEKKPEYFKIQCLNDVRSLFPDSVHPLYAGFGNRINDVIAYKAVGIDPKRIFTVNPEGSLKNEYCQKWSTSYGNLFDVADHFFQFQSVHGISGIDYALEDYIDVNYWSLPINEVDIKEEINKSKPAI
Sbjct:    1 MGRDKLISGIKYVYSDINPSTLTGAIDIIVVEQEDGSFTCGPFHVRFGKMGTLKPADKIVDIHLNGVYLENLHMKLGSAGEAYFIETVEPTLSETIDSSFIVSPFHSDSEEVDDSEKTDLSGSRLNKKRSRKNVKYKSEFYTQNGLNDESTTAECYNKRYHCLSDNDDFIQDDSAELLREGYNSDGAVDKITKEELNDINMTWDWGNFPLDSRASSEKPTETTITVTNESVHTLVNNKPNDLENSKDVYLEDIMASGVSDELKRAYLYTEETKIRTRHQSNENVTLTVDAGYRSDGEVSVLAISPTYPIIQELKLSLCGDISVNDNISEETFFQHLVSFEDFIKDPDELLKNTSLVLLLNGKYYNWGVAAPMILSIIAFKTELPINTVSNLKETYMSQKKRRSTWFSWRRHEPPNDKKEPVKPELSVIPPTPIVENKLTTVDSSEEISTHNKVYKKKIRLSSEEVSALNLKEGRNDIVFSMTTKYQGTTCCYATIYRWKWYDKIVISDVDGTITKSDVLGHVLPILGRDWTQAGVVKLYNKIFQNNYRFIYLSARAIGQAGITRTFLQDIVQEFSDKLPEGPILLSPTSLFQSLHREVIEKKPEYFKIQCLNDVRSLFPDSVHPLYAGFGNRINDVIAYKAVGIDPKRIFTVNPEGSLKNEYCQKWSTSYGNLFDVADHFFQFQSVHGISGIDYALEDYIDVNYWSLPINEVDIKEEINKSKPAI 725          
The following BLAST results are available for this feature:
BLAST of Phosphatidate phosphatase LPIN2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LPIN31.336e-11046.48lipin 3 [Source:HGNC Symbol;Acc:HGNC:14451][more]
LPIN31.494e-11046.48lipin 3 [Source:HGNC Symbol;Acc:HGNC:14451][more]
LPIN22.522e-10738.66lipin 2 [Source:HGNC Symbol;Acc:HGNC:14450][more]
LPIN16.547e-9441.79lipin 1 [Source:HGNC Symbol;Acc:HGNC:13345][more]
LPIN17.378e-9441.79lipin 1 [Source:HGNC Symbol;Acc:HGNC:13345][more]
back to top
BLAST of Phosphatidate phosphatase LPIN2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
lpin-11.530e-7143.27LiPIN (Mammalian lipodystrophy associated) homolog... [more]
back to top
BLAST of Phosphatidate phosphatase LPIN2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lpin4.055e-10136.53gene:FBgn0263593 transcript:FBtr0303580[more]
Lpin8.791e-10136.76gene:FBgn0263593 transcript:FBtr0303573[more]
Lpin2.666e-10036.53gene:FBgn0263593 transcript:FBtr0113055[more]
Lpin2.666e-10036.53gene:FBgn0263593 transcript:FBtr0303583[more]
Lpin1.028e-9437.32gene:FBgn0263593 transcript:FBtr0303577[more]
back to top
BLAST of Phosphatidate phosphatase LPIN2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1233052.259e-10642.00zgc:123305 [Source:ZFIN;Acc:ZDB-GENE-051120-171][more]
zgc:1233052.259e-10642.00zgc:123305 [Source:ZFIN;Acc:ZDB-GENE-051120-171][more]
zgc:1233053.656e-10642.00zgc:123305 [Source:ZFIN;Acc:ZDB-GENE-051120-171][more]
lpin12.359e-10139.39lipin 1 [Source:ZFIN;Acc:ZDB-GENE-080722-2][more]
lpin12.457e-10139.39lipin 1 [Source:ZFIN;Acc:ZDB-GENE-080722-2][more]
back to top
BLAST of Phosphatidate phosphatase LPIN2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adamts169.769e-12234.86ADAM metallopeptidase with thrombospondin type 1 m... [more]
acy1.11.818e-11534.58aminoacylase 1, gene 1 [Source:Xenbase;Acc:XB-GENE... [more]
stxbp23.455e-11234.30syntaxin binding protein 2 [Source:Xenbase;Acc:XB-... [more]
adamts162.215e-9941.18ADAM metallopeptidase with thrombospondin type 1 m... [more]
adamts163.404e-9940.49ADAM metallopeptidase with thrombospondin type 1 m... [more]
back to top
BLAST of Phosphatidate phosphatase LPIN2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lpin31.041e-11246.92lipin 3 [Source:MGI Symbol;Acc:MGI:1891342][more]
Lpin31.041e-11246.92lipin 3 [Source:MGI Symbol;Acc:MGI:1891342][more]
Lpin31.356e-10945.83lipin 3 [Source:MGI Symbol;Acc:MGI:1891342][more]
Lpin36.272e-10847.04lipin 3 [Source:MGI Symbol;Acc:MGI:1891342][more]
Lpin26.346e-10538.33lipin 2 [Source:MGI Symbol;Acc:MGI:1891341][more]
back to top
BLAST of Phosphatidate phosphatase LPIN2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q99PI4|LPIN3_MOUSE7.281e-11246.92Phosphatidate phosphatase LPIN3 OS=Mus musculus OX... [more]
sp|Q7TNN8|LPIN3_MUSSP1.471e-11146.92Phosphatidate phosphatase LPIN3 OS=Mus spretus OX=... [more]
sp|Q9BQK8|LPIN3_HUMAN7.176e-11046.48Phosphatidate phosphatase LPIN3 OS=Homo sapiens OX... [more]
sp|Q92539|LPIN2_HUMAN1.211e-10638.66Phosphatidate phosphatase LPIN2 OS=Homo sapiens OX... [more]
sp|Q99PI5|LPIN2_MOUSE4.439e-10438.33Phosphatidate phosphatase LPIN2 OS=Mus musculus OX... [more]
back to top
BLAST of Phosphatidate phosphatase LPIN2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A430QID91.403e-17744.35Phosphatidate phosphatase LPIN OS=Schistosoma bovi... [more]
A0A183NJ867.754e-17743.38LNS2 domain-containing protein OS=Schistosoma matt... [more]
A0A183AZE89.100e-17744.43LNS2 domain-containing protein OS=Echinostoma capr... [more]
A0A183L1379.697e-17744.21LNS2 domain-containing protein OS=Schistosoma cura... [more]
G4V8V61.148e-17643.88Putative lipin OS=Schistosoma mansoni OX=6183 GN=S... [more]
back to top
BLAST of Phosphatidate phosphatase LPIN2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LPIN26.387e-13633.93lipin 2 [Source:HGNC Symbol;Acc:HGNC:14450][more]
lpin16.976e-10941.91lipin 1 [Source:ZFIN;Acc:ZDB-GENE-080722-2][more]
LPIN22.261e-10739.20lipin 2 [Source:HGNC Symbol;Acc:HGNC:14450][more]
lpin13.804e-10644.13lipin 1 [Source:ZFIN;Acc:ZDB-GENE-080722-2][more]
lpin27.851e-10338.00phosphatidate phosphatase LPIN2-like [Source:NCBI ... [more]
back to top
BLAST of Phosphatidate phosphatase LPIN2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000006569.18.157e-1746.00pep scaffold:Pmarinus_7.0:GL488977:141:7536:-1 gen... [more]
back to top
BLAST of Phosphatidate phosphatase LPIN2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PAH16.751e-6347.52Mg2+-dependent phosphatidate (PA) phosphatase; dep... [more]
back to top
BLAST of Phosphatidate phosphatase LPIN2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO334418.586e-7049.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO334432.537e-2857.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO334428.085e-1659.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Phosphatidate phosphatase LPIN2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1233051.386e-10940.04phosphatidate phosphatase LPIN2 [Source:NCBI gene;... [more]
zgc:1233051.386e-10940.04phosphatidate phosphatase LPIN2 [Source:NCBI gene;... [more]
zgc:1233052.244e-10940.04phosphatidate phosphatase LPIN2 [Source:NCBI gene;... [more]
lpin22.200e-10036.72phosphatidate phosphatase LPIN2 [Source:NCBI gene;... [more]
lpin23.824e-10036.72phosphatidate phosphatase LPIN2 [Source:NCBI gene;... [more]
back to top
BLAST of Phosphatidate phosphatase LPIN2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000013641.10.000e+0100.00SMESG000013641.1[more]
SMESG000013641.10.000e+0100.00SMESG000013641.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031931 ID=SMED30031931|Name=Phosphatidate phosphatase LPIN2|organism=Schmidtea mediterranea sexual|type=transcript|length=2838bp
ATTCAGATCATGATTTATGTTTATGTTTTGTTTATTTGAATTTAATATTT
AAATTTTGAAGTTATAATATTTCTATATTATTTTCCCATGCAAACCTTTA
AGCAAGTCATATCTATGGGGCGTGATAAGTTAATATCGGGCATTAAATAT
GTTTATTCAGACATAAATCCGTCAACATTAACTGGTGCTATTGACATTAT
AGTTGTGGAACAGGAAGATGGTAGTTTTACTTGTGGTCCATTTCACGTTA
GATTTGGAAAAATGGGGACACTAAAACCTGCTGATAAAATAGTTGATATT
CATTTAAATGGAGTATATTTAGAAAATTTGCATATGAAGTTAGGATCTGC
TGGTGAAGCATATTTTATTGAAACAGTTGAACCAACACTTTCTGAAACTA
TAGATTCTTCATTTATCGTATCTCCTTTCCATAGTGATTCAGAAGAGGTT
GACGATAGCGAAAAGACTGATTTGAGTGGCTCTCGTTTAAATAAAAAGCG
TTCAAGAAAAAATGTTAAGTATAAATCTGAGTTTTATACACAAAATGGTT
TAAACGACGAATCAACAACTGCGGAATGTTATAATAAAAGATATCATTGT
TTATCAGACAATGATGATTTTATTCAAGATGATTCGGCAGAACTCTTAAG
AGAAGGCTATAATTCTGATGGTGCTGTTGACAAAATAACCAAAGAAGAAT
TAAATGACATAAACATGACTTGGGATTGGGGAAATTTTCCCTTGGATAGC
CGAGCTTCTAGTGAAAAACCAACTGAAACAACTATTACCGTAACAAATGA
ATCAGTTCATACATTAGTAAATAATAAACCAAATGATTTAGAAAATTCTA
AAGATGTTTATCTTGAAGATATTATGGCTTCGGGTGTTTCGGATGAATTA
AAGAGAGCATATTTGTATACAGAAGAAACTAAAATTCGTACAAGACATCA
ATCAAATGAAAATGTTACACTAACAGTTGATGCGGGTTACCGATCAGATG
GTGAAGTAAGTGTTTTGGCAATATCTCCAACGTATCCAATCATCCAAGAA
TTGAAATTGTCTCTTTGTGGCGATATTAGTGTTAACGATAACATTTCCGA
AGAAACTTTCTTCCAACATCTAGTTTCATTTGAAGATTTCATCAAAGATC
CTGATGAACTTTTGAAAAATACAAGTCTAGTTTTATTGTTAAATGGCAAG
TATTACAATTGGGGTGTTGCTGCACCTATGATTCTTTCAATTATAGCATT
TAAAACCGAATTACCTATCAATACCGTTTCGAATTTAAAAGAAACCTACA
TGTCACAGAAAAAACGTCGCTCAACTTGGTTCAGTTGGAGACGTCACGAA
CCACCCAACGACAAAAAGGAACCCGTTAAACCAGAACTATCTGTTATTCC
ACCAACTCCAATTGTTGAAAATAAATTGACCACAGTTGACAGCAGTGAAG
AAATTAGCACTCACAACAAAGTATATAAGAAAAAAATACGCCTGAGTTCC
GAAGAAGTATCGGCTTTGAATTTGAAGGAAGGTCGAAATGATATAGTATT
CAGCATGACAACTAAATACCAAGGAACAACTTGCTGCTATGCCACGATTT
ATCGATGGAAATGGTACGACAAAATAGTAATATCAGACGTAGACGGAACG
ATTACCAAATCGGACGTTTTGGGCCATGTTTTACCAATATTAGGACGAGA
TTGGACACAGGCCGGAGTAGTAAAACTATATAACAAAATCTTTCAAAACA
ACTATCGATTCATTTATTTATCCGCACGAGCTATCGGACAAGCAGGAATT
ACTCGAACCTTTCTACAGGATATCGTACAGGAGTTTTCCGATAAACTCCC
AGAAGGCCCGATCCTTCTTTCGCCAACATCGCTTTTCCAATCGTTACATC
GAGAAGTCATTGAAAAAAAACCGGAATATTTCAAAATCCAATGTCTAAAT
GATGTTCGGTCGCTTTTTCCCGACTCCGTCCATCCTCTGTACGCCGGTTT
CGGGAATCGTATCAATGACGTTATTGCTTACAAAGCTGTCGGAATAGATC
CGAAACGGATATTTACCGTCAATCCTGAAGGCTCGTTGAAAAATGAATAC
TGTCAAAAGTGGTCAACGAGTTATGGAAATCTTTTCGATGTCGCCGATCA
TTTCTTTCAATTCCAGTCAGTTCACGGCATATCGGGTATTGATTACGCCT
TGGAGGATTATATCGATGTCAACTATTGGTCACTGCCAATCAATGAAGTG
GATATTAAAGAGGAAATTAATAAATCTAAACCAGCTATTTAGTGTGTTCT
TATTTTACTTCATTTTAATACCGCAATCTTTCATGAAATTCTAGTAATAA
TTTTCACTTTCCTACATTTGATTGCTTACCTTGAAAATTAATTCTATATT
AATTACTGCCAATTCAGTTGTTCCAGTTTTAATTACTTTTCTAAAATTTA
TCAACTATTGATTTAAATTTCTTGTGTGAAATGCCAATACATTTTTTTAA
TGCATGATTACTGTTTTTCAGAAAATTTTGTTTCTAGACTTTAATATTTT
GTAATTAATCCAGGGAAAACAAAATAAAGATTGAATTGATAAAATAAAAT
TATCGTACAATTTTTACTTTGGTTATATAAATTGTTATTGATGAAGTGTG
ATATATTTTTTATTAAATTTACTTGTAATTTTCTCCATTGCAAAGCAGGG
AATAGTTGAATGACAAATGCTTTTGTTAATTTGTTATTATTATTGTAATT
GACATGTTTTCATATAATTGAAACTATTGATTTTTTTAGATATCAAATAT
TTTTAGAGTTTATTTCGGTTAATGAAACTAATAAGGTC
back to top

protein sequence of SMED30031931-orf-1

>SMED30031931-orf-1 ID=SMED30031931-orf-1|Name=SMED30031931-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=735bp
MQTFKQVISMGRDKLISGIKYVYSDINPSTLTGAIDIIVVEQEDGSFTCG
PFHVRFGKMGTLKPADKIVDIHLNGVYLENLHMKLGSAGEAYFIETVEPT
LSETIDSSFIVSPFHSDSEEVDDSEKTDLSGSRLNKKRSRKNVKYKSEFY
TQNGLNDESTTAECYNKRYHCLSDNDDFIQDDSAELLREGYNSDGAVDKI
TKEELNDINMTWDWGNFPLDSRASSEKPTETTITVTNESVHTLVNNKPND
LENSKDVYLEDIMASGVSDELKRAYLYTEETKIRTRHQSNENVTLTVDAG
YRSDGEVSVLAISPTYPIIQELKLSLCGDISVNDNISEETFFQHLVSFED
FIKDPDELLKNTSLVLLLNGKYYNWGVAAPMILSIIAFKTELPINTVSNL
KETYMSQKKRRSTWFSWRRHEPPNDKKEPVKPELSVIPPTPIVENKLTTV
DSSEEISTHNKVYKKKIRLSSEEVSALNLKEGRNDIVFSMTTKYQGTTCC
YATIYRWKWYDKIVISDVDGTITKSDVLGHVLPILGRDWTQAGVVKLYNK
IFQNNYRFIYLSARAIGQAGITRTFLQDIVQEFSDKLPEGPILLSPTSLF
QSLHREVIEKKPEYFKIQCLNDVRSLFPDSVHPLYAGFGNRINDVIAYKA
VGIDPKRIFTVNPEGSLKNEYCQKWSTSYGNLFDVADHFFQFQSVHGISG
IDYALEDYIDVNYWSLPINEVDIKEEINKSKPAI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002056medial muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR026058LIPIN
IPR036412HAD-like_sf
IPR031315LNS2/PITP
IPR031703Lipin_mid
IPR007651Lipin_N
IPR013209LNS2
IPR023214HAD_sf
Vocabulary: molecular function
TermDefinition
GO:0042578phosphoric ester hydrolase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR031315LNS2/PITPSMARTSM00775lns2coord: 513..670
e-value: 7.2E-96
score: 334.5
IPR031703Lipin, middle domainPFAMPF16876Lipin_midcoord: 323..417
e-value: 1.9E-26
score: 92.1
IPR007651Lipin, N-terminalPFAMPF04571Lipin_Ncoord: 14..110
e-value: 1.3E-34
score: 118.3
IPR013209Lipin/Ned1/Smp2 (LNS2)PFAMPF08235LNS2coord: 465..690
e-value: 2.6E-96
score: 321.5
NoneNo IPR availablePANTHERPTHR12181:SF62PHOSPHATIDATE PHOSPHATASE LPIN3coord: 253..725
NoneNo IPR availablePANTHERPTHR12181:SF62PHOSPHATIDATE PHOSPHATASE LPIN3coord: 18..126
IPR026058LIPIN familyPANTHERPTHR12181LIPINcoord: 253..725
IPR026058LIPIN familyPANTHERPTHR12181LIPINcoord: 18..126
IPR036412HAD-like superfamilySUPERFAMILYSSF56784HAD-likecoord: 506..658