S-like RNase

Overview
NameS-like RNase
Smed IDSMED30031930
Length (bp)1042
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of S-like RNase (SMED30031930) t-SNE clustered cells

Violin plots show distribution of expression levels for S-like RNase (SMED30031930) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of S-like RNase (SMED30031930) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for S-like RNase (SMED30031930) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031930

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30031930h1SMcG0004097 Contig758GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Smed sexual biotypeSMED30031930h1SMcG0004097 Contig39931newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031930h1SMcG0004097 Contig39931uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
gutSMED30031930h1SMcG0004097 dd_Smed_v4_1008_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30031930h1SMcG0004097 dd_Smed_v4_1008_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30031930h1SMcG0004097 dd_Smed_v4_1008_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of S-like RNase vs. Ensembl Human
Match: AL159163.1 (novel protein)

HSP 1 Score: 81.2629 bits (199), Expect = 1.144e-17
Identity = 45/131 (34.35%), Postives = 67/131 (51.15%), Query Frame = 1
Query:  121 WDYLTYTLLWPQTFCKYNQCNYDKTKVTGWNIHGLWPSNITGKDPSKCKGDPFNINDLNSIYPDLVVQWANLL-EFTNPAEFWTHEWTKHGLCAILPPLFTNELSYFSRSLQLKQFVSLDKILSDNDIQPS 510
            W  L     WP+T C+  Q N  +     W IHGLWP    G + S     PFN+ ++  + P++   W +++  F N + FW HEW KHG CA       ++  YF RSL+L + + L+ +L    I+PS
Sbjct:   15 WKKLIMVQHWPETVCEKIQ-NDCRDPPDYWTIHGLWPDKSEGCNRSW----PFNLEEIKDLLPEMRAYWPDVIHSFPNRSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGIKPS 140          
BLAST of S-like RNase vs. Ensembl Human
Match: RNASET2 (ribonuclease T2 [Source:HGNC Symbol;Acc:HGNC:21686])

HSP 1 Score: 82.0333 bits (201), Expect = 2.527e-17
Identity = 44/132 (33.33%), Postives = 67/132 (50.76%), Query Frame = 1
Query:  118 NWDYLTYTLLWPQTFCKYNQCNYDKTKVTGWNIHGLWPSNITGKDPSKCKGDPFNINDLNSIYPDLVVQWANLL-EFTNPAEFWTHEWTKHGLCAILPPLFTNELSYFSRSLQLKQFVSLDKILSDNDIQPS 510
             W  L     WP+T C+  Q N  +     W IHGLWP    G +    +  PFN+ ++  + P++   W +++  F N + FW HEW KHG CA       ++  YF RSL+L + + L+ +L    I+PS
Sbjct:   33 EWKKLIMVQHWPETVCEKIQ-NDCRDPPDYWTIHGLWPDKSEGCN----RSWPFNLEEIKDLLPEMRAYWPDVIHSFPNRSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGIKPS 159          
BLAST of S-like RNase vs. Ensembl Human
Match: RNASET2 (ribonuclease T2 [Source:HGNC Symbol;Acc:HGNC:21686])

HSP 1 Score: 82.0333 bits (201), Expect = 2.527e-17
Identity = 44/132 (33.33%), Postives = 67/132 (50.76%), Query Frame = 1
Query:  118 NWDYLTYTLLWPQTFCKYNQCNYDKTKVTGWNIHGLWPSNITGKDPSKCKGDPFNINDLNSIYPDLVVQWANLL-EFTNPAEFWTHEWTKHGLCAILPPLFTNELSYFSRSLQLKQFVSLDKILSDNDIQPS 510
             W  L     WP+T C+  Q N  +     W IHGLWP    G +    +  PFN+ ++  + P++   W +++  F N + FW HEW KHG CA       ++  YF RSL+L + + L+ +L    I+PS
Sbjct:   33 EWKKLIMVQHWPETVCEKIQ-NDCRDPPDYWTIHGLWPDKSEGCN----RSWPFNLEEIKDLLPEMRAYWPDVIHSFPNRSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGIKPS 159          
BLAST of S-like RNase vs. Ensembl Human
Match: RNASET2 (ribonuclease T2 [Source:HGNC Symbol;Acc:HGNC:21686])

HSP 1 Score: 81.6481 bits (200), Expect = 2.711e-17
Identity = 44/132 (33.33%), Postives = 67/132 (50.76%), Query Frame = 1
Query:  118 NWDYLTYTLLWPQTFCKYNQCNYDKTKVTGWNIHGLWPSNITGKDPSKCKGDPFNINDLNSIYPDLVVQWANLL-EFTNPAEFWTHEWTKHGLCAILPPLFTNELSYFSRSLQLKQFVSLDKILSDNDIQPS 510
             W  L     WP+T C+  Q N  +     W IHGLWP    G +    +  PFN+ ++  + P++   W +++  F N + FW HEW KHG CA       ++  YF RSL+L + + L+ +L    I+PS
Sbjct:   33 EWKKLIMVQHWPETVCEKIQ-NDCRDPPDYWTIHGLWPDKSEGCN----RSWPFNLEEIKDLLPEMRAYWPDVIHSFPNRSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGIKPS 159          
BLAST of S-like RNase vs. Ensembl Human
Match: RNASET2 (ribonuclease T2 [Source:HGNC Symbol;Acc:HGNC:21686])

HSP 1 Score: 79.337 bits (194), Expect = 1.186e-16
Identity = 42/122 (34.43%), Postives = 65/122 (53.28%), Query Frame = 1
Query:  148 WPQTFCKYNQCNYDKTKVTGWNIHGLWPSNITGKDPSKCKGDPFNINDLNSIYPDLVVQWANLL-EFTNPAEFWTHEWTKHGLCAILPPLFTNELSYFSRSLQLKQFVSLDKILSDNDIQPS 510
            WP+T C+  Q N  +     W IHGLWP    G +    +  PFN+ ++  + P++   W +++  F N + FW HEW KHG CA       ++  YF RSL+L + + L+ +L    I+PS
Sbjct:    5 WPETVCEKIQ-NDCRDPPDYWTIHGLWPDKSEGCN----RSWPFNLEEIKDLLPEMRAYWPDVIHSFPNRSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGIKPS 121          
BLAST of S-like RNase vs. Ensembl Celegans
Match: rnst-2 (pep chromosome:WBcel235:V:1061595:1067908:1 gene:WBGene00019624.1 transcript:K10C9.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:rnst-2)

HSP 1 Score: 91.2781 bits (225), Expect = 6.665e-21
Identity = 61/209 (29.19%), Postives = 97/209 (46.41%), Query Frame = 1
Query:  121 WDYLTYTLLWPQTFCKYNQCNYDKT-----KVTGWNIHGLWPSNITGKDPSKCKGDP--FNINDLNSIYPDLVVQWANLLEFTNPAEFWTHEWTKHGLCAILPPLFTNELSYFSRSLQLKQFVSLDKILSDNDIQPSDDKQYDTDXXXXXXXXXXXXXXXXECI--KIEDDYYLSAVEICFDHQLKPINCPK-HHHDNVDSQLKDLIHQ 717
            +DYL +T ++P   C+ +  +  ++         W+IHGLWP+   G  P  C+G P  F+ N + SI   LVV W NL        FW HE+ KHG CA    LF +EL+YF+  +++  F S+D       + PS+     +D  +       G   +  C+  K    + L  + +C +  L   +CP    H N  S+ +  I +
Sbjct:   23 FDYLMFTTIYPTAVCRADDDSVPESCEIPSGTPQWSIHGLWPNFENGSYPQNCRGTPRHFDENLIKSIEDRLVVVWPNLYPKKTIQSFWKHEYDKHGTCAQSEKLFESELAYFTEVMKV--FDSIDVAGGLKSVGPSEKPITSSDLKNALSGVTSGKTFQFHCLRDKKTKQFLLGDIRLCLNKDLTIRDCPTDGKHPNRVSRFERSIGR 229          
BLAST of S-like RNase vs. Ensembl Fly
Match: RNaseX25 (gene:FBgn0010406 transcript:FBtr0076752)

HSP 1 Score: 86.2705 bits (212), Expect = 8.856e-19
Identity = 61/192 (31.77%), Postives = 91/192 (47.40%), Query Frame = 1
Query:  118 NWDYLTYTLLWPQTFCKY-------NQCNYDKTKVTGWNIHGLWPSNITGKDPSKCKGDP-FNINDLNSIYPDLVVQWANLLEFTNPAEFWTHEWTKHGLCAILPPLFTNELSYFSRSLQLKQFVSLDKILSDNDIQPSDDKQYDTDXXXXXXXXXXXXXXXXECI--KIEDDYYLSAVEICFDHQLKPINC 663
            NWD L +T  WP T C +        +C+  + K   W IHG+WP+ +    P+ C     F+ + LN I   L   W +L    +    W HEW KHG CA+L     NEL YF + L  ++   + +IL  +DI P  D      +++ ++   LG  P + C+        YLS + ICF   L+ I+C
Sbjct:   75 NWDVLIFTQQWPVTTCYHWREENPDQECSLPQKK-EFWTIHGIWPTKLHQMGPNFCNNSANFDPSKLNPIEDRLETFWPDLKGMDSTEWLWKHEWQKHGTCAMLVEELDNELKYFEQGLTWREEYIMSRILDASDIHP--DSNNTVAAINNAIVKALGKNPSIHCLYDGKHGISYLSEIRICFSKSLELIDC 263          
BLAST of S-like RNase vs. Ensembl Zebrafish
Match: rnaset2 (ribonuclease T2 [Source:NCBI gene;Acc:791890])

HSP 1 Score: 95.5153 bits (236), Expect = 1.433e-22
Identity = 77/228 (33.77%), Postives = 112/228 (49.12%), Query Frame = 1
Query:  115 ANWDYLTYTLLWPQTFCKYNQCNYDKTKVTGWNIHGLWPSNITGKDPSKCKGD-PFNINDLNSIYPDLVVQWANLLEFTNPAEFWTHEWTKHGLCAILPPLFTNELSYFSRSLQLKQFVSLDKILSDNDIQPSDDKQYDTDXXXXXXXXXXXXXXXXECIKIEDD---YYLSAVEICFDHQLKPINCPKHHHDNVDSQLKDLIHQIFQKVEGHLLLS--DATKPINIP 780
              W  L  T  WPQTFCK   C   KT  + W +HGLWP+  TG    +C     FN + +  I P++   W +LLE ++P +FW +EWTKHG CA       +E  YF ++L+L     L+ +L  N I PS +K Y  + V ++++S  GV PK++C+          L  +EIC D   + + C K   D   + L  +       V G   LS  D + P+  P
Sbjct:   25 GEWTKLILTQHWPQTFCKMEHC---KTDFSYWTLHGLWPN--TG---VRCNTSWHFNASLIEDILPEMEKFWPDLLEPSSP-KFWNYEWTKHGTCAAKSESLNSEHKYFGKALELYHKFDLNSVLLKNQIVPS-EKHYTLEDVEEAITSAYGVKPKIQCVHPGQGGQVQILGQIEICVDRDFQLMGCEKSSEDTWSNDLPTV------PVSGQSGLSVCDHSMPVYYP 236          
BLAST of S-like RNase vs. Ensembl Zebrafish
Match: rnaset2 (ribonuclease T2 [Source:NCBI gene;Acc:791890])

HSP 1 Score: 95.5153 bits (236), Expect = 1.433e-22
Identity = 77/228 (33.77%), Postives = 112/228 (49.12%), Query Frame = 1
Query:  115 ANWDYLTYTLLWPQTFCKYNQCNYDKTKVTGWNIHGLWPSNITGKDPSKCKGD-PFNINDLNSIYPDLVVQWANLLEFTNPAEFWTHEWTKHGLCAILPPLFTNELSYFSRSLQLKQFVSLDKILSDNDIQPSDDKQYDTDXXXXXXXXXXXXXXXXECIKIEDD---YYLSAVEICFDHQLKPINCPKHHHDNVDSQLKDLIHQIFQKVEGHLLLS--DATKPINIP 780
              W  L  T  WPQTFCK   C   KT  + W +HGLWP+  TG    +C     FN + +  I P++   W +LLE ++P +FW +EWTKHG CA       +E  YF ++L+L     L+ +L  N I PS +K Y  + V ++++S  GV PK++C+          L  +EIC D   + + C K   D   + L  +       V G   LS  D + P+  P
Sbjct:   25 GEWTKLILTQHWPQTFCKMEHC---KTDFSYWTLHGLWPN--TG---VRCNTSWHFNASLIEDILPEMEKFWPDLLEPSSP-KFWNYEWTKHGTCAAKSESLNSEHKYFGKALELYHKFDLNSVLLKNQIVPS-EKHYTLEDVEEAITSAYGVKPKIQCVHPGQGGQVQILGQIEICVDRDFQLMGCEKSSEDTWSNDLPTV------PVSGQSGLSVCDHSMPVYYP 236          
BLAST of S-like RNase vs. Ensembl Zebrafish
Match: rnaset2 (ribonuclease T2 [Source:NCBI gene;Acc:791890])

HSP 1 Score: 95.5153 bits (236), Expect = 1.433e-22
Identity = 77/228 (33.77%), Postives = 112/228 (49.12%), Query Frame = 1
Query:  115 ANWDYLTYTLLWPQTFCKYNQCNYDKTKVTGWNIHGLWPSNITGKDPSKCKGD-PFNINDLNSIYPDLVVQWANLLEFTNPAEFWTHEWTKHGLCAILPPLFTNELSYFSRSLQLKQFVSLDKILSDNDIQPSDDKQYDTDXXXXXXXXXXXXXXXXECIKIEDD---YYLSAVEICFDHQLKPINCPKHHHDNVDSQLKDLIHQIFQKVEGHLLLS--DATKPINIP 780
              W  L  T  WPQTFCK   C   KT  + W +HGLWP+  TG    +C     FN + +  I P++   W +LLE ++P +FW +EWTKHG CA       +E  YF ++L+L     L+ +L  N I PS +K Y  + V ++++S  GV PK++C+          L  +EIC D   + + C K   D   + L  +       V G   LS  D + P+  P
Sbjct:   25 GEWTKLILTQHWPQTFCKMEHC---KTDFSYWTLHGLWPN--TG---VRCNTSWHFNASLIEDILPEMEKFWPDLLEPSSP-KFWNYEWTKHGTCAAKSESLNSEHKYFGKALELYHKFDLNSVLLKNQIVPS-EKHYTLEDVEEAITSAYGVKPKIQCVHPGQGGQVQILGQIEICVDRDFQLMGCEKSSEDTWSNDLPTV------PVSGQSGLSVCDHSMPVYYP 236          
BLAST of S-like RNase vs. Ensembl Zebrafish
Match: rnaset2 (ribonuclease T2 [Source:NCBI gene;Acc:791890])

HSP 1 Score: 95.5153 bits (236), Expect = 1.433e-22
Identity = 77/228 (33.77%), Postives = 112/228 (49.12%), Query Frame = 1
Query:  115 ANWDYLTYTLLWPQTFCKYNQCNYDKTKVTGWNIHGLWPSNITGKDPSKCKGD-PFNINDLNSIYPDLVVQWANLLEFTNPAEFWTHEWTKHGLCAILPPLFTNELSYFSRSLQLKQFVSLDKILSDNDIQPSDDKQYDTDXXXXXXXXXXXXXXXXECIKIEDD---YYLSAVEICFDHQLKPINCPKHHHDNVDSQLKDLIHQIFQKVEGHLLLS--DATKPINIP 780
              W  L  T  WPQTFCK   C   KT  + W +HGLWP+  TG    +C     FN + +  I P++   W +LLE ++P +FW +EWTKHG CA       +E  YF ++L+L     L+ +L  N I PS +K Y  + V ++++S  GV PK++C+          L  +EIC D   + + C K   D   + L  +       V G   LS  D + P+  P
Sbjct:   25 GEWTKLILTQHWPQTFCKMEHC---KTDFSYWTLHGLWPN--TG---VRCNTSWHFNASLIEDILPEMEKFWPDLLEPSSP-KFWNYEWTKHGTCAAKSESLNSEHKYFGKALELYHKFDLNSVLLKNQIVPS-EKHYTLEDVEEAITSAYGVKPKIQCVHPGQGGQVQILGQIEICVDRDFQLMGCEKSSEDTWSNDLPTV------PVSGQSGLSVCDHSMPVYYP 236          
BLAST of S-like RNase vs. Ensembl Zebrafish
Match: rnaset2 (ribonuclease T2 [Source:NCBI gene;Acc:791890])

HSP 1 Score: 95.5153 bits (236), Expect = 1.433e-22
Identity = 77/228 (33.77%), Postives = 112/228 (49.12%), Query Frame = 1
Query:  115 ANWDYLTYTLLWPQTFCKYNQCNYDKTKVTGWNIHGLWPSNITGKDPSKCKGD-PFNINDLNSIYPDLVVQWANLLEFTNPAEFWTHEWTKHGLCAILPPLFTNELSYFSRSLQLKQFVSLDKILSDNDIQPSDDKQYDTDXXXXXXXXXXXXXXXXECIKIEDD---YYLSAVEICFDHQLKPINCPKHHHDNVDSQLKDLIHQIFQKVEGHLLLS--DATKPINIP 780
              W  L  T  WPQTFCK   C   KT  + W +HGLWP+  TG    +C     FN + +  I P++   W +LLE ++P +FW +EWTKHG CA       +E  YF ++L+L     L+ +L  N I PS +K Y  + V ++++S  GV PK++C+          L  +EIC D   + + C K   D   + L  +       V G   LS  D + P+  P
Sbjct:   25 GEWTKLILTQHWPQTFCKMEHC---KTDFSYWTLHGLWPN--TG---VRCNTSWHFNASLIEDILPEMEKFWPDLLEPSSP-KFWNYEWTKHGTCAAKSESLNSEHKYFGKALELYHKFDLNSVLLKNQIVPS-EKHYTLEDVEEAITSAYGVKPKIQCVHPGQGGQVQILGQIEICVDRDFQLMGCEKSSEDTWSNDLPTV------PVSGQSGLSVCDHSMPVYYP 236          
BLAST of S-like RNase vs. Ensembl Xenopus
Match: rnaset2 (ribonuclease T2 [Source:NCBI gene;Acc:780173])

HSP 1 Score: 69.3218 bits (168), Expect = 3.579e-13
Identity = 47/152 (30.92%), Postives = 67/152 (44.08%), Query Frame = 1
Query:  208 WNIHGLWPSNITGKDPSKCKGDPFNINDLNSIYPDLVVQWANLLEFTNPAEFWTHEWTKHGLCAILPPLFTNELSYFSRSLQLKQFVSLDKILSDNDIQPSDDKQYDTDXXXXXXXXXXXXXXXXECIKIEDDYYLSAVEICFDHQLKPINC 663
            W +HGLWP      + S     PF  +++  I P+L   W ++L   N ++ W HEW KHG CA        +  YFS+ L+L   V L+ +L  + I PS  K Y                    C   E+   L  +EICF  +L+  NC
Sbjct:   60 WTLHGLWPDKAQMCNNSW----PFEYSEIQDILPELNHYWPDILH-PNKSQLWKHEWQKHGTCAASLECLNTQHKYFSKGLELYTKVDLNSVLEKSGIVPS-TKYYQV-----------------RCYLGENVQTLGQIEICFTKELQLRNC 188          
BLAST of S-like RNase vs. Ensembl Mouse
Match: Rnaset2a (ribonuclease T2A [Source:MGI Symbol;Acc:MGI:1915445])

HSP 1 Score: 76.2554 bits (186), Expect = 1.875e-15
Identity = 43/132 (32.58%), Postives = 67/132 (50.76%), Query Frame = 1
Query:  118 NWDYLTYTLLWPQTFCKYNQCNYDKTKVTGWNIHGLWPSNITGKDPSKCKGDPFNINDLNSIYPDLVVQWANLL-EFTNPAEFWTHEWTKHGLCAILPPLFTNELSYFSRSLQLKQFVSLDKILSDNDIQPS 510
             W  L  T  WP T CK  + N  +  +  W IHGLWP      + S      FN++++  +  D+ + W +++   +N ++FW HEW KHG CA       +E  YF +SL L + + L+ +L    I+PS
Sbjct:   38 EWKKLILTQHWPPTVCK--EVNSCQDSLDYWTIHGLWPDRAEDCNQSW----HFNLDEIKDLLRDMKIYWPDVIHRSSNRSQFWKHEWVKHGTCAAQVDALNSEKKYFGKSLDLYKQIDLNSVLQKFGIKPS 163          
BLAST of S-like RNase vs. Ensembl Mouse
Match: Rnaset2a (ribonuclease T2A [Source:MGI Symbol;Acc:MGI:1915445])

HSP 1 Score: 76.2554 bits (186), Expect = 1.875e-15
Identity = 43/132 (32.58%), Postives = 67/132 (50.76%), Query Frame = 1
Query:  118 NWDYLTYTLLWPQTFCKYNQCNYDKTKVTGWNIHGLWPSNITGKDPSKCKGDPFNINDLNSIYPDLVVQWANLL-EFTNPAEFWTHEWTKHGLCAILPPLFTNELSYFSRSLQLKQFVSLDKILSDNDIQPS 510
             W  L  T  WP T CK  + N  +  +  W IHGLWP      + S      FN++++  +  D+ + W +++   +N ++FW HEW KHG CA       +E  YF +SL L + + L+ +L    I+PS
Sbjct:   38 EWKKLILTQHWPPTVCK--EVNSCQDSLDYWTIHGLWPDRAEDCNQSW----HFNLDEIKDLLRDMKIYWPDVIHRSSNRSQFWKHEWVKHGTCAAQVDALNSEKKYFGKSLDLYKQIDLNSVLQKFGIKPS 163          
BLAST of S-like RNase vs. Ensembl Mouse
Match: Gm49673 (predicted gene, 49673 [Source:MGI Symbol;Acc:MGI:6215117])

HSP 1 Score: 76.2554 bits (186), Expect = 1.875e-15
Identity = 43/132 (32.58%), Postives = 67/132 (50.76%), Query Frame = 1
Query:  118 NWDYLTYTLLWPQTFCKYNQCNYDKTKVTGWNIHGLWPSNITGKDPSKCKGDPFNINDLNSIYPDLVVQWANLL-EFTNPAEFWTHEWTKHGLCAILPPLFTNELSYFSRSLQLKQFVSLDKILSDNDIQPS 510
             W  L  T  WP T CK  + N  +  +  W IHGLWP      + S      FN++++  +  D+ + W +++   +N ++FW HEW KHG CA       +E  YF +SL L + + L+ +L    I+PS
Sbjct:   38 EWKKLILTQHWPPTVCK--EVNSCQDSLDYWTIHGLWPDRAEDCNQSW----HFNLDEIKDLLRDMKIYWPDVIHRSSNRSQFWKHEWVKHGTCAAQVDALNSEKKYFGKSLDLYKQIDLNSVLQKFGIKPS 163          
BLAST of S-like RNase vs. Ensembl Mouse
Match: Gm49721 (predicted gene, 49721 [Source:MGI Symbol;Acc:MGI:6215195])

HSP 1 Score: 76.2554 bits (186), Expect = 1.875e-15
Identity = 43/132 (32.58%), Postives = 67/132 (50.76%), Query Frame = 1
Query:  118 NWDYLTYTLLWPQTFCKYNQCNYDKTKVTGWNIHGLWPSNITGKDPSKCKGDPFNINDLNSIYPDLVVQWANLL-EFTNPAEFWTHEWTKHGLCAILPPLFTNELSYFSRSLQLKQFVSLDKILSDNDIQPS 510
             W  L  T  WP T CK  + N  +  +  W IHGLWP      + S      FN++++  +  D+ + W +++   +N ++FW HEW KHG CA       +E  YF +SL L + + L+ +L    I+PS
Sbjct:   38 EWKKLILTQHWPPTVCK--EVNSCQDSLDYWTIHGLWPDRAEDCNQSW----HFNLDEIKDLLRDMKIYWPDVIHRSSNRSQFWKHEWVKHGTCAAQVDALNSEKKYFGKSLDLYKQIDLNSVLQKFGIKPS 163          
BLAST of S-like RNase vs. Ensembl Mouse
Match: Rnaset2b (ribonuclease T2B [Source:MGI Symbol;Acc:MGI:3702087])

HSP 1 Score: 76.2554 bits (186), Expect = 1.875e-15
Identity = 43/132 (32.58%), Postives = 67/132 (50.76%), Query Frame = 1
Query:  118 NWDYLTYTLLWPQTFCKYNQCNYDKTKVTGWNIHGLWPSNITGKDPSKCKGDPFNINDLNSIYPDLVVQWANLL-EFTNPAEFWTHEWTKHGLCAILPPLFTNELSYFSRSLQLKQFVSLDKILSDNDIQPS 510
             W  L  T  WP T CK  + N  +  +  W IHGLWP      + S      FN++++  +  D+ + W +++   +N ++FW HEW KHG CA       +E  YF +SL L + + L+ +L    I+PS
Sbjct:   38 EWKKLILTQHWPPTVCK--EVNSCQDSLDYWTIHGLWPDRAEDCNQSW----HFNLDEIKDLLRDMKIYWPDVIHRSSNRSQFWKHEWVKHGTCAAQVDALNSEKKYFGKSLDLYKQIDLNSVLQKFGIKPS 163          
BLAST of S-like RNase vs. UniProt/SwissProt
Match: sp|Q7M456|RNOY_CRAGI (Ribonuclease Oy OS=Crassostrea gigas OX=29159 PE=1 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 6.647e-29
Identity = 67/189 (35.45%), Postives = 96/189 (50.79%), Query Frame = 1
Query:  118 NWDYLTYTLLWPQTFCKYNQCNYDKTKVTGWNIHGLWPSNIT-GKDPSKCKGD-PFNINDLNSIYPDLVVQWANLLEFTNPAEFWTHEWTKHGLCAILPPLFTNELSYFSRSLQLKQFVSLDKILSDNDIQPSDDKQYDTDXXXXXXXXXXXXXXXXECI---KIEDDYYLSAVEICFDHQLKPINCPK 669
            +W+Y T+   WP   C  ++  +    V GW IHGLWPS+ T  K P  C G  PF+IN++  + P+L   W NL   T    FW HEW+KHG CA   P  +NEL YF   L+L    ++ +IL +  I PS    Y  +    +V  +LGV   +EC+   +      L  + IC   + + I+C K
Sbjct:    2 DWNYFTFAQQWPIAVCAEHKSCFIPDSVVGWGIHGLWPSSDTESKGPENCNGSWPFDINNVMPLVPELKKYWPNLYPDTKANSFWEHEWSKHGTCATSLPATSNELKYFGMGLKLHAKYNISRILVNQGILPSKTAGYMINETEAAVKRELGVDAVIECVYDKEKTKKQLLYEISICLTKEFELISCNK 190          
BLAST of S-like RNase vs. UniProt/SwissProt
Match: sp|B8XY56|RNT2_DANRE (Ribonuclease T2 OS=Danio rerio OX=7955 GN=rnaset2 PE=2 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 1.082e-21
Identity = 77/228 (33.77%), Postives = 112/228 (49.12%), Query Frame = 1
Query:  115 ANWDYLTYTLLWPQTFCKYNQCNYDKTKVTGWNIHGLWPSNITGKDPSKCKGD-PFNINDLNSIYPDLVVQWANLLEFTNPAEFWTHEWTKHGLCAILPPLFTNELSYFSRSLQLKQFVSLDKILSDNDIQPSDDKQYDTDXXXXXXXXXXXXXXXXECIKIEDD---YYLSAVEICFDHQLKPINCPKHHHDNVDSQLKDLIHQIFQKVEGHLLLS--DATKPINIP 780
              W  L  T  WPQTFCK   C   KT  + W +HGLWP+  TG    +C     FN + +  I P++   W +LLE ++P +FW +EWTKHG CA       +E  YF ++L+L     L+ +L  N I PS +K Y  + V ++++S  GV PK++C+          L  +EIC D   + + C K   D   + L  +       V G   LS  D + P+  P
Sbjct:   25 GEWTKLILTQHWPQTFCKMEHC---KTDFSYWTLHGLWPN--TG---VRCNTSWHFNASLIEDILPEMEKFWPDLLEPSSP-KFWNYEWTKHGTCAAKSESLNSEHKYFGKALELYHKFDLNSVLLKNQIVPS-EKHYTLEDVEEAITSAYGVKPKIQCVHPGQGGQVQILGQIEICVDRDFQLMGCEKSSEDTWSNDLPTV------PVSGQSGLSVCDHSMPVYYP 236          
BLAST of S-like RNase vs. UniProt/SwissProt
Match: sp|O61887|RNST2_CAEEL (Ribonuclease T2 protein rnst-2 OS=Caenorhabditis elegans OX=6239 GN=rnst-2 PE=1 SV=2)

HSP 1 Score: 91.2781 bits (225), Expect = 8.478e-20
Identity = 61/209 (29.19%), Postives = 97/209 (46.41%), Query Frame = 1
Query:  121 WDYLTYTLLWPQTFCKYNQCNYDKT-----KVTGWNIHGLWPSNITGKDPSKCKGDP--FNINDLNSIYPDLVVQWANLLEFTNPAEFWTHEWTKHGLCAILPPLFTNELSYFSRSLQLKQFVSLDKILSDNDIQPSDDKQYDTDXXXXXXXXXXXXXXXXECI--KIEDDYYLSAVEICFDHQLKPINCPK-HHHDNVDSQLKDLIHQ 717
            +DYL +T ++P   C+ +  +  ++         W+IHGLWP+   G  P  C+G P  F+ N + SI   LVV W NL        FW HE+ KHG CA    LF +EL+YF+  +++  F S+D       + PS+     +D  +       G   +  C+  K    + L  + +C +  L   +CP    H N  S+ +  I +
Sbjct:   23 FDYLMFTTIYPTAVCRADDDSVPESCEIPSGTPQWSIHGLWPNFENGSYPQNCRGTPRHFDENLIKSIEDRLVVVWPNLYPKKTIQSFWKHEYDKHGTCAQSEKLFESELAYFTEVMKV--FDSIDVAGGLKSVGPSEKPITSSDLKNALSGVTSGKTFQFHCLRDKKTKQFLLGDIRLCLNKDLTIRDCPTDGKHPNRVSRFERSIGR 229          
BLAST of S-like RNase vs. UniProt/SwissProt
Match: sp|Q7M438|RNDI_DICDI (Ribonuclease DdI OS=Dictyostelium discoideum OX=44689 GN=ddiA PE=1 SV=3)

HSP 1 Score: 85.5001 bits (210), Expect = 3.738e-18
Identity = 57/186 (30.65%), Postives = 95/186 (51.08%), Query Frame = 1
Query:  115 ANWDYLTYTLLWPQTFCKYNQCNYDKTKVTGWNIHGLWPSNITGKDPSKCKGDPFNINDLNSIYPDLVVQWANLLEFTNP-AEFWTHEWTKHGLCAILPPLFTNELSYFSRSLQLKQFVSLDKILSDNDIQPSDDKQYDTDXXXXXXXXXXXXXXXXECIKIEDDYYLSAVEICFD-HQLKPINCP 666
             ++D+  +   W  ++C    C  +K +   + IHGLWP N  G  PS C G  FN+N +  +   L   W +L   T P  +FWTHE++KHG C+I  P+ T+   YF+  ++L    ++   L   +I PSD   Y    ++ ++++  G  P ++C   +    LS V +C D + L  ++CP
Sbjct:   30 GDFDFYLFVQQWIYSYCDSQTCIQNKER-EAFTIHGLWPENSDGSYPSFCSGPSFNVNAIQDLEDQLNFDWPSL---TGPNTDFWTHEFSKHGTCSITGPI-TDIHDYFATGIKLYTEFNITAALESENIYPSDSNTYKPVDITNAITTHFGGKPGIQCSSGQ----LSTVAVCIDKNSLSIMDCP 206          
BLAST of S-like RNase vs. UniProt/SwissProt
Match: sp|P42815|RNS3_ARATH (Ribonuclease 3 OS=Arabidopsis thaliana OX=3702 GN=RNS3 PE=2 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 3.390e-17
Identity = 66/202 (32.67%), Postives = 101/202 (50.00%), Query Frame = 1
Query:  118 NWDYLTYTLLWPQTFC-KYNQCNYDKTK--VTGWNIHGLWPSNITGKDPSKCKGDP-FNINDLNSIYPDLVVQWANLLEFTNPA-EFWTHEWTKHGLCAILPPLFTNELSYFSRSLQLKQFVSLDKILSDNDIQPSDDKQYDTDXXXXXXXXXXXXXXXXECIK-IEDDYYLSAVEICFDHQL-KPINCPKHHHDNVDSQLK 702
            ++D+  + L WP  +C   + C Y +T      + IHGLWP+  TG  P  C  D  F+   ++ +  DL  +W  L   +N   +FWTHEW KHG CA       ++  YF   L+LKQ  +L   L++  I+P DDK Y+   +  ++   +G  P +EC K    +  L  + +C D    K INCP   H   DS+++
Sbjct:   21 DFDFFYFVLQWPGAYCDSRHSCCYPQTGKPAADFGIHGLWPNYKTGGWPQNCNPDSRFDDLRVSDLMSDLQREWPTLSCPSNDGMKFWTHEWEKHGTCAESE---LDQHDYFEAGLKLKQKANLLHALTNAGIKP-DDKFYEMKDIENTIKQVVGFAPGIECNKDSSHNSQLYQIYLCVDTSASKFINCPVMPHGRCDSRVQ 218          
BLAST of S-like RNase vs. TrEMBL
Match: A0A4Z2DFD7 (Ribonuclease Oy isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_001528 PE=3 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 8.589e-29
Identity = 71/192 (36.98%), Postives = 102/192 (53.12%), Query Frame = 1
Query:  121 WDYLTYTLLWPQTFCKYNQCNYDKTKVTGWNIHGLWPSNITGKDPSKCKGD-PFNINDLNSIYPDLVVQWANLLEFTNPAEFWTHEWTKHGLCAILPPLFTNELSYFSRSLQLKQFVSLDKILSDNDIQPSDDKQYDTDXXXXXXXXXXXXXXXXECIKI-EDDYYLSAVEICFDHQLKPINCPKHHHDNVD 690
            WDYL Y+L WP T+C  + C      +  +NIHGLWPS      P+ C    PF I+ +  IY +L  +WANL +F +P  FW HEW KHG+CA+  P+ +NEL YF+ SL +K  V+L + L    I PSD      D +   +     V   + C  I      L+ + +C +  ++ I+CP   H N+D
Sbjct:   24 WDYLVYSLEWPPTYCFTHTCKL-PYNINNFNIHGLWPSIWPSGSPTNCPNHMPFEIDTIKPIYTELQKEWANLDDFDDPKAFWKHEWQKHGVCALSDPIISNELDYFNISLIMKSKVNLLRRLESIKIIPSDSVTLKRDVLLNQLKKLFNVDVLMYCFLIHHKPAKLAEIRLCLNPSMEFISCPSSIH-NID 213          
BLAST of S-like RNase vs. TrEMBL
Match: A0A4Z2DG04 (Ribonuclease Oy isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_001528 PE=3 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 1.283e-28
Identity = 71/192 (36.98%), Postives = 102/192 (53.12%), Query Frame = 1
Query:  121 WDYLTYTLLWPQTFCKYNQCNYDKTKVTGWNIHGLWPSNITGKDPSKCKGD-PFNINDLNSIYPDLVVQWANLLEFTNPAEFWTHEWTKHGLCAILPPLFTNELSYFSRSLQLKQFVSLDKILSDNDIQPSDDKQYDTDXXXXXXXXXXXXXXXXECIKI-EDDYYLSAVEICFDHQLKPINCPKHHHDNVD 690
            WDYL Y+L WP T+C  + C      +  +NIHGLWPS      P+ C    PF I+ +  IY +L  +WANL +F +P  FW HEW KHG+CA+  P+ +NEL YF+ SL +K  V+L + L    I PSD      D +   +     V   + C  I      L+ + +C +  ++ I+CP   H N+D
Sbjct:   44 WDYLVYSLEWPPTYCFTHTCKL-PYNINNFNIHGLWPSIWPSGSPTNCPNHMPFEIDTIKPIYTELQKEWANLDDFDDPKAFWKHEWQKHGVCALSDPIISNELDYFNISLIMKSKVNLLRRLESIKIIPSDSVTLKRDVLLNQLKKLFNVDVLMYCFLIHHKPAKLAEIRLCLNPSMEFISCPSSIH-NID 233          
BLAST of S-like RNase vs. TrEMBL
Match: G4V5B9 (Putative ribonuclease t2 OS=Schistosoma mansoni OX=6183 GN=Smp_158430 PE=3 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 6.691e-28
Identity = 74/210 (35.24%), Postives = 110/210 (52.38%), Query Frame = 1
Query:  121 WDYLTYTLLWPQTFCKYNQCNYDKTKVTGWNIHGLWPSNITGKDPSKCKGD-PFNINDLNSIYPDLVVQWANLLEFTNPAEFWTHEWTKHGLCAILP-PLFTNELSYFSRSLQLKQFVSLDKILSDNDIQPSDDKQYDTDXXXXXXXXXXXXXXXXEC-IKIEDDYYLSAVEICFDHQLKPINCPKHHHDNVDSQLKDLIHQIFQKVEGH 741
            WD+  ++L WP T+C    C    + +  +NIHGLWPS     +P  C    PF I  +  IY DL  QWANL++F NP +FW HEW+KHG+CAI   PL +NEL YF+ SL +K  V+L   L    I P++      D +   + +   V   + C ++      LS + IC +  L+ I+C     + ++ QL    +  ++ V GH
Sbjct:   24 WDHFVFSLEWPPTYCFIQTCKIPYS-INDFNIHGLWPSIWPHTEPKNCSNRTPFRIELIKPIYNDLQKQWANLIDFDNPEDFWKHEWSKHGVCAISDHPLISNELDYFNISLAIKSRVNLLSRLESVSITPNNLVTLKRDMLLDQLKNLFSVNVLIYCSMRKHQPGRLSEIRICLNPSLEFIDCFTSSANKINHQL--FSNHFYKTVYGH 230          
BLAST of S-like RNase vs. TrEMBL
Match: A0A4Z2DFD4 (Ribonuclease Oy OS=Schistosoma japonicum OX=6182 GN=EWB00_001525 PE=3 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 1.599e-27
Identity = 68/187 (36.36%), Postives = 100/187 (53.48%), Query Frame = 1
Query:  115 ANWDYLTYTLLWPQTFCKYNQCNYDKTKVTGWNIHGLWPSNITGKDPSKCKG-DPFNINDLNSIYPDLVVQWANLLEFTNPAEFWTHEWTKHGLCAILPPLFTNELSYFSRSLQLKQFVSLDKILSDNDIQPSDDKQYDTDXXXXXXXXXXXXXXXXEC-IKIEDDYY--LSAVEICFDHQLKPINC 663
             +W+Y  +TL WP TFC Y +C      +  + IHGLWPS   GK P+ C     F+I+ L SI   L   WANLL + NP+ FW HEW KHG C I   L +NEL+YF+ +++LK+ ++L   L    IQP++    +       +     V   ++C  K   D    L+ +  CF+ +L+ I+C
Sbjct:   26 GDWNYFVFTLTWPPTFCSYKKCKLPPG-LNDFTIHGLWPSIWPGKQPTNCSAHSRFDIHRLQSIRNKLDYTWANLLNYENPSPFWEHEWYKHGQCGIENVLISNELNYFNTAVELKEKLNLLTQLKSYGIQPNNSVVIEKSHFLNVLKQAYNVSAVVKCKSKRRKDKLTKLAEIRFCFNVKLQLIDC 211          
BLAST of S-like RNase vs. TrEMBL
Match: Q5BVY2 (SJCHGC07916 protein (Fragment) OS=Schistosoma japonicum OX=6182 PE=2 SV=2)

HSP 1 Score: 115.161 bits (287), Expect = 2.692e-27
Identity = 60/139 (43.17%), Postives = 80/139 (57.55%), Query Frame = 1
Query:  121 WDYLTYTLLWPQTFCKYNQCNYDKTKVTGWNIHGLWPSNITGKDPSKCKGD-PFNINDLNSIYPDLVVQWANLLEFTNPAEFWTHEWTKHGLCAILPPLFTNELSYFSRSLQLKQFVSLDKILSDNDIQPSDDKQYDTD 534
            WDYL Y+L WP T+C  + C      +  +NIHGLWPS      P+ C    PF I+ +  IY +L  +WANL +F +P  FW HEW KHG+CA+  P+ +NEL YF+ SL +K  V+L + L    I PSD      D
Sbjct:   24 WDYLVYSLEWPPTYCFTHTCKL-PYNINNFNIHGLWPSIWPSGSPTNCPNHMPFEIDTIKPIYTELQKEWANLDDFDDPKAFWKHEWQKHGVCALSDPIISNELDYFNISLIMKSKVNLLRRLESIKIIPSDSVTLKRD 161          
BLAST of S-like RNase vs. Ensembl Cavefish
Match: rnaset2 (ribonuclease T2 [Source:NCBI gene;Acc:103036121])

HSP 1 Score: 84.7297 bits (208), Expect = 1.259e-18
Identity = 62/187 (33.16%), Postives = 97/187 (51.87%), Query Frame = 1
Query:  118 NWDYLTYTLLWPQTFCKYNQCNYDKTKVTGWNIHGLWPSNITGKDPSKCKGDPFNINDLNSIYPDLVVQWANLLEFTNPAEFWTHEWTKHGLCAILPPLFTNELSYFSRSLQLKQFVSLDKILSDNDIQPSDDKQYDTDXXXXXXXXXXXXXXXXECI---KIEDDYYLSAVEICFDHQLKPINCPK 669
            +W  L  T  WP+TFC  +QC    T  + W +HG WP N+     S      FN + +  + P++   W +LL+  +  +FW HEW KHG CA       ++  YFS++L+L   + LD +L  + I PS +K Y    + +S+ S  GV PK++C+   K  +   +  +EIC D Q +  +C K
Sbjct:   25 DWTKLILTHHWPKTFCMIDQCT---TNFSYWTLHGFWP-NVGNMCNSSWH---FNASLIEDLLPEMKTYWPDLLKPAS-TQFWKHEWEKHGTCAAKDEDLDSQHKYFSKALELYHKLDLDGVLKKSQIVPS-EKYYKLADLEESIVSSFGVTPKIQCVLEAKRAEVQTVGQIEICVDKQFQLTDCEK 202          
BLAST of S-like RNase vs. Ensembl Cavefish
Match: rnaset2l (ribonuclease Oy-like [Source:NCBI gene;Acc:103022964])

HSP 1 Score: 76.2554 bits (186), Expect = 1.755e-15
Identity = 49/168 (29.17%), Postives = 78/168 (46.43%), Query Frame = 1
Query:  115 ANWDYLTYTLLWPQTFC----KYNQCNYDKTKVTGWNIHGLWPSNITGKDPSKCKGDPFNINDLNSIYPDLVVQWANLLEFTNPAEFWTHEWTKHGLCAILPPLFTNELSYFSRSLQLKQFVSLDKILSDNDIQPSDDKQYDTDXXXXXXXXXXXXXXXXECIKIEDD 606
             NW  + +T+ WP +FC      N C   +  +  W IHGLWP    G     C   P   + L  + P+L   W +L++  +   FW  EW KHG CA       +   YF  SL+L+    +D  L++  I+PS +  Y  + +  ++   LG    ++C+K E +
Sbjct:   42 CNWTCMIFTIQWPGSFCLSLENRNICRIPE-NIHNWTIHGLWPIRTYGC----CFCWPVFQSHLQDLEPELSQLWPSLIKSKSNFSFWKDEWFKHGTCAACVESMGSPAHYFRTSLKLRTLFDVDNALANTGIKPSCNISYKHEEIHAALGPFLGNNYVVQCVKDEKE 204          
BLAST of S-like RNase vs. Ensembl Sea Lamprey
Match: rnaset2 (ribonuclease T2 [Source:NCBI gene;Acc:791890])

HSP 1 Score: 91.6633 bits (226), Expect = 9.600e-22
Identity = 58/198 (29.29%), Postives = 103/198 (52.02%), Query Frame = 1
Query:  118 NWDYLTYTLLWPQTFC-----KYNQCNYDKTKVTGWNIHGLWPSNITGKDPSKCKGDPFNINDLNSIYPDLVVQWANLLEFTNPAEFWTHEWTKHGLCAILPPLFTNELSYFSRSLQLKQFVSLDKILSDNDIQPSDDKQYDTDXXXXXXXXXXXXXXXXECIKI---EDDYYLSAVEICFDHQLKPINCPKHHHDNV 687
            +W  L  T  WPQ+FC     + + C    + V  W+IHGLW ++ T  +    K   F++ ++  + P L   W +L E TN  + W HEW +HG CA       ++ +YFS++++L Q + + K LSD  + PS+   Y  + + ++ S+  GV  KL+C+ +   E+   L  +++C+  +   +NC +H    +
Sbjct:   28 DWSQLILTQHWPQSFCMSQWSEKHNCTIPSS-VKSWSIHGLWTNHRTFCN----KSWHFDVKEIEDLLPQLDQFWPDL-EKTNGTDLWKHEWIRHGTCAATLEALNSQHNYFSKTMELYQKLDISKALSDAGVTPSNTVFYKEEQILEAFSTAFGVKAKLQCLTVPQEENTQLLGQIQMCWSREFSLVNCSRHAEAGI 219          
BLAST of S-like RNase vs. Ensembl Nematostella
Match: EDO48543 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJ98])

HSP 1 Score: 98.9821 bits (245), Expect = 2.806e-24
Identity = 67/214 (31.31%), Postives = 105/214 (49.07%), Query Frame = 1
Query:  121 WDYLTYTLLWPQTFCKY--NQCNYDKTK--------------VTGWNIHGLWPSNITGKDPSKCKGD-PFNINDLNSIYPDLVVQWANLLEFTNPA--EFWTHEWTKHGLCAILPPLFTNELSYFSRSLQLKQFVSLDKILSDNDIQPSDDKQYDTDXXXXXXXXXXXXXXXXECIKIEDD-YYLSAVEICFDHQLKPINC----PKHHHDNVD 690
            WDY  ++  WPQ+ C Y   Q   DK +              VT W +HGLWP+     +P  C    PF  +++  +   ++ +W    + +  +  + W+HEW KHG CA      +NE SYFS +L L     L + L+  +I PSDD+ Y    V +++S+K G   ++ C++  DD   L+ + IC D   +P NC    P+H  D+ D
Sbjct:   27 WDYFVFSQWWPQSQCYYRNGQTMDDKWRFTSGNARNDCVPADVTTWTLHGLWPTVGGKAEPVNCNSSWPFVESEIQDLEDRMMQRWLAFPDSSKSSARDLWSHEWKKHGTCATDLAQTSNEHSYFSMALALNSNCGLLRALASENIIPSDDQMYTVKQVERAISNKYGAKGRVICLRGPDDQQLLAGIRICLDKSFRPRNCIQTYPEHCSDDDD 240          
BLAST of S-like RNase vs. Ensembl Nematostella
Match: EDO48544 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJ99])

HSP 1 Score: 82.4185 bits (202), Expect = 2.878e-18
Identity = 49/154 (31.82%), Postives = 74/154 (48.05%), Query Frame = 1
Query:  121 WDYLTYTLLWPQTFCKY--NQCNYDKTK--------------VTGWNIHGLWPSNITGKDPSKCKGD-PFNINDLNSIYPDLVVQWANLLEFTNPA--EFWTHEWTKHGLCAILPPLFTNELSYFSRSLQLKQFVSLDKILSDNDIQPSDDKQY 525
            WDY  ++  WPQ+ C Y   Q   DK +              VT W +HGLWP+     +P  C    PF  +++  +   ++ +W    + +  +  + W+HEW KHG CA      +NE SYFS +L L     L + L+  +I PSDD+ Y
Sbjct:   20 WDYFVFSQWWPQSQCYYRNGQTMDDKWRFTSGNARNDCVPADVTTWTLHGLWPTVGGKAEPVNCNSSWPFVESEIQDLEDRMMQRWLAFPDSSKSSARDLWSHEWKKHGTCATDLAETSNEHSYFSMALALNSNCGLLRALASENIIPSDDQMY 173          
BLAST of S-like RNase vs. Ensembl Medaka
Match: rnaset2l (ribonuclease Oy [Source:NCBI gene;Acc:101170531])

HSP 1 Score: 88.9669 bits (219), Expect = 4.774e-20
Identity = 50/141 (35.46%), Postives = 72/141 (51.06%), Query Frame = 1
Query:  121 WDYLTYTLLWPQTFCK--YNQ--CNYDKTKVTGWNIHGLWPSNITGKDPSKCKGDPFNINDLNSIYPDLVVQWANLLEFTNPAEFWTHEWTKHGLCAILPPLFTNELSYFSRSLQLKQFVSLDKILSDNDIQPSDDKQYDT 531
            W  + +TL WP  FC   YNQ  C    T VT W IHGLWP +        C   P   +D+  +  +LV  W +LL+  +  +FW  EW KHG CA     F +   YF  SL+L+++  + ++L D  I PS +++Y  
Sbjct:   49 WRCIIFTLQWPGGFCASLYNQTLCRIPDT-VTDWTIHGLWPLHAQ----RCCNCWPMFQSDVQELKDELVENWPSLLKTKSSFQFWEQEWAKHGACAACVEGFNSPQKYFQISLKLRKWFEIQRVLEDAGIAPSCERRYKV 184          
BLAST of S-like RNase vs. Ensembl Medaka
Match: rnaset2l (ribonuclease Oy [Source:NCBI gene;Acc:101170531])

HSP 1 Score: 88.9669 bits (219), Expect = 4.774e-20
Identity = 50/141 (35.46%), Postives = 72/141 (51.06%), Query Frame = 1
Query:  121 WDYLTYTLLWPQTFCK--YNQ--CNYDKTKVTGWNIHGLWPSNITGKDPSKCKGDPFNINDLNSIYPDLVVQWANLLEFTNPAEFWTHEWTKHGLCAILPPLFTNELSYFSRSLQLKQFVSLDKILSDNDIQPSDDKQYDT 531
            W  + +TL WP  FC   YNQ  C    T VT W IHGLWP +        C   P   +D+  +  +LV  W +LL+  +  +FW  EW KHG CA     F +   YF  SL+L+++  + ++L D  I PS +++Y  
Sbjct:   49 WRCIIFTLQWPGGFCASLYNQTLCRIPDT-VTDWTIHGLWPLHAQ----RCCNCWPMFQSDVQELKDELVENWPSLLKTKSSFQFWEQEWAKHGACAACVEGFNSPQKYFQISLKLRKWFEIQRVLEDAGIAPSCERRYKV 184          
BLAST of S-like RNase vs. Ensembl Medaka
Match: rnaset2 (ribonuclease T2 [Source:NCBI gene;Acc:101163650])

HSP 1 Score: 80.8777 bits (198), Expect = 2.998e-17
Identity = 61/187 (32.62%), Postives = 89/187 (47.59%), Query Frame = 1
Query:  121 WDYLTYTLLWPQTFCKYNQCNYDKTKVTGWNIHGLWPSNITGKDPSKCKGD-PFNINDLNSIYPDLVVQWANLLEFTNPAEFWTHEWTKHGLCAILPPLFTNELSYFSRSLQLKQFVSLDKILSDNDIQPSDDKQYDTDXXXXXXXXXXXXXXXXECI---KIEDDYYLSAVEICFDHQLKPINCPK 669
            W  L  T  WP TFC    C+     ++ W +HGLWP    G D   C     FN + +  + PD+   W +L   ++   FW +EW KHG CA       ++  YFS++L+L   + L  +L    I PS DK Y    V  ++ +  G  PK++C+   K  D   L  +EICFD     ++C K
Sbjct:   27 WSKLILTHHWPNTFCSMEHCH---PNISYWTLHGLWPDK--GMD---CNSSWHFNPSLIEDLLPDMNKSWPDLRNRSS-VSFWKYEWHKHGTCAAKAESLNSQHKYFSKALELYHKLDLSSVLVKFGITPS-DKYYPFSQVEGAIENVYGFKPKIQCVHSSKGGDFQSLGQIEICFDSDFTLMDCEK 203          
BLAST of S-like RNase vs. Ensembl Medaka
Match: rnaset2 (ribonuclease T2 [Source:NCBI gene;Acc:101163650])

HSP 1 Score: 80.8777 bits (198), Expect = 2.998e-17
Identity = 61/187 (32.62%), Postives = 89/187 (47.59%), Query Frame = 1
Query:  121 WDYLTYTLLWPQTFCKYNQCNYDKTKVTGWNIHGLWPSNITGKDPSKCKGD-PFNINDLNSIYPDLVVQWANLLEFTNPAEFWTHEWTKHGLCAILPPLFTNELSYFSRSLQLKQFVSLDKILSDNDIQPSDDKQYDTDXXXXXXXXXXXXXXXXECI---KIEDDYYLSAVEICFDHQLKPINCPK 669
            W  L  T  WP TFC    C+     ++ W +HGLWP    G D   C     FN + +  + PD+   W +L   ++   FW +EW KHG CA       ++  YFS++L+L   + L  +L    I PS DK Y    V  ++ +  G  PK++C+   K  D   L  +EICFD     ++C K
Sbjct:   27 WSKLILTHHWPNTFCSMEHCH---PNISYWTLHGLWPDK--GMD---CNSSWHFNPSLIEDLLPDMNKSWPDLRNRSS-VSFWKYEWHKHGTCAAKAESLNSQHKYFSKALELYHKLDLSSVLVKFGITPS-DKYYPFSQVEGAIENVYGFKPKIQCVHSSKGGDFQSLGQIEICFDSDFTLMDCEK 203          
BLAST of S-like RNase vs. Planmine SMEST
Match: SMESG000016389.1 (SMESG000016389.1)

HSP 1 Score: 298.13 bits (762), Expect = 5.930e-102
Identity = 161/162 (99.38%), Postives = 162/162 (100.00%), Query Frame = 1
Query:  115 ANWDYLTYTLLWPQTFCKYNQCNYDKTKVTGWNIHGLWPSNITGKDPSKCKGDPFNINDLNSIYPDLVVQWANLLEFTNPAEFWTHEWTKHGLCAILPPLFTNELSYFSRSLQLKQFVSLDKILSDNDIQPSDDKQYDTDXXXXXXXXXXXXXXXXECIKIE 600
            ANWDYLTYTLLWPQTFCKYNQCNYDKTKVTGWNIHGLWPSNITGKDPSKCKGDPFNINDLNSI+PDLVVQWANLLEFTNPAEFWTHEWTKHGLCAILPPLFTNELSYFSRSLQLKQFVSLDKILSDNDIQPSDDKQYDTDSVSKSVSSKLGVLPKLECIKIE
Sbjct:   17 ANWDYLTYTLLWPQTFCKYNQCNYDKTKVTGWNIHGLWPSNITGKDPSKCKGDPFNINDLNSIFPDLVVQWANLLEFTNPAEFWTHEWTKHGLCAILPPLFTNELSYFSRSLQLKQFVSLDKILSDNDIQPSDDKQYDTDSVSKSVSSKLGVLPKLECIKIE 178          
BLAST of S-like RNase vs. Planmine SMEST
Match: SMESG000046228.1 (SMESG000046228.1)

HSP 1 Score: 134.42 bits (337), Expect = 1.731e-37
Identity = 79/218 (36.24%), Postives = 127/218 (58.26%), Query Frame = 1
Query:  166 KYNQCNYDKTKVTGWNIHGLWPSNITGKDPSKCKGDPFNIN-DLNSIYPDLVVQWANLLEFTNPAEFWTHEWTKHGLCAILPPLFTNELSYFSRSLQLKQFVSLDKILSDNDIQPSDDKQYDTDXXXXXXXXXXXXXXXXECIKIED-DYYLSAVEICFDHQLKPINCPKHHHDNVD--SQLKDLIHQIFQKVEGHLLLSDATKPINIPCNDNSFYIP 807
            KY+     ++K + WNIHGLWP  I G D   C G+PF     L SIY +L++ WANL  F+ P +FW +EW KHG C+I   LF+NE  YF  +L+LK+ +S+ K+LS+++I P++DK Y+   +  ++  +LG++P L+C + +D ++ L ++ ICFD  +   +C      NV+    +  +I  + +K+  +L       PI   C  + F IP
Sbjct:    6 KYHSSATIQSKDSRWNIHGLWPYKIHGNDTFNCDGEPFQRQLVLISIYEELLLNWANLKNFSKPEKFWGYEWHKHGTCSIKDKLFSNEFGYFYHTLRLKKNISMKKLLSNHNILPNNDKAYNIQQIHNAIKVELGIIPMLQCFQKQDNEWNLLSIGICFDRSMNLKDC-----QNVELPQSMGSIIGNLIKKIFLYLGAKKVITPIKDKCEGHDFKIP 218          
BLAST of S-like RNase vs. Planmine SMEST
Match: SMESG000048912.1 (SMESG000048912.1)

HSP 1 Score: 133.265 bits (334), Expect = 5.462e-37
Identity = 85/235 (36.17%), Postives = 120/235 (51.06%), Query Frame = 1
Query:  118 NWDYLTYTLLWPQTFC----KYNQCNYDKTKVTGWNIHGLWPSNITGKDPSKCK-GDPFNINDLNSIYPDLVVQWANLLEFTNPAEFWTHEWTKHGLCAILPPLFTNELSYFSRSLQLKQFVSLDKILSDNDIQPSDDKQYDTDXXXXXXXXXXXXXXXXECIKIEDDYYLSAVEICFDHQLKPINCPKHHHDNVDSQLKDLIHQIFQKVEGHLLLSDATKPINIPCNDNSFYIP 807
            +WDYL   + WP +FC    K  QC  D + VTGWN+HGLWPS+  G DP  CK    ++   L  I  DL+ +W  L   +   +FW HEW  HG CA    L   EL YF+ ++Q+K+ V L  IL  N+++P ++K Y        +     V PKL+C   +   Y+ A+E CFD +L  I CPK H      + +D + +   K        ++T PI+IPC     Y P
Sbjct:    5 DWDYLVMAVEWPPSFCYTFPKKIQC-CDTSHVTGWNLHGLWPSSSKGSDPLCCKNASAYDEKKLKPIMEDLLKEWNPLGNCS--KDFWKHEWKFHGTCASHNKLLHTELQYFNETIQMKKHVDLTNILHQNNVKPDNNKMYKVSDFVNVIKKVYKVEPKLQCTHYKGKIYILAMEFCFDTKLNIIMCPKRH------KSEDHLSRHRNKCRK---PRNSTNPIHIPCTTGFLYQP 227          
BLAST of S-like RNase vs. Planmine SMEST
Match: SMESG000048912.1 (SMESG000048912.1)

HSP 1 Score: 132.88 bits (333), Expect = 1.299e-36
Identity = 85/235 (36.17%), Postives = 120/235 (51.06%), Query Frame = 1
Query:  118 NWDYLTYTLLWPQTFC----KYNQCNYDKTKVTGWNIHGLWPSNITGKDPSKCK-GDPFNINDLNSIYPDLVVQWANLLEFTNPAEFWTHEWTKHGLCAILPPLFTNELSYFSRSLQLKQFVSLDKILSDNDIQPSDDKQYDTDXXXXXXXXXXXXXXXXECIKIEDDYYLSAVEICFDHQLKPINCPKHHHDNVDSQLKDLIHQIFQKVEGHLLLSDATKPINIPCNDNSFYIP 807
            +WDYL   + WP +FC    K  QC  D + VTGWN+HGLWPS+  G DP  CK    ++   L  I  DL+ +W  L   +   +FW HEW  HG CA    L   EL YF+ ++Q+K+ V L  IL  N+++P ++K Y        +     V PKL+C   +   Y+ A+E CFD +L  I CPK H      + +D + +   K        ++T PI+IPC     Y P
Sbjct:   25 DWDYLVMAVEWPPSFCYTFPKKIQC-CDTSHVTGWNLHGLWPSSSKGSDPLCCKNASAYDEKKLKPIMEDLLKEWNPLGNCSK--DFWKHEWKFHGTCASHNKLLHTELQYFNETIQMKKHVDLTNILHQNNVKPDNNKMYKVSDFVNVIKKVYKVEPKLQCTHYKGKIYILAMEFCFDTKLNIIMCPKRH------KSEDHLSRHRNKCRK---PRNSTNPIHIPCTTGFLYQP 247          
BLAST of S-like RNase vs. Planmine SMEST
Match: SMESG000048912.1 (SMESG000048912.1)

HSP 1 Score: 124.02 bits (310), Expect = 1.372e-33
Identity = 81/225 (36.00%), Postives = 114/225 (50.67%), Query Frame = 1
Query:  148 WPQTFC----KYNQCNYDKTKVTGWNIHGLWPSNITGKDPSKCK-GDPFNINDLNSIYPDLVVQWANLLEFTNPAEFWTHEWTKHGLCAILPPLFTNELSYFSRSLQLKQFVSLDKILSDNDIQPSDDKQYDTDXXXXXXXXXXXXXXXXECIKIEDDYYLSAVEICFDHQLKPINCPKHHHDNVDSQLKDLIHQIFQKVEGHLLLSDATKPINIPCNDNSFYIP 807
            WP +FC    K  QC  D + VTGWN+HGLWPS+  G DP  CK    ++   L  I  DL+ +W  L   +   +FW HEW  HG CA    L   EL YF+ ++Q+K+ V L  IL  N+++P ++K Y        +     V PKL+C   +   Y+ A+E CFD +L  I CPK H      + +D + +   K        ++T PI+IPC     Y P
Sbjct:    5 WPPSFCYTFPKKIQC-CDTSHVTGWNLHGLWPSSSKGSDPLCCKNASAYDEKKLKPIMEDLLKEWNPLGNCS--KDFWKHEWKFHGTCASHNKLLHTELQYFNETIQMKKHVDLTNILHQNNVKPDNNKMYKVSDFVNVIKKVYKVEPKLQCTHYKGKIYILAMEFCFDTKLNIIMCPKRH------KSEDHLSRHRNKCRK---PRNSTNPIHIPCTTGFLYQP 217          
The following BLAST results are available for this feature:
BLAST of S-like RNase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AL159163.11.144e-1734.35novel protein[more]
RNASET22.527e-1733.33ribonuclease T2 [Source:HGNC Symbol;Acc:HGNC:21686... [more]
RNASET22.527e-1733.33ribonuclease T2 [Source:HGNC Symbol;Acc:HGNC:21686... [more]
RNASET22.711e-1733.33ribonuclease T2 [Source:HGNC Symbol;Acc:HGNC:21686... [more]
RNASET21.186e-1634.43ribonuclease T2 [Source:HGNC Symbol;Acc:HGNC:21686... [more]
back to top
BLAST of S-like RNase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rnst-26.665e-2129.19pep chromosome:WBcel235:V:1061595:1067908:1 gene:W... [more]
back to top
BLAST of S-like RNase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
RNaseX258.856e-1931.77gene:FBgn0010406 transcript:FBtr0076752[more]
back to top
BLAST of S-like RNase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rnaset21.433e-2233.77ribonuclease T2 [Source:NCBI gene;Acc:791890][more]
rnaset21.433e-2233.77ribonuclease T2 [Source:NCBI gene;Acc:791890][more]
rnaset21.433e-2233.77ribonuclease T2 [Source:NCBI gene;Acc:791890][more]
rnaset21.433e-2233.77ribonuclease T2 [Source:NCBI gene;Acc:791890][more]
rnaset21.433e-2233.77ribonuclease T2 [Source:NCBI gene;Acc:791890][more]
back to top
BLAST of S-like RNase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rnaset23.579e-1330.92ribonuclease T2 [Source:NCBI gene;Acc:780173][more]
back to top
BLAST of S-like RNase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rnaset2a1.875e-1532.58ribonuclease T2A [Source:MGI Symbol;Acc:MGI:191544... [more]
Rnaset2a1.875e-1532.58ribonuclease T2A [Source:MGI Symbol;Acc:MGI:191544... [more]
Gm496731.875e-1532.58predicted gene, 49673 [Source:MGI Symbol;Acc:MGI:6... [more]
Gm497211.875e-1532.58predicted gene, 49721 [Source:MGI Symbol;Acc:MGI:6... [more]
Rnaset2b1.875e-1532.58ribonuclease T2B [Source:MGI Symbol;Acc:MGI:370208... [more]
back to top
BLAST of S-like RNase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7M456|RNOY_CRAGI6.647e-2935.45Ribonuclease Oy OS=Crassostrea gigas OX=29159 PE=1... [more]
sp|B8XY56|RNT2_DANRE1.082e-2133.77Ribonuclease T2 OS=Danio rerio OX=7955 GN=rnaset2 ... [more]
sp|O61887|RNST2_CAEEL8.478e-2029.19Ribonuclease T2 protein rnst-2 OS=Caenorhabditis e... [more]
sp|Q7M438|RNDI_DICDI3.738e-1830.65Ribonuclease DdI OS=Dictyostelium discoideum OX=44... [more]
sp|P42815|RNS3_ARATH3.390e-1732.67Ribonuclease 3 OS=Arabidopsis thaliana OX=3702 GN=... [more]
back to top
BLAST of S-like RNase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2DFD78.589e-2936.98Ribonuclease Oy isoform 2 OS=Schistosoma japonicum... [more]
A0A4Z2DG041.283e-2836.98Ribonuclease Oy isoform 1 OS=Schistosoma japonicum... [more]
G4V5B96.691e-2835.24Putative ribonuclease t2 OS=Schistosoma mansoni OX... [more]
A0A4Z2DFD41.599e-2736.36Ribonuclease Oy OS=Schistosoma japonicum OX=6182 G... [more]
Q5BVY22.692e-2743.17SJCHGC07916 protein (Fragment) OS=Schistosoma japo... [more]
back to top
BLAST of S-like RNase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rnaset21.259e-1833.16ribonuclease T2 [Source:NCBI gene;Acc:103036121][more]
rnaset2l1.755e-1529.17ribonuclease Oy-like [Source:NCBI gene;Acc:1030229... [more]
back to top
BLAST of S-like RNase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rnaset29.600e-2229.29ribonuclease T2 [Source:NCBI gene;Acc:791890][more]
back to top
BLAST of S-like RNase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of S-like RNase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO485432.806e-2431.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO485442.878e-1831.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of S-like RNase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
rnaset2l4.774e-2035.46ribonuclease Oy [Source:NCBI gene;Acc:101170531][more]
rnaset2l4.774e-2035.46ribonuclease Oy [Source:NCBI gene;Acc:101170531][more]
rnaset22.998e-1732.62ribonuclease T2 [Source:NCBI gene;Acc:101163650][more]
rnaset22.998e-1732.62ribonuclease T2 [Source:NCBI gene;Acc:101163650][more]
back to top
BLAST of S-like RNase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016389.15.930e-10299.38SMESG000016389.1[more]
SMESG000046228.11.731e-3736.24SMESG000046228.1[more]
SMESG000048912.15.462e-3736.17SMESG000048912.1[more]
SMESG000048912.11.299e-3636.17SMESG000048912.1[more]
SMESG000048912.11.372e-3336.00SMESG000048912.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031930 ID=SMED30031930|Name=S-like RNase|organism=Schmidtea mediterranea sexual|type=transcript|length=1042bp
TAACAACAACAAGATTTTTAAGTATTTATAGAAAATTATTTTTATAATTT
GATTATTTGAAATATAATGTTAAAGCTTCTGATAATATTGTCGGTTGTGG
GTGTAAGTCTTTCAGCCAATTGGGATTATCTGACATATACTTTGCTATGG
CCTCAAACGTTTTGTAAATACAACCAGTGCAATTACGACAAGACAAAGGT
AACAGGATGGAATATTCATGGATTATGGCCATCTAATATAACAGGAAAGG
ATCCATCGAAATGCAAAGGCGATCCGTTCAATATTAATGATCTTAATAGT
ATTTATCCGGACCTGGTTGTGCAGTGGGCAAATTTATTAGAATTTACAAA
TCCTGCCGAATTCTGGACACATGAATGGACTAAGCACGGGTTGTGCGCAA
TTCTGCCGCCTTTATTTACAAATGAGCTTTCGTACTTTAGTCGCTCTCTA
CAATTGAAACAGTTTGTGTCTCTCGACAAAATTCTCTCCGACAACGACAT
CCAACCGAGCGACGATAAACAATATGACACGGATTCTGTCAGCAAATCAG
TATCGAGTAAGCTCGGAGTGTTACCGAAATTGGAATGCATTAAAATTGAA
GATGATTATTATTTGAGTGCAGTAGAAATATGTTTTGACCATCAACTGAA
GCCCATAAACTGTCCAAAGCATCACCATGATAATGTTGATAGCCAGCTTA
AAGACCTCATTCATCAAATATTCCAAAAGGTGGAAGGTCACCTACTACTC
TCCGATGCAACAAAGCCTATTAATATACCATGCAACGACAACTCATTTTA
CATTCCGGTTTAACTGTGCCAAACTTTACTAATATTTTATCACTTAAAAA
TTTTTATTCATAATTAATAGTAATTAAAAAAACCCATGTGACTCTTCAAA
TGTTCATTTTAAATCTGAATAATTATAAATGAGATTAGAAAGGTTATAGG
TCATCATGGTCAGTGATCACTTCATGAATGGAGATATTTCATTTTTTAAA
TTATATTTTTATTTATTAGAAAATATTATTTTAGTTAAAAAT
back to top

protein sequence of SMED30031930-orf-1

>SMED30031930-orf-1 ID=SMED30031930-orf-1|Name=SMED30031930-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=249bp
MLKLLIILSVVGVSLSANWDYLTYTLLWPQTFCKYNQCNYDKTKVTGWNI
HGLWPSNITGKDPSKCKGDPFNINDLNSIYPDLVVQWANLLEFTNPAEFW
THEWTKHGLCAILPPLFTNELSYFSRSLQLKQFVSLDKILSDNDIQPSDD
KQYDTDSVSKSVSSKLGVLPKLECIKIEDDYYLSAVEICFDHQLKPINCP
KHHHDNVDSQLKDLIHQIFQKVEGHLLLSDATKPINIPCNDNSFYIPV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036430RNase_T2-like_sf
IPR001568RNase_T2-like
IPR018188RNase_T2_His_AS_1
IPR033130RNase_T2_His_AS_2
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0033897ribonuclease T2 activity
GO:0004518nuclease activity
GO:0004519endonuclease activity
GO:0016787hydrolase activity
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
Vocabulary: biological process
TermDefinition
GO:0090305nucleic acid phosphodiester bond hydrolysis
GO:0090502RNA phosphodiester bond hydrolysis, endonucleolytic
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR036430Ribonuclease T2-like superfamilyGENE3DG3DSA:3.90.730.10coord: 16..214
e-value: 1.8E-51
score: 176.8
IPR036430Ribonuclease T2-like superfamilySUPERFAMILYSSF55895Ribonuclease Rh-likecoord: 18..207
IPR001568Ribonuclease T2-likePFAMPF00445Ribonuclease_T2coord: 19..199
e-value: 1.3E-44
score: 152.6
IPR001568Ribonuclease T2-likePANTHERPTHR11240RIBONUCLEASE T2coord: 5..208
NoneNo IPR availablePANTHERPTHR11240:SF22RIBONUCLEASE T2coord: 5..208
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..16
score: 0.878
IPR018188Ribonuclease T2, His active site 1PROSITEPS00530RNASE_T2_1coord: 48..55
IPR033130Ribonuclease T2, His active site 2PROSITEPS00531RNASE_T2_2coord: 99..110