F-box only protein 16

Overview
NameF-box only protein 16
Smed IDSMED30031919
Length (bp)1215
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of F-box only protein 16 (SMED30031919) t-SNE clustered cells

Violin plots show distribution of expression levels for F-box only protein 16 (SMED30031919) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of F-box only protein 16 (SMED30031919) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for F-box only protein 16 (SMED30031919) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031919

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30031919h1SMcG0020791 SmedASXL_007751SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30031919h1SMcG0020791 dd_Smed_v4_12714_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30031919h1SMcG0020791 dd_Smed_v4_12714_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30031919h1SMcG0020791 dd_Smed_v6_12714_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30031919h1SMcG0020791 Contig27427newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30031919h1SMcG0020791 Contig27427uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30031919h1SMcG0020791 Contig41597newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30031919h1SMcG0020791 Contig41597uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30031919h1SMcG0020791 dd_Smed_v4_12714_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of F-box only protein 16 vs. Ensembl Human
Match: FBXO16 (F-box protein 16 [Source:HGNC Symbol;Acc:HGNC:13618])

HSP 1 Score: 189.504 bits (480), Expect = 1.020e-56
Identity = 95/219 (43.38%), Postives = 132/219 (60.27%), Query Frame = 2
Query:   77 STWTPLNHEDSNIKVFEERRSLVNKWFEMWNTNQRKQILEDLLTSCNGNQVEYAKLILSTKAIQKHVDFTRILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLAECNEIWAPKCARLGWYFTGPINTMESGLWKKHFIENIIFLQITRPAXXXXXXXXXXXXXXXXXXXXQAEKD--EALRKAKRLKEKQLQAQKTSFAPWRGPDPRPIDIVRNNYIDN 727
            STWTPLNH+  N +VFEERR+L+ KWF+ W  +QR++IL  LL  C+ +Q ++    L  K   + +DFT  LPRV+ LYIFSFLDPRSLCR AQVCW+WK LAE +++W  KC R  WY        E G+WKKH+I+ +  L IT+P    +    +         + + ++    A R +  L++K    +K +  PWR  D  P DI+R NY+DN
Sbjct:   20 STWTPLNHQLLNDRVFEERRALLGKWFDKWTDSQRRRILTGLLERCSLSQQKFCCRKLQEKIPAEALDFTTKLPRVLSLYIFSFLDPRSLCRCAQVCWHWKNLAELDQLWMLKCLRFNWYINFSPTPFEQGIWKKHYIQMVKELHITKPKTPPKDGFVIADVQLVTSNSPEEKQSPLSAFRSSSSLRKKNNSGEK-ALPPWRSSDKHPTDIIRFNYLDN 237          
BLAST of F-box only protein 16 vs. Ensembl Human
Match: FBXO16 (F-box protein 16 [Source:HGNC Symbol;Acc:HGNC:13618])

HSP 1 Score: 190.274 bits (482), Expect = 2.719e-56
Identity = 95/219 (43.38%), Postives = 132/219 (60.27%), Query Frame = 2
Query:   77 STWTPLNHEDSNIKVFEERRSLVNKWFEMWNTNQRKQILEDLLTSCNGNQVEYAKLILSTKAIQKHVDFTRILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLAECNEIWAPKCARLGWYFTGPINTMESGLWKKHFIENIIFLQITRPAXXXXXXXXXXXXXXXXXXXXQAEKD--EALRKAKRLKEKQLQAQKTSFAPWRGPDPRPIDIVRNNYIDN 727
            STWTPLNH+  N +VFEERR+L+ KWF+ W  +QR++IL  LL  C+ +Q ++    L  K   + +DFT  LPRV+ LYIFSFLDPRSLCR AQVCW+WK LAE +++W  KC R  WY        E G+WKKH+I+ +  L IT+P    +    +         + + ++    A R +  L++K    +K +  PWR  D  P DI+R NY+DN
Sbjct:   20 STWTPLNHQLLNDRVFEERRALLGKWFDKWTDSQRRRILTGLLERCSLSQQKFCCRKLQEKIPAEALDFTTKLPRVLSLYIFSFLDPRSLCRCAQVCWHWKNLAELDQLWMLKCLRFNWYINFSPTPFEQGIWKKHYIQMVKELHITKPKTPPKDGFVIADVQLVTSNSPEEKQSPLSAFRSSSSLRKKNNSGEK-ALPPWRSSDKHPTDIIRFNYLDN 237          
BLAST of F-box only protein 16 vs. Ensembl Human
Match: FBXO16 (F-box protein 16 [Source:HGNC Symbol;Acc:HGNC:13618])

HSP 1 Score: 164.081 bits (414), Expect = 3.720e-47
Identity = 87/219 (39.73%), Postives = 122/219 (55.71%), Query Frame = 2
Query:   77 STWTPLNHEDSNIKVFEERRSLVNKWFEMWNTNQRKQILEDLLTSCNGNQVEYAKLILSTKAIQKHVDFTRILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLAECNEIWAPKCARLGWYFTGPINTMESGLWKKHFIENIIFLQITRPAXXXXXXXXXXXXXXXXXXXXQAEKD--EALRKAKRLKEKQLQAQKTSFAPWRGPDPRPIDIVRNNYIDN 727
            STWTPLNH+            L+N  F+ W  +QR++IL  LL  C+ +Q ++    L  K   + +DFT  LPRV+ LYIFSFLDPRSLCR AQVCW+WK LAE +++W  KC R  WY        E G+WKKH+I+ +  L IT+P    +    +         + + ++    A R +  L++K    +K +  PWR  D  P DI+R NY+DN
Sbjct:   20 STWTPLNHQ------------LLNDRFDKWTDSQRRRILTGLLERCSLSQQKFCCRKLQEKIPAEALDFTTKLPRVLSLYIFSFLDPRSLCRCAQVCWHWKNLAELDQLWMLKCLRFNWYINFSPTPFEQGIWKKHYIQMVKELHITKPKTPPKDGFVIADVQLVTSNSPEEKQSPLSAFRSSSSLRKKNNSGEK-ALPPWRSSDKHPTDIIRFNYLDN 225          
BLAST of F-box only protein 16 vs. Ensembl Human
Match: FBXO16 (F-box protein 16 [Source:HGNC Symbol;Acc:HGNC:13618])

HSP 1 Score: 164.851 bits (416), Expect = 5.039e-47
Identity = 87/219 (39.73%), Postives = 122/219 (55.71%), Query Frame = 2
Query:   77 STWTPLNHEDSNIKVFEERRSLVNKWFEMWNTNQRKQILEDLLTSCNGNQVEYAKLILSTKAIQKHVDFTRILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLAECNEIWAPKCARLGWYFTGPINTMESGLWKKHFIENIIFLQITRPAXXXXXXXXXXXXXXXXXXXXQAEKD--EALRKAKRLKEKQLQAQKTSFAPWRGPDPRPIDIVRNNYIDN 727
            STWTPLNH+            L+N  F+ W  +QR++IL  LL  C+ +Q ++    L  K   + +DFT  LPRV+ LYIFSFLDPRSLCR AQVCW+WK LAE +++W  KC R  WY        E G+WKKH+I+ +  L IT+P    +    +         + + ++    A R +  L++K    +K +  PWR  D  P DI+R NY+DN
Sbjct:   20 STWTPLNHQ------------LLNDRFDKWTDSQRRRILTGLLERCSLSQQKFCCRKLQEKIPAEALDFTTKLPRVLSLYIFSFLDPRSLCRCAQVCWHWKNLAELDQLWMLKCLRFNWYINFSPTPFEQGIWKKHYIQMVKELHITKPKTPPKDGFVIADVQLVTSNSPEEKQSPLSAFRSSSSLRKKNNSGEK-ALPPWRSSDKHPTDIIRFNYLDN 225          
BLAST of F-box only protein 16 vs. Ensembl Human
Match: ECT2L (epithelial cell transforming 2 like [Source:HGNC Symbol;Acc:HGNC:21118])

HSP 1 Score: 132.494 bits (332), Expect = 6.853e-33
Identity = 70/202 (34.65%), Postives = 110/202 (54.46%), Query Frame = 2
Query:   77 STWTPLNHEDSNIKVFEERRSLVNKWFEMWNTNQRKQILEDLLTSCNGNQVEYAKLILSTKAIQKHVDFTRILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLAECNEIWAPKCARLGWYFTGPINTMESGLWKKHFIENIIFLQITRPAXXXXXXXXXXXXXXXXXXXXQAEKDEALRKAKRLKEKQLQAQKTSFA---PW 673
            S WTP +++  N ++F+ER +L++ WF++W   QR++ L  +   C  +Q+ + +   S +     VDF+ +LPR I LYIFSFL P+ LC +AQV W WK+L E + +W PKC + GW+        E G WK+H+I  +  L    P +       L +  T  E   + ++++ LR  KR+ EK    +K  F    PW
Sbjct:    9 SAWTPFSNKSLNRQLFQERVALISHWFDLWTNKQRQEFLFAIFLRCTKSQLRFVQDWFSERMQVAKVDFSTVLPRFISLYIFSFLSPKDLCAAAQVSWPWKFLTEQDCLWMPKCVKFGWFLPYTPTDNEYGAWKRHYIACVSHLDWLTPREAAATYGTLNEPKTEDEELLERQREKCLR--KRIWEKIALRKKELFKVRPPW 208          
BLAST of F-box only protein 16 vs. Ensembl Celegans
Match: fbxl-1 (Uncharacterized F-box/LRR-repeat protein C02F5.7 [Source:UniProtKB/Swiss-Prot;Acc:P34284])

HSP 1 Score: 48.9062 bits (115), Expect = 4.770e-6
Identity = 20/34 (58.82%), Postives = 26/34 (76.47%), Query Frame = 2
Query:  287 RILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLA 388
            R+LP+ + L +FSFLD ++LCRSAQVC  W  LA
Sbjct:   58 RVLPKEVLLKVFSFLDTKALCRSAQVCRSWSILA 91          
BLAST of F-box only protein 16 vs. Ensembl Celegans
Match: fbxl-1 (Uncharacterized F-box/LRR-repeat protein C02F5.7 [Source:UniProtKB/Swiss-Prot;Acc:P34284])

HSP 1 Score: 48.9062 bits (115), Expect = 4.770e-6
Identity = 20/34 (58.82%), Postives = 26/34 (76.47%), Query Frame = 2
Query:  287 RILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLA 388
            R+LP+ + L +FSFLD ++LCRSAQVC  W  LA
Sbjct:   58 RVLPKEVLLKVFSFLDTKALCRSAQVCRSWSILA 91          
BLAST of F-box only protein 16 vs. Ensembl Celegans
Match: fbxl-1 (Uncharacterized F-box/LRR-repeat protein C02F5.7 [Source:UniProtKB/Swiss-Prot;Acc:P34284])

HSP 1 Score: 48.9062 bits (115), Expect = 4.770e-6
Identity = 20/34 (58.82%), Postives = 26/34 (76.47%), Query Frame = 2
Query:  287 RILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLA 388
            R+LP+ + L +FSFLD ++LCRSAQVC  W  LA
Sbjct:   58 RVLPKEVLLKVFSFLDTKALCRSAQVCRSWSILA 91          
BLAST of F-box only protein 16 vs. Ensembl Celegans
Match: fbxl-1 (Uncharacterized F-box/LRR-repeat protein C02F5.7 [Source:UniProtKB/Swiss-Prot;Acc:P34284])

HSP 1 Score: 48.9062 bits (115), Expect = 4.770e-6
Identity = 20/34 (58.82%), Postives = 26/34 (76.47%), Query Frame = 2
Query:  287 RILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLA 388
            R+LP+ + L +FSFLD ++LCRSAQVC  W  LA
Sbjct:   58 RVLPKEVLLKVFSFLDTKALCRSAQVCRSWSILA 91          
BLAST of F-box only protein 16 vs. Ensembl Celegans
Match: fbxl-1 (Uncharacterized F-box/LRR-repeat protein C02F5.7 [Source:UniProtKB/Swiss-Prot;Acc:P34284])

HSP 1 Score: 48.521 bits (114), Expect = 5.722e-6
Identity = 20/34 (58.82%), Postives = 26/34 (76.47%), Query Frame = 2
Query:  287 RILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLA 388
            R+LP+ + L +FSFLD ++LCRSAQVC  W  LA
Sbjct:   58 RVLPKEVLLKVFSFLDTKALCRSAQVCRSWSILA 91          
BLAST of F-box only protein 16 vs. Ensembl Fly
Match: ago (gene:FBgn0041171 transcript:FBtr0073246)

HSP 1 Score: 66.6254 bits (161), Expect = 1.913e-11
Identity = 29/90 (32.22%), Postives = 52/90 (57.78%), Query Frame = 2
Query:  155 FEMWNTNQRKQILEDLLTSCNGNQVEYAKLILSTKAIQKHVDFTRILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLAECNEIWAPKCAR 424
            F+ W+  +R   L+ L+  C+ +QV +   ++     Q   DF  +LPR + L++ S+L+P+ L R+AQ C  W++L + N +W  KC +
Sbjct:  852 FQRWSHVERLLALDRLIDHCDPSQVRHMMKVIEP---QFQRDFISLLPRELALFVLSYLEPKDLLRAAQTCRSWRFLCDDNLLWKEKCRK 938          
BLAST of F-box only protein 16 vs. Ensembl Fly
Match: ago (gene:FBgn0041171 transcript:FBtr0073245)

HSP 1 Score: 66.6254 bits (161), Expect = 1.913e-11
Identity = 29/90 (32.22%), Postives = 52/90 (57.78%), Query Frame = 2
Query:  155 FEMWNTNQRKQILEDLLTSCNGNQVEYAKLILSTKAIQKHVDFTRILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLAECNEIWAPKCAR 424
            F+ W+  +R   L+ L+  C+ +QV +   ++     Q   DF  +LPR + L++ S+L+P+ L R+AQ C  W++L + N +W  KC +
Sbjct:  852 FQRWSHVERLLALDRLIDHCDPSQVRHMMKVIEP---QFQRDFISLLPRELALFVLSYLEPKDLLRAAQTCRSWRFLCDDNLLWKEKCRK 938          
BLAST of F-box only protein 16 vs. Ensembl Fly
Match: ago (gene:FBgn0041171 transcript:FBtr0073247)

HSP 1 Score: 66.6254 bits (161), Expect = 1.913e-11
Identity = 29/90 (32.22%), Postives = 52/90 (57.78%), Query Frame = 2
Query:  155 FEMWNTNQRKQILEDLLTSCNGNQVEYAKLILSTKAIQKHVDFTRILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLAECNEIWAPKCAR 424
            F+ W+  +R   L+ L+  C+ +QV +   ++     Q   DF  +LPR + L++ S+L+P+ L R+AQ C  W++L + N +W  KC +
Sbjct:  852 FQRWSHVERLLALDRLIDHCDPSQVRHMMKVIEP---QFQRDFISLLPRELALFVLSYLEPKDLLRAAQTCRSWRFLCDDNLLWKEKCRK 938          
BLAST of F-box only protein 16 vs. Ensembl Zebrafish
Match: fbxo16 (F-box protein 16 [Source:ZFIN;Acc:ZDB-GENE-041015-747])

HSP 1 Score: 191.815 bits (486), Expect = 3.496e-57
Identity = 96/240 (40.00%), Postives = 138/240 (57.50%), Query Frame = 2
Query:   77 STWTPLNHEDSNIKVFEERRSLVNKWFEMWNTNQRKQILEDLLTSCNGNQVEYAKLILSTKAIQKHVDFTRILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLAECNEIWAPKCARLGWYFTGPINTMESGLWKKHFIENIIFLQITRPAXXXXXX-----XXXXXXXXXXXXXXQAEKDEALRKAKRLKEKQLQAQKTSFAPWRGPDPRPIDIVRNNYIDNDIENGARFKMTFQKSHQK 781
            STWTPLNH+ SN  VFEERR+L+ KWFE W  +QRKQ+L+D  + C+  Q+++ +  LS+   ++ +DFT +LPRVI LYIFS+LDPRSLCR AQV W+WK L E +++W PKC +LGW  T      E G+WK+ +IE +  L I+RP    + +      +++   T   +     +D      +      L        PWR  D  P D +R NY+DN +  G   +    K+ Q+
Sbjct:    6 STWTPLNHQLSNAHVFEERRNLLGKWFEKWTDSQRKQVLQDFFSRCSAGQLKHLRQTLSSWVPEETLDFTTVLPRVISLYIFSYLDPRSLCRCAQVSWHWKNLVELDQLWMPKCLKLGWCITFTPTPFEQGVWKRQYIETVQELHISRPKVPVKEEFIVPDVKVIGSETEGSLPLTGHRDLLGLHGRSKNGNDLGKSAKGLPPWRDSDRHPTDTIRFNYLDN-LHPGEHARKALLKTRQE 244          
BLAST of F-box only protein 16 vs. Ensembl Zebrafish
Match: fbxo16 (F-box protein 16 [Source:ZFIN;Acc:ZDB-GENE-041015-747])

HSP 1 Score: 191.815 bits (486), Expect = 3.496e-57
Identity = 96/240 (40.00%), Postives = 138/240 (57.50%), Query Frame = 2
Query:   77 STWTPLNHEDSNIKVFEERRSLVNKWFEMWNTNQRKQILEDLLTSCNGNQVEYAKLILSTKAIQKHVDFTRILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLAECNEIWAPKCARLGWYFTGPINTMESGLWKKHFIENIIFLQITRPAXXXXXX-----XXXXXXXXXXXXXXQAEKDEALRKAKRLKEKQLQAQKTSFAPWRGPDPRPIDIVRNNYIDNDIENGARFKMTFQKSHQK 781
            STWTPLNH+ SN  VFEERR+L+ KWFE W  +QRKQ+L+D  + C+  Q+++ +  LS+   ++ +DFT +LPRVI LYIFS+LDPRSLCR AQV W+WK L E +++W PKC +LGW  T      E G+WK+ +IE +  L I+RP    + +      +++   T   +     +D      +      L        PWR  D  P D +R NY+DN +  G   +    K+ Q+
Sbjct:    6 STWTPLNHQLSNAHVFEERRNLLGKWFEKWTDSQRKQVLQDFFSRCSAGQLKHLRQTLSSWVPEETLDFTTVLPRVISLYIFSYLDPRSLCRCAQVSWHWKNLVELDQLWMPKCLKLGWCITFTPTPFEQGVWKRQYIETVQELHISRPKVPVKEEFIVPDVKVIGSETEGSLPLTGHRDLLGLHGRSKNGNDLGKSAKGLPPWRDSDRHPTDTIRFNYLDN-LHPGEHARKALLKTRQE 244          
BLAST of F-box only protein 16 vs. Ensembl Zebrafish
Match: fbxo16 (F-box protein 16 [Source:ZFIN;Acc:ZDB-GENE-041015-747])

HSP 1 Score: 192.2 bits (487), Expect = 3.606e-57
Identity = 96/240 (40.00%), Postives = 138/240 (57.50%), Query Frame = 2
Query:   77 STWTPLNHEDSNIKVFEERRSLVNKWFEMWNTNQRKQILEDLLTSCNGNQVEYAKLILSTKAIQKHVDFTRILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLAECNEIWAPKCARLGWYFTGPINTMESGLWKKHFIENIIFLQITRPAXXXXXX-----XXXXXXXXXXXXXXQAEKDEALRKAKRLKEKQLQAQKTSFAPWRGPDPRPIDIVRNNYIDNDIENGARFKMTFQKSHQK 781
            STWTPLNH+ SN  VFEERR+L+ KWFE W  +QRKQ+L+D  + C+  Q+++ +  LS+   ++ +DFT +LPRVI LYIFS+LDPRSLCR AQV W+WK L E +++W PKC +LGW  T      E G+WK+ +IE +  L I+RP    + +      +++   T   +     +D      +      L        PWR  D  P D +R NY+DN +  G   +    K+ Q+
Sbjct:   14 STWTPLNHQLSNAHVFEERRNLLGKWFEKWTDSQRKQVLQDFFSRCSAGQLKHLRQTLSSWVPEETLDFTTVLPRVISLYIFSYLDPRSLCRCAQVSWHWKNLVELDQLWMPKCLKLGWCITFTPTPFEQGVWKRQYIETVQELHISRPKVPVKEEFIVPDVKVIGSETEGSLPLTGHRDLLGLHGRSKNGNDLGKSAKGLPPWRDSDRHPTDTIRFNYLDN-LHPGEHARKALLKTRQE 252          
BLAST of F-box only protein 16 vs. Ensembl Zebrafish
Match: fbxo16 (F-box protein 16 [Source:ZFIN;Acc:ZDB-GENE-041015-747])

HSP 1 Score: 192.2 bits (487), Expect = 3.606e-57
Identity = 96/240 (40.00%), Postives = 138/240 (57.50%), Query Frame = 2
Query:   77 STWTPLNHEDSNIKVFEERRSLVNKWFEMWNTNQRKQILEDLLTSCNGNQVEYAKLILSTKAIQKHVDFTRILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLAECNEIWAPKCARLGWYFTGPINTMESGLWKKHFIENIIFLQITRPAXXXXXX-----XXXXXXXXXXXXXXQAEKDEALRKAKRLKEKQLQAQKTSFAPWRGPDPRPIDIVRNNYIDNDIENGARFKMTFQKSHQK 781
            STWTPLNH+ SN  VFEERR+L+ KWFE W  +QRKQ+L+D  + C+  Q+++ +  LS+   ++ +DFT +LPRVI LYIFS+LDPRSLCR AQV W+WK L E +++W PKC +LGW  T      E G+WK+ +IE +  L I+RP    + +      +++   T   +     +D      +      L        PWR  D  P D +R NY+DN +  G   +    K+ Q+
Sbjct:   14 STWTPLNHQLSNAHVFEERRNLLGKWFEKWTDSQRKQVLQDFFSRCSAGQLKHLRQTLSSWVPEETLDFTTVLPRVISLYIFSYLDPRSLCRCAQVSWHWKNLVELDQLWMPKCLKLGWCITFTPTPFEQGVWKRQYIETVQELHISRPKVPVKEEFIVPDVKVIGSETEGSLPLTGHRDLLGLHGRSKNGNDLGKSAKGLPPWRDSDRHPTDTIRFNYLDN-LHPGEHARKALLKTRQE 252          
BLAST of F-box only protein 16 vs. Ensembl Zebrafish
Match: fbxo16 (F-box protein 16 [Source:ZFIN;Acc:ZDB-GENE-041015-747])

HSP 1 Score: 179.874 bits (455), Expect = 3.791e-54
Identity = 79/149 (53.02%), Postives = 107/149 (71.81%), Query Frame = 2
Query:   77 STWTPLNHEDSNIKVFEERRSLVNKWFEMWNTNQRKQILEDLLTSCNGNQVEYAKLILSTKAIQKHVDFTRILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLAECNEIWAPKCARLGWYFTGPINTMESGLWKKHFIENIIFLQITRP 523
            STWTPLNH+ SN  VFEERR+L+ KWFE W  +QRKQ+L+D  + C+  Q+++ +  LS+   ++ +DFT +LPRVI LYIFS+LDPRSLCR AQV W+WK L E +++W PKC +LGW  T      E G+WK+ +IE +  L I+RP
Sbjct:   14 STWTPLNHQLSNAHVFEERRNLLGKWFEKWTDSQRKQVLQDFFSRCSAGQLKHLRQTLSSWVPEETLDFTTVLPRVISLYIFSYLDPRSLCRCAQVSWHWKNLVELDQLWMPKCLKLGWCITFTPTPFEQGVWKRQYIETVQELHISRP 162          
BLAST of F-box only protein 16 vs. Ensembl Xenopus
Match: gucd1 (guanylyl cyclase domain containing 1 [Source:Xenbase;Acc:XB-GENE-941300])

HSP 1 Score: 184.496 bits (467), Expect = 2.350e-53
Identity = 98/225 (43.56%), Postives = 131/225 (58.22%), Query Frame = 2
Query:   77 STWTPLNHEDSNIKVFEERRSLVNKWFEMWNTNQRKQILEDLLTSCNGNQVEYAKLILSTKAIQKHVDFTRILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLAECNEIWAPKCARLGWYFTGPINTMESGLWKKHFIENIIFLQITRPAXXXXXXXXXXXXXXXXXXXXQAEKDEALRKAKRLKEKQLQAQ-KTSFAPWRGPDPRPIDIVRNNYIDN--DIENG 742
            STWTPLNH+  N KVFEER +L+ KWF+ W+  QR++IL DLL  C+ +Q+++    L  K  ++ +DFT ILPRV+ LYIFSFLDPRSLCR AQV W+WK L E +++W PKC R GWY        E  +WK+ +IE +  L ITRP    +   +    +  ++   +   D           K  ++Q K    PWR  D  P D VR NY+DN   IE G
Sbjct:   19 STWTPLNHQLMNDKVFEERCALLGKWFDKWSDAQRRRILTDLLERCSLSQLKFCNSHLQEKVPREALDFTSILPRVLSLYIFSFLDPRSLCRCAQVSWHWKSLTELDQLWMPKCLRFGWYINFSPTPFEQRIWKRQYIEMVKELHITRP----KTPPKDEFVVIDVQPIAKEAADTKFSPTYTYYPKSSKSQGKKDLPPWRSSDKHPTDTVRFNYLDNYDPIEQG 239          
BLAST of F-box only protein 16 vs. Ensembl Xenopus
Match: ENSXETT00000008237.1 (F-box and WD repeat domain containing 7 [Source:NCBI gene;Acc:100145670])

HSP 1 Score: 72.4034 bits (176), Expect = 5.018e-13
Identity = 34/94 (36.17%), Postives = 54/94 (57.45%), Query Frame = 2
Query:  149 KWFEMWNTNQRKQILEDLLTSCNGNQVEYAKLILSTKAIQKHVDFTRILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLAECNEIWAPKCARLG 430
            K F+ W+  ++   L++L+  C   QV++   ++     Q   DF  +LP+ + LY+ SFLDP+ L ++AQ C YW+ LAE N +W  KC   G
Sbjct:  235 KMFQSWSGPEKLLALDELIDICEPTQVKHMMQVIEP---QFQRDFISLLPKELALYVLSFLDPKDLLQAAQTCRYWRILAEDNLLWREKCKEDG 325          
BLAST of F-box only protein 16 vs. Ensembl Xenopus
Match: ENSXETT00000008111.1 (F-box and WD repeat domain containing 7 [Source:NCBI gene;Acc:100145670])

HSP 1 Score: 71.633 bits (174), Expect = 5.532e-13
Identity = 43/138 (31.16%), Postives = 71/138 (51.45%), Query Frame = 2
Query:   56 YAKGIVKSTWTPLNHED---SNIKVFEERR-------SLVNKWFEM---WNTNQRKQILEDLLTSCNGNQVEYAKLILSTKAIQKHVDFTRILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLAECNEIWAPKCARLG 430
            Y  G+V  + TP    D   +N +  + RR       + + +W +M   W+  ++   L++L+  C   QV++   ++     Q   DF  +LP+ + LY+ SFLDP+ L ++AQ C YW+ LAE N +W  KC   G
Sbjct:    2 YTTGLVPCSATPTTFGDLRAANGQGQQRRRITSVQPPTGLQEWLKMFQSWSGPEKLLALDELIDICEPTQVKHMMQVIEP---QFQRDFISLLPKELALYVLSFLDPKDLLQAAQTCRYWRILAEDNLLWREKCKEDG 136          
BLAST of F-box only protein 16 vs. Ensembl Xenopus
Match: ENSXETT00000008205.1 (F-box and WD repeat domain containing 7 [Source:NCBI gene;Acc:100145670])

HSP 1 Score: 71.633 bits (174), Expect = 8.145e-13
Identity = 34/94 (36.17%), Postives = 54/94 (57.45%), Query Frame = 2
Query:  149 KWFEMWNTNQRKQILEDLLTSCNGNQVEYAKLILSTKAIQKHVDFTRILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLAECNEIWAPKCARLG 430
            K F+ W+  ++   L++L+  C   QV++   ++     Q   DF  +LP+ + LY+ SFLDP+ L ++AQ C YW+ LAE N +W  KC   G
Sbjct:  305 KMFQSWSGPEKLLALDELIDICEPTQVKHMMQVIEP---QFQRDFISLLPKELALYVLSFLDPKDLLQAAQTCRYWRILAEDNLLWREKCKEDG 395          
BLAST of F-box only protein 16 vs. Ensembl Xenopus
Match: ENSXETT00000008122.1 (F-box and WD repeat domain containing 7 [Source:NCBI gene;Acc:100145670])

HSP 1 Score: 70.8626 bits (172), Expect = 1.203e-12
Identity = 34/94 (36.17%), Postives = 54/94 (57.45%), Query Frame = 2
Query:  149 KWFEMWNTNQRKQILEDLLTSCNGNQVEYAKLILSTKAIQKHVDFTRILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLAECNEIWAPKCARLG 430
            K F+ W+  ++   L++L+  C   QV++   ++     Q   DF  +LP+ + LY+ SFLDP+ L ++AQ C YW+ LAE N +W  KC   G
Sbjct:   84 KMFQSWSGPEKLLALDELIDICEPTQVKHMMQVIEP---QFQRDFISLLPKELALYVLSFLDPKDLLQAAQTCRYWRILAEDNLLWREKCKEDG 174          
BLAST of F-box only protein 16 vs. Ensembl Mouse
Match: Fbxo16 (F-box protein 16 [Source:MGI Symbol;Acc:MGI:1354706])

HSP 1 Score: 184.111 bits (466), Expect = 1.070e-54
Identity = 104/281 (37.01%), Postives = 156/281 (55.52%), Query Frame = 2
Query:   77 STWTPLNHEDSNIKVFEERRSLVNKWFEMWNTNQRKQILEDLLTSCNGNQVEYAKLILSTKAIQKHVDFTRILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLAECNEIWAPKCARLGWYFTGPINTMESGLWKKHFIENIIFLQITRPAXXXXXXXXXXXXXXXXXXXXQAEKDEAL--RKAKRLKEKQLQAQKTSFAPWRGPDPRPIDIVRNNYIDNDIENGARFKMTFQKSHQKT----RRLSHNDGNLSAKEKVH-----ASITTKQVDQNYILTLV 886
            STWTPLNH+  N +VFEERR+L+ KWF+ W  +QR++IL  LL  C+ +Q ++    L  K   + +DFT  LPRV+ +YIFSFLDPRSLCR AQV WYWK LAE +++W  KC R  WY +      E G+WKKH+I+ +  L +T+P    + +            +   ++  +L  R +  L++K    +K    PWR  D  P DI+R NY+DN   +   F++  +K  + T    R+L      L  + ++       S+ T+   +N  +TL+
Sbjct:   20 STWTPLNHQLLNDQVFEERRALLGKWFDKWTDSQRRRILTGLLERCSLSQQKFCCRKLQEKIPAEALDFTTKLPRVLSVYIFSFLDPRSLCRCAQVSWYWKSLAELDQLWMLKCLRFNWYISFSPTPFEQGVWKKHYIQMVRELHVTKPKTPPKDEFTTADVQPIPGNSPDEKQSPSLAFRSSSSLRKKNNPGEK-ELPPWRSSDKHPTDIIRFNYLDNC--DPELFRLGRRKRSEVTPDFKRQLRDKKNKLQDRARLRKAQSLVSLLTEHSSRNQEITLI 297          
BLAST of F-box only protein 16 vs. Ensembl Mouse
Match: Fbxo16 (F-box protein 16 [Source:MGI Symbol;Acc:MGI:1354706])

HSP 1 Score: 183.341 bits (464), Expect = 1.607e-54
Identity = 93/219 (42.47%), Postives = 131/219 (59.82%), Query Frame = 2
Query:   77 STWTPLNHEDSNIKVFEERRSLVNKWFEMWNTNQRKQILEDLLTSCNGNQVEYAKLILSTKAIQKHVDFTRILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLAECNEIWAPKCARLGWYFTGPINTMESGLWKKHFIENIIFLQITRPAXXXXXXXXXXXXXXXXXXXXQAEKDEAL--RKAKRLKEKQLQAQKTSFAPWRGPDPRPIDIVRNNYIDN 727
            STWTPLNH+  N +VFEERR+L+ KWF+ W  +QR++IL  LL  C+ +Q ++    L  K   + +DFT  LPRV+ +YIFSFLDPRSLCR AQV WYWK LAE +++W  KC R  WY +      E G+WKKH+I+ +  L +T+P    + +            +   ++  +L  R +  L++K    +K    PWR  D  P DI+R NY+DN
Sbjct:   20 STWTPLNHQLLNDQVFEERRALLGKWFDKWTDSQRRRILTGLLERCSLSQQKFCCRKLQEKIPAEALDFTTKLPRVLSVYIFSFLDPRSLCRCAQVSWYWKSLAELDQLWMLKCLRFNWYISFSPTPFEQGVWKKHYIQMVRELHVTKPKTPPKDEFTTADVQPIPGNSPDEKQSPSLAFRSSSSLRKKNNPGEK-ELPPWRSSDKHPTDIIRFNYLDN 237          
BLAST of F-box only protein 16 vs. Ensembl Mouse
Match: Fbxo16 (F-box protein 16 [Source:MGI Symbol;Acc:MGI:1354706])

HSP 1 Score: 184.496 bits (467), Expect = 1.640e-54
Identity = 93/219 (42.47%), Postives = 131/219 (59.82%), Query Frame = 2
Query:   77 STWTPLNHEDSNIKVFEERRSLVNKWFEMWNTNQRKQILEDLLTSCNGNQVEYAKLILSTKAIQKHVDFTRILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLAECNEIWAPKCARLGWYFTGPINTMESGLWKKHFIENIIFLQITRPAXXXXXXXXXXXXXXXXXXXXQAEKDEAL--RKAKRLKEKQLQAQKTSFAPWRGPDPRPIDIVRNNYIDN 727
            STWTPLNH+  N +VFEERR+L+ KWF+ W  +QR++IL  LL  C+ +Q ++    L  K   + +DFT  LPRV+ +YIFSFLDPRSLCR AQV WYWK LAE +++W  KC R  WY +      E G+WKKH+I+ +  L +T+P    + +            +   ++  +L  R +  L++K    +K    PWR  D  P DI+R NY+DN
Sbjct:   20 STWTPLNHQLLNDQVFEERRALLGKWFDKWTDSQRRRILTGLLERCSLSQQKFCCRKLQEKIPAEALDFTTKLPRVLSVYIFSFLDPRSLCRCAQVSWYWKSLAELDQLWMLKCLRFNWYISFSPTPFEQGVWKKHYIQMVRELHVTKPKTPPKDEFTTADVQPIPGNSPDEKQSPSLAFRSSSSLRKKNNPGEK-ELPPWRSSDKHPTDIIRFNYLDN 237          
BLAST of F-box only protein 16 vs. Ensembl Mouse
Match: Ect2l (epithelial cell transforming sequence 2 oncogene-like [Source:MGI Symbol;Acc:MGI:3641723])

HSP 1 Score: 134.42 bits (337), Expect = 1.284e-33
Identity = 56/138 (40.58%), Postives = 87/138 (63.04%), Query Frame = 2
Query:   77 STWTPLNHEDSNIKVFEERRSLVNKWFEMWNTNQRKQILEDLLTSCNGNQVEYAKLILSTKAIQKHVDFTRILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLAECNEIWAPKCARLGWYFTGPINTMESGLWKKHFI 490
            S WTP  ++  N ++F+ER +L++ WF++W   QR++ L  +L+ C+ +Q+ + +   S +     VDF+ +LPR I LYIFSFL+P+ LC +AQV W WK+L E + +W PKC + GW+        E G WK H+I
Sbjct:   21 SAWTPFKNQSLNRQLFQERVTLISHWFDLWTNKQRREFLFVILSQCSKSQLRFIQDWFSERKQVARVDFSTVLPRFISLYIFSFLNPKDLCAAAQVSWPWKFLTEQDCLWMPKCTKFGWFLPYTPTQNEYGAWKHHYI 158          
BLAST of F-box only protein 16 vs. Ensembl Mouse
Match: Ect2l (epithelial cell transforming sequence 2 oncogene-like [Source:MGI Symbol;Acc:MGI:3641723])

HSP 1 Score: 134.42 bits (337), Expect = 1.310e-33
Identity = 56/138 (40.58%), Postives = 87/138 (63.04%), Query Frame = 2
Query:   77 STWTPLNHEDSNIKVFEERRSLVNKWFEMWNTNQRKQILEDLLTSCNGNQVEYAKLILSTKAIQKHVDFTRILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLAECNEIWAPKCARLGWYFTGPINTMESGLWKKHFI 490
            S WTP  ++  N ++F+ER +L++ WF++W   QR++ L  +L+ C+ +Q+ + +   S +     VDF+ +LPR I LYIFSFL+P+ LC +AQV W WK+L E + +W PKC + GW+        E G WK H+I
Sbjct:   21 SAWTPFKNQSLNRQLFQERVTLISHWFDLWTNKQRREFLFVILSQCSKSQLRFIQDWFSERKQVARVDFSTVLPRFISLYIFSFLNPKDLCAAAQVSWPWKFLTEQDCLWMPKCTKFGWFLPYTPTQNEYGAWKHHYI 158          
BLAST of F-box only protein 16 vs. UniProt/SwissProt
Match: sp|Q8IX29|FBX16_HUMAN (F-box only protein 16 OS=Homo sapiens OX=9606 GN=FBXO16 PE=1 SV=1)

HSP 1 Score: 189.504 bits (480), Expect = 4.898e-56
Identity = 95/219 (43.38%), Postives = 132/219 (60.27%), Query Frame = 2
Query:   77 STWTPLNHEDSNIKVFEERRSLVNKWFEMWNTNQRKQILEDLLTSCNGNQVEYAKLILSTKAIQKHVDFTRILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLAECNEIWAPKCARLGWYFTGPINTMESGLWKKHFIENIIFLQITRPAXXXXXXXXXXXXXXXXXXXXQAEKD--EALRKAKRLKEKQLQAQKTSFAPWRGPDPRPIDIVRNNYIDN 727
            STWTPLNH+  N +VFEERR+L+ KWF+ W  +QR++IL  LL  C+ +Q ++    L  K   + +DFT  LPRV+ LYIFSFLDPRSLCR AQVCW+WK LAE +++W  KC R  WY        E G+WKKH+I+ +  L IT+P    +    +         + + ++    A R +  L++K    +K +  PWR  D  P DI+R NY+DN
Sbjct:   20 STWTPLNHQLLNDRVFEERRALLGKWFDKWTDSQRRRILTGLLERCSLSQQKFCCRKLQEKIPAEALDFTTKLPRVLSLYIFSFLDPRSLCRCAQVCWHWKNLAELDQLWMLKCLRFNWYINFSPTPFEQGIWKKHYIQMVKELHITKPKTPPKDGFVIADVQLVTSNSPEEKQSPLSAFRSSSSLRKKNNSGEK-ALPPWRSSDKHPTDIIRFNYLDN 237          
BLAST of F-box only protein 16 vs. UniProt/SwissProt
Match: sp|Q9QZM9|FBX16_MOUSE (F-box only protein 16 OS=Mus musculus OX=10090 GN=Fbxo16 PE=2 SV=1)

HSP 1 Score: 184.496 bits (467), Expect = 1.147e-53
Identity = 93/219 (42.47%), Postives = 131/219 (59.82%), Query Frame = 2
Query:   77 STWTPLNHEDSNIKVFEERRSLVNKWFEMWNTNQRKQILEDLLTSCNGNQVEYAKLILSTKAIQKHVDFTRILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLAECNEIWAPKCARLGWYFTGPINTMESGLWKKHFIENIIFLQITRPAXXXXXXXXXXXXXXXXXXXXQAEKDEAL--RKAKRLKEKQLQAQKTSFAPWRGPDPRPIDIVRNNYIDN 727
            STWTPLNH+  N +VFEERR+L+ KWF+ W  +QR++IL  LL  C+ +Q ++    L  K   + +DFT  LPRV+ +YIFSFLDPRSLCR AQV WYWK LAE +++W  KC R  WY +      E G+WKKH+I+ +  L +T+P    + +            +   ++  +L  R +  L++K    +K    PWR  D  P DI+R NY+DN
Sbjct:   20 STWTPLNHQLLNDQVFEERRALLGKWFDKWTDSQRRRILTGLLERCSLSQQKFCCRKLQEKIPAEALDFTTKLPRVLSVYIFSFLDPRSLCRCAQVSWYWKSLAELDQLWMLKCLRFNWYISFSPTPFEQGVWKKHYIQMVRELHVTKPKTPPKDEFTTADVQPIPGNSPDEKQSPSLAFRSSSSLRKKNNPGEK-ELPPWRSSDKHPTDIIRFNYLDN 237          
BLAST of F-box only protein 16 vs. UniProt/SwissProt
Match: sp|Q008S8|ECT2L_HUMAN (Epithelial cell-transforming sequence 2 oncogene-like OS=Homo sapiens OX=9606 GN=ECT2L PE=2 SV=2)

HSP 1 Score: 132.494 bits (332), Expect = 3.291e-32
Identity = 70/202 (34.65%), Postives = 110/202 (54.46%), Query Frame = 2
Query:   77 STWTPLNHEDSNIKVFEERRSLVNKWFEMWNTNQRKQILEDLLTSCNGNQVEYAKLILSTKAIQKHVDFTRILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLAECNEIWAPKCARLGWYFTGPINTMESGLWKKHFIENIIFLQITRPAXXXXXXXXXXXXXXXXXXXXQAEKDEALRKAKRLKEKQLQAQKTSFA---PW 673
            S WTP +++  N ++F+ER +L++ WF++W   QR++ L  +   C  +Q+ + +   S +     VDF+ +LPR I LYIFSFL P+ LC +AQV W WK+L E + +W PKC + GW+        E G WK+H+I  +  L    P +       L +  T  E   + ++++ LR  KR+ EK    +K  F    PW
Sbjct:    9 SAWTPFSNKSLNRQLFQERVALISHWFDLWTNKQRQEFLFAIFLRCTKSQLRFVQDWFSERMQVAKVDFSTVLPRFISLYIFSFLSPKDLCAAAQVSWPWKFLTEQDCLWMPKCVKFGWFLPYTPTDNEYGAWKRHYIACVSHLDWLTPREAAATYGTLNEPKTEDEELLERQREKCLR--KRIWEKIALRKKELFKVRPPW 208          
BLAST of F-box only protein 16 vs. UniProt/SwissProt
Match: sp|D3Z902|FBXW7_RAT (F-box/WD repeat-containing protein 7 OS=Rattus norvegicus OX=10116 GN=Fbxw7 PE=1 SV=2)

HSP 1 Score: 73.1738 bits (178), Expect = 1.256e-12
Identity = 34/94 (36.17%), Postives = 55/94 (58.51%), Query Frame = 2
Query:  149 KWFEMWNTNQRKQILEDLLTSCNGNQVEYAKLILSTKAIQKHVDFTRILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLAECNEIWAPKCARLG 430
            K F+ W+  ++   L++L+ SC   QV++   ++     Q   DF  +LP+ + LY+ SFL+P+ L ++AQ C YW+ LAE N +W  KC   G
Sbjct:  245 KMFQSWSGPEKLLALDELIDSCEPTQVKHMMQVIEP---QFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEG 335          
BLAST of F-box only protein 16 vs. UniProt/SwissProt
Match: sp|Q969H0|FBXW7_HUMAN (F-box/WD repeat-containing protein 7 OS=Homo sapiens OX=9606 GN=FBXW7 PE=1 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.307e-12
Identity = 34/94 (36.17%), Postives = 55/94 (58.51%), Query Frame = 2
Query:  149 KWFEMWNTNQRKQILEDLLTSCNGNQVEYAKLILSTKAIQKHVDFTRILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLAECNEIWAPKCARLG 430
            K F+ W+  ++   L++L+ SC   QV++   ++     Q   DF  +LP+ + LY+ SFL+P+ L ++AQ C YW+ LAE N +W  KC   G
Sbjct:  239 KMFQSWSGPEKLLALDELIDSCEPTQVKHMMQVIEP---QFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEG 329          
BLAST of F-box only protein 16 vs. TrEMBL
Match: A0A2R2MTD8 (F-box only protein 16 isoform X3 OS=Lingula unguis OX=7574 GN=LOC106158756 PE=4 SV=1)

HSP 1 Score: 208.379 bits (529), Expect = 1.399e-59
Identity = 108/240 (45.00%), Postives = 141/240 (58.75%), Query Frame = 2
Query:   59 AKGIVKSTWTPLNHEDSNIKVFEERRSLVNKWFEMWNTNQRKQILEDLLTSCNGNQVEYAKLILSTKAIQKHVDFTRILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLAECNEIWAPKCARLGWYFTGPINTMESGLWKKHFIENIIFLQITRPAXXXXXXXXXXXXXXXXXXXX-QAEKDE-------------ALRKAKRLKEKQLQAQKTSFAPWRGPDPRPIDIVRNNYIDNDIE 736
            AK  +KS+WTPL++ED N ++FEERR LV+KWF+ W   QRK+ILEDL   C   Q+E+   I++ K    H DFTR+LPRV+ LY+FSFLDPRSLCRS++VCWYWK+LAE +EIW  KC RLGWY     +  E GLWKKH++E I  +Q  RP +  + +  L      +E     + KD+                       K   A      PW+G DP P D  R NY+DN+ E
Sbjct:   23 AKNRLKSSWTPLSNEDHNHQIFEERRQLVSKWFDKWTDEQRKKILEDLTGKCRKKQLEFTADIVNKKVPIYHQDFTRVLPRVLSLYLFSFLDPRSLCRSSRVCWYWKFLAESDEIWMGKCMRLGWYLPFTPSPYERGLWKKHYVETIRGIQYIRPKEYPKPESTLPPPSEDMESMTIHSPKDDHDRRSRRPPRPRSGKDTPTSSSRKPAAAVPGKPPPWKGSDPTPKDTWRYNYLDNEDE 262          
BLAST of F-box only protein 16 vs. TrEMBL
Match: A0A2R2MTM8 (F-box only protein 16 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106158756 PE=4 SV=1)

HSP 1 Score: 208.764 bits (530), Expect = 1.883e-59
Identity = 108/240 (45.00%), Postives = 141/240 (58.75%), Query Frame = 2
Query:   59 AKGIVKSTWTPLNHEDSNIKVFEERRSLVNKWFEMWNTNQRKQILEDLLTSCNGNQVEYAKLILSTKAIQKHVDFTRILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLAECNEIWAPKCARLGWYFTGPINTMESGLWKKHFIENIIFLQITRPAXXXXXXXXXXXXXXXXXXXX-QAEKDE-------------ALRKAKRLKEKQLQAQKTSFAPWRGPDPRPIDIVRNNYIDNDIE 736
            AK  +KS+WTPL++ED N ++FEERR LV+KWF+ W   QRK+ILEDL   C   Q+E+   I++ K    H DFTR+LPRV+ LY+FSFLDPRSLCRS++VCWYWK+LAE +EIW  KC RLGWY     +  E GLWKKH++E I  +Q  RP +  + +  L      +E     + KD+                       K   A      PW+G DP P D  R NY+DN+ E
Sbjct:   23 AKNRLKSSWTPLSNEDHNHQIFEERRQLVSKWFDKWTDEQRKKILEDLTGKCRKKQLEFTADIVNKKVPIYHQDFTRVLPRVLSLYLFSFLDPRSLCRSSRVCWYWKFLAESDEIWMGKCMRLGWYLPFTPSPYERGLWKKHYVETIRGIQYIRPKEYPKPESTLPPPSEDMESMTIHSPKDDHDRRSRRPPRPRSGKDTPTSSSRKPAAAVPGKPPPWKGSDPTPKDTWRYNYLDNEDE 262          
BLAST of F-box only protein 16 vs. TrEMBL
Match: A0A2R2MSZ9 (F-box only protein 16 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106158756 PE=4 SV=1)

HSP 1 Score: 208.379 bits (529), Expect = 5.247e-59
Identity = 108/240 (45.00%), Postives = 141/240 (58.75%), Query Frame = 2
Query:   59 AKGIVKSTWTPLNHEDSNIKVFEERRSLVNKWFEMWNTNQRKQILEDLLTSCNGNQVEYAKLILSTKAIQKHVDFTRILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLAECNEIWAPKCARLGWYFTGPINTMESGLWKKHFIENIIFLQITRPAXXXXXXXXXXXXXXXXXXXX-QAEKDE-------------ALRKAKRLKEKQLQAQKTSFAPWRGPDPRPIDIVRNNYIDNDIE 736
            AK  +KS+WTPL++ED N ++FEERR LV+KWF+ W   QRK+ILEDL   C   Q+E+   I++ K    H DFTR+LPRV+ LY+FSFLDPRSLCRS++VCWYWK+LAE +EIW  KC RLGWY     +  E GLWKKH++E I  +Q  RP +  + +  L      +E     + KD+                       K   A      PW+G DP P D  R NY+DN+ E
Sbjct:   23 AKNRLKSSWTPLSNEDHNHQIFEERRQLVSKWFDKWTDEQRKKILEDLTGKCRKKQLEFTADIVNKKVPIYHQDFTRVLPRVLSLYLFSFLDPRSLCRSSRVCWYWKFLAESDEIWMGKCMRLGWYLPFTPSPYERGLWKKHYVETIRGIQYIRPKEYPKPESTLPPPSEDMESMTIHSPKDDHDRRSRRPPRPRSGKDTPTSSSRKPAAAVPGKPPPWKGSDPTPKDTWRYNYLDNEDE 262          
BLAST of F-box only protein 16 vs. TrEMBL
Match: A0A210PSQ1 (F-box only protein 16 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT23296 PE=4 SV=1)

HSP 1 Score: 204.142 bits (518), Expect = 9.656e-59
Identity = 113/319 (35.42%), Postives = 180/319 (56.43%), Query Frame = 2
Query:   59 AKGIVKSTWTPLNHEDSNIKVFEERRSLVNKWFEMWNTNQRKQILEDLLTSCNGNQVEYAKLILSTKAIQKHVDFTRILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLAECNEIWAPKCARLGWYFTGPINTMESGLWKKHFIENIIFLQITRPAXXXXXXXXXXXXXXXXXXXXQAEKDEALRKAKRLKEKQLQAQKTSFAPWRGPDPRPIDIVRNNYIDND----IENGARFKMTF-------QKSHQKTRRLSHNDGNLSAKEKVHASITTKQVDQNYILTLVKSKLETEDIKCNSPAVP----VENIHRPGPIN 970
            AK   KSTWTPL++ ++N ++F+ER++L+ KWF+ W   QRK+I EDL+      Q+ YA+ +L+      H DFTR+LPRV+ +YI SFLDPR+LCR A+VCWYWK+L+E +++W PKC RLGW  +   +  E+G+WK++++EN+  L++ RP+                   +Q EK + L   K  +  + +++K    PWRG DP P D  R N ++ND      N  R +MT+        K+ +   +  HN  N+S +  + AS+   +++  +       + +    K  SP V     +E + RPGP++
Sbjct:    5 AKNRTKSTWTPLSNGNTNNQIFDERKALIGKWFDRWTDEQRKKIFEDLVQRSKHKQLHYARDLLNETVPAFHEDFTRVLPRVLSVYILSFLDPRTLCRCARVCWYWKHLSESDKLWMPKCLRLGWILSFTPSPYETGVWKRNYVENLRLLKVHRPS---------------HSTLEQLEKLK-LDLEKDYRVSKHKSKKKEKTPWRGSDPVPKDTWRYNVLENDDVVQSVNKIRKRMTYGSEAEMVSKNAKSKVKAGHNALNMSTRRSISASVP--RLNTGFTENDGLGRPQWAKNKTGSPYVSFDPGMETVQRPGPVS 305          
BLAST of F-box only protein 16 vs. TrEMBL
Match: R7TTL6 (F-box domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_170674 PE=4 SV=1)

HSP 1 Score: 202.216 bits (513), Expect = 1.464e-57
Identity = 107/248 (43.15%), Postives = 141/248 (56.85%), Query Frame = 2
Query:   50 SKYAKGIVKSTWTPLNHEDSNIK-------------------VFEERRSLVNKWFEMWNTNQRKQILEDLLTSCNGNQVEYAKLILSTKAIQKHVDFTRILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLAECNEIWAPKCARLGWYFTGPINTMESGLWKKHFIENIIFLQITRPAXXXXXXXXXXXXXXXXXXXXQAEKDEALRKAKRLKEKQLQAQKTSFAPWRGPDPRPIDIVRNNYIDNDIE 736
            S  AK  V+STWTPL +++ N K                   +FEERR+LV KWF+ W  +QRKQ++E+L+  C   QV++   ++S K    H DFTR LPRVI LYIFSFLDPRSLCR +QVCW+WKYL E ++IW PKC RLGW      +  E+G+WK+ +IE I+ L+   P        QL   ++ + +    E    L   +         QK +  PWRG DP P DI RNNY+ ND E
Sbjct:    2 SNLAKNRVQSTWTPLGNQEFNQKSKDSTPKSPPTKGPDPLRGIFEERRALVGKWFDKWTDSQRKQVIEELMNKCKSKQVQFTIDVISKKQPIFHDDFTRGLPRVISLYIFSFLDPRSLCRCSQVCWHWKYLTEVDQIWMPKCCRLGWVLPFSPSPYETGVWKRLYIEKIMALKSYAPTVPMSSNGQLESSVSKMSLLADMEAKGLLNTPR---------QKDARPPWRGSDPTPKDIWRNNYLQNDDE 240          
BLAST of F-box only protein 16 vs. Ensembl Cavefish
Match: ccdc28a (epithelial cell transforming 2 like [Source:NCBI gene;Acc:103047164])

HSP 1 Score: 122.479 bits (306), Expect = 9.435e-30
Identity = 56/144 (38.89%), Postives = 87/144 (60.42%), Query Frame = 2
Query:   59 AKGIVKSTWTPLNHEDSNIKVFEERRSLVNKWFEMWNTNQRKQILEDLLTSCNGNQVEYAKLILSTKAIQKHVDFTRILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLAECNEIWAPKCARLGWYFTGPINTMESGLWKKHFI 490
            A   + STWTP+ ++ SN ++F+ER +L+  WF++W   QRK +L  LL  C  +Q+++             +DF  +LPR + LYI SFL+P  L  +AQV W+W++LAE + +W PKC R GW+     +  E G WK+H++
Sbjct:   25 AGATLFSTWTPVTNKPSNQQLFQERTTLILHWFDLWTDGQRKHLLHLLLRRCPKSQLKFVSDRFMEAVPITQLDFVTVLPRFLSLYILSFLNPVDLSAAAQVSWHWRFLAEQDCLWLPKCVRRGWFLPYSPSDTEYGAWKRHYV 168          
BLAST of F-box only protein 16 vs. Ensembl Cavefish
Match: fbxw7 (F-box and WD repeat domain containing 7 [Source:NCBI gene;Acc:103046885])

HSP 1 Score: 72.0182 bits (175), Expect = 4.096e-13
Identity = 33/92 (35.87%), Postives = 54/92 (58.70%), Query Frame = 2
Query:  155 FEMWNTNQRKQILEDLLTSCNGNQVEYAKLILSTKAIQKHVDFTRILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLAECNEIWAPKCARLG 430
            F+ W+  ++   L++L+ SC   QV++   ++     Q   DF  +LP+ + LY+ SFL+P+ L ++AQ C YW+ LAE N +W  KC   G
Sbjct:  324 FQSWSGPEKLLALDELIDSCEPTQVKHMMQVIEP---QFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCREEG 412          
BLAST of F-box only protein 16 vs. Ensembl Cavefish
Match: fbxw7 (F-box and WD repeat domain containing 7 [Source:NCBI gene;Acc:103046885])

HSP 1 Score: 70.4774 bits (171), Expect = 8.280e-13
Identity = 33/92 (35.87%), Postives = 54/92 (58.70%), Query Frame = 2
Query:  155 FEMWNTNQRKQILEDLLTSCNGNQVEYAKLILSTKAIQKHVDFTRILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLAECNEIWAPKCARLG 430
            F+ W+  ++   L++L+ SC   QV++   ++     Q   DF  +LP+ + LY+ SFL+P+ L ++AQ C YW+ LAE N +W  KC   G
Sbjct:   82 FQSWSGPEKLLALDELIDSCEPTQVKHMMQVIEP---QFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCREEG 170          
BLAST of F-box only protein 16 vs. Ensembl Cavefish
Match: fbxw2 (F-box and WD repeat domain containing 2 [Source:NCBI gene;Acc:103029011])

HSP 1 Score: 53.9138 bits (128), Expect = 1.671e-7
Identity = 37/128 (28.91%), Postives = 62/128 (48.44%), Query Frame = 2
Query:  116 KVFEERRSLVNKWFEMWNTNQRKQILEDLLTSCNGNQVEYAKLILSTKAIQKHVDFTRILPRVICLYIFSFLDPRSLCRSAQVCWYW-KYLAECNEIWAPKCARLGWYFTGPINTMESGL-WKKHFIE 493
            + FE     V+  F   N  QR Q L+ L++     Q+ +    L T   +   DF R+LP  +  Y+  +LDP++L     VC  W K +  C E+W   C  LGW      ++++ G+ WK+ +++
Sbjct:    4 EAFEGWLESVSASFLALNDQQRNQSLDHLISLSGAVQLRHLSNGLETLLKR---DFLRLLPLELAFYLLRWLDPQTLLTCCLVCKQWNKVINACTEVWQGVCRDLGWRID---DSIQDGVHWKQVYLK 125          
BLAST of F-box only protein 16 vs. Ensembl Sea Lamprey
Match: FBXO16 (F-box protein 16 [Source:HGNC Symbol;Acc:HGNC:13618])

HSP 1 Score: 157.147 bits (396), Expect = 4.699e-47
Identity = 68/136 (50.00%), Postives = 95/136 (69.85%), Query Frame = 2
Query:  116 KVFEERRSLVNKWFEMWNTNQRKQILEDLLTSCNGNQVEYAKLILSTKAIQKHVDFTRILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLAECNEIWAPKCARLGWYFTGPINTMESGLWKKHFIENIIFLQITRP 523
            +VFEERR LV KWFE W   QR+++LE++L+ C+  Q+ + + +LS+   Q+ +D  R LPRV+CLYIF+ LDPRSLCR+AQVCWYW++L+E + +W PKC R GW         E GLWK+H+I+ +  L   RP
Sbjct:    1 QVFEERRELVAKWFERWTDIQRRRVLEEVLSFCSERQLRHCEALLSSALPQRALDPARALPRVLCLYIFAHLDPRSLCRAAQVCWYWRHLSESDCLWMPKCLRFGWSLGFSPTPFEQGLWKRHYIQAVHELHCLRP 136          
BLAST of F-box only protein 16 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008862.1 (pep scaffold:Pmarinus_7.0:GL476579:86637:114999:1 gene:ENSPMAG00000008000.1 transcript:ENSPMAT00000008862.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 71.633 bits (174), Expect = 9.228e-14
Identity = 34/92 (36.96%), Postives = 53/92 (57.61%), Query Frame = 2
Query:  155 FEMWNTNQRKQILEDLLTSCNGNQVEYAKLILSTKAIQKHVDFTRILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLAECNEIWAPKCARLG 430
            F+ W+  +R   L++L+  C   Q+++   ++     Q   DF  +LP+ + LY+ SFL+PR L R+AQ C YW+ LAE N +W  KC   G
Sbjct:   94 FQSWSGPERLLALDELIDRCEPPQIKHVMQVIEP---QFQRDFISLLPKELALYVLSFLEPRDLLRAAQTCRYWRILAEDNLLWREKCREEG 182          
BLAST of F-box only protein 16 vs. Ensembl Sea Lamprey
Match: fbxw2 (F-box and WD repeat domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-050522-303])

HSP 1 Score: 59.3066 bits (142), Expect = 5.492e-10
Identity = 38/125 (30.40%), Postives = 61/125 (48.80%), Query Frame = 2
Query:  122 FEERRSLVNKWFEMWNTNQRKQILEDLLTSCNGNQVEYAKLILSTKAIQKHVDFTRILPRVICLYIFSFLDPRSLCRSAQVCWYW-KYLAECNEIWAPKCARLGWYFTGPINTMESGLWKKHFIE 493
            FE     V++ F   +  QR  +L+ L+ S    Q+ +  L    +++ K  DF R+LP  +  ++  +LDPRSL     VC  W K +  C+E+W   C  LGW      +T +   WK  +I+
Sbjct:    6 FESWLQQVSRGFVSLSDGQRNAVLDVLIASSGPTQLRH--LSTQLESLLKR-DFLRLLPLELSFHLLKWLDPRSLLTCCLVCRSWNKVVNGCSEVWLSACRELGWRVPDECSTQDGRHWKCAYIQ 127          
BLAST of F-box only protein 16 vs. Ensembl Yeast
Match: MET30 (F-box protein containing five copies of the WD40 motif; controls cell cycle function, sulfur metabolism, and methionine biosynthesis as part of the ubiquitin ligase complex; interacts with and regulates Met4p, localizes within the nucleus; dissociation of Met30p from SCF complex in response to cadmium stress is regulated by Cdc48p [Source:SGD;Acc:S000001308])

HSP 1 Score: 53.9138 bits (128), Expect = 2.377e-8
Identity = 33/97 (34.02%), Postives = 52/97 (53.61%), Query Frame = 2
Query:  167 NTNQRKQILEDLLTSCNGNQVEYAKLILSTKAIQKHVDFTRILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLAECNEIWAP--------KCARLGW 433
            N   RK IL+ +L++    Q+ Y   ++ T  I+  +DF  ILP+ + L I S+LD +SLC + +VC  W+ LA+ + +W          KC   GW
Sbjct:  148 NDKIRKLILDGILSTSCFPQLSYISSLV-THMIK--IDFISILPQELSLKILSYLDCQSLCNATRVCRKWQKLADDDRVWYHMCEQHIDRKCPNCGW 241          
BLAST of F-box only protein 16 vs. Ensembl Nematostella
Match: EDO44013 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWR2])

HSP 1 Score: 139.813 bits (351), Expect = 5.622e-36
Identity = 79/221 (35.75%), Postives = 115/221 (52.04%), Query Frame = 2
Query:   77 STWTPLNHEDSNIKVFEERRSLVNKWFEMWNTNQRKQILEDLLTSCNGNQVEYAKLILSTKAIQ-KHVDFTRILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLAECNEIWAPKCARLGWYFTGPINTMESGLWKKHFIENIIFLQITRPAXXXXXXXXXXXXXXXXXXXXQAEKDEALRK-AKRLKEKQLQAQKTSFAPWRGPD--PRPIDIVRNNYIDN 727
            S WTP+ +  +N K+++ER  L+  WF MW   Q K+ L  +L  C  +Q++Y KL      +   H DFT +LPR I +YIFSFLDPRSL R+A V W+WK+L E +EIW PKC R GW+     +  + G WK H+I     L +  P+++K  +      +   +      K +   K A++ KE     Q     PW   D  P+ +D  R   +D 
Sbjct:   69 SAWTPVLNPYNNNKLYQERVDLIGHWFSMWTDAQCKKFLSFILQRCTKSQMKYLKLGYFNHPLPIYHQDFTTVLPRFISMYIFSFLDPRSLSRAAMVSWHWKFLCEQDEIWMPKCQRFGWFLPYKPDVNKYGAWKNHYIMCYSTLDVEGPSEVKMAEMYGQFGVVPPDKRSSKRKSKGKEKSARKSKEILYYRQDNHRPPWIYTDQNPKDLDDARKALLDG 289          
BLAST of F-box only protein 16 vs. Ensembl Nematostella
Match: EDO36656 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHY7])

HSP 1 Score: 97.4413 bits (241), Expect = 3.447e-25
Identity = 43/79 (54.43%), Postives = 57/79 (72.15%), Query Frame = 2
Query:  155 FEMWNTNQRKQILEDLLTSCNGNQVEYAKLILSTKAIQKHVDFTRILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLAE 391
            F+ W   QR+ IL+ ++  C  +Q+++   +L  +    HVDFTR LPRVI +YIFSFLDPRSLCR +QVCWYW+YLAE
Sbjct:    1 FDRWTDAQRRTILDIIIPKCKQHQLQHVFSLLDERIPVTHVDFTRKLPRVITVYIFSFLDPRSLCRCSQVCWYWRYLAE 79          
BLAST of F-box only protein 16 vs. Ensembl Nematostella
Match: EDO26920 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TAQ1])

HSP 1 Score: 97.4413 bits (241), Expect = 5.544e-25
Identity = 42/83 (50.60%), Postives = 52/83 (62.65%), Query Frame = 2
Query:  278 DFTRILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLAECNEIWAPKCARLGWYFTGPINTMESGLWKKHFIENIIFLQITRPA 526
            DFT  LPR I +YIFSFLDPRSL R A V W+WK+L E ++IW PKC R GW+     +  E G WK H+I     L +  P+
Sbjct:    1 DFTTALPRFISMYIFSFLDPRSLSRGAMVSWHWKFLCEQDDIWMPKCQRFGWFLPYKPDVNEYGAWKNHYIMCYSTLDVEGPS 83          
BLAST of F-box only protein 16 vs. Ensembl Nematostella
Match: EDO42306 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1V2])

HSP 1 Score: 64.6994 bits (156), Expect = 3.022e-11
Identity = 30/92 (32.61%), Postives = 51/92 (55.43%), Query Frame = 2
Query:  155 FEMWNTNQRKQILEDLLTSCNGNQVEYAKLILSTKAIQKHVDFTRILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLAECNEIWAPKCARLG 430
            F+ W+  ++K  +E+++ +C  + V +   ++ T   +   DF  +LPR + LY+ SFL+P  L  +AQ C  W+ L E N +W  KC   G
Sbjct:  137 FQQWDPEEKKYAIEEIIETCEPSLVRH---MMGTIEPRFQRDFISLLPRELALYVLSFLEPSDLLHAAQTCKCWQILCEDNLLWKQKCREAG 225          
BLAST of F-box only protein 16 vs. Ensembl Nematostella
Match: EDO32198 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVR9])

HSP 1 Score: 58.9214 bits (141), Expect = 1.847e-9
Identity = 43/127 (33.86%), Postives = 66/127 (51.97%), Query Frame = 2
Query:  128 ERRSLVNKWFE-MWNTNQRKQILEDLLTSCNGNQVEYAKLILSTK--AIQKHVDFTRILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLAECNEIWAPKCARLGWYFTGPINTMESGLWKKHFIENI 499
            E    V +WFE  W+ +QR   L+  L       +E A+L L +   A+++  DF  +LP  + L + S+L P  L  +AQVC +W+ +A  +E+W  KC RL  Y   P++     +WK  F  NI
Sbjct:  268 ENAQCVVQWFEEKWDGSQRNHFLQLFL-----RILEPAELYLLSGLLAVRQFRDFISLLPDELSLKVLSYLRPNELLVAAQVCKFWQGMASRDELWQAKC-RLQ-YVGVPLSV--PAIWKDIFKRNI 385          
BLAST of F-box only protein 16 vs. Ensembl Medaka
Match: fbxo16 (F-box protein 16 [Source:NCBI gene;Acc:101159553])

HSP 1 Score: 169.474 bits (428), Expect = 1.931e-48
Identity = 87/243 (35.80%), Postives = 131/243 (53.91%), Query Frame = 2
Query:   74 KSTWTPLNHEDSNIKVFEERRSLVNKWFEMWNTNQRKQILEDLLTSCNGNQVEYAKLILSTKAIQKHVDFTRILPRVICLYIFSFLDPRSLCRSAQ-------------------------VCWYWKYLAECNEIWAPKCARLGWYFTGPINTMESGLWKKHFIENIIFLQITRPAXXXXXXXXXXXXXXXXXXXXQAEKDEALRKAKRLKEKQLQAQKTSFAPWRGPDPRPIDIVRNNYIDN 727
            +S WTP+NH  +N ++FEERR LV KWF  W+ +QRK++L+DL+ +C   Q+ +  L +S +   +  DFT +LPR ICLY+FSFLDPRSLCR AQ                         V W+WK + E +++W PKC +LGW         E  +WK+H+I+ +  LQ+ +P   ++L     Q ++       A +       K     +L+ +  +  PWR  D  P DI+R NY++N
Sbjct:    5 RSAWTPMNHLLANTQIFEERRKLVAKWFNRWSDSQRKEVLQDLVLNCAEEQLRFLSLSVSRRLPLQAADFTCLLPRAICLYVFSFLDPRSLCRCAQVHALKSSDGVCWTDLLIRISVSVEKVSWHWKSMVELDQLWMPKCLKLGWCIDFSPTPFEQSIWKRHYIQTVQELQLLKPVSSQRLMLPDSQVVSESPELVNATEGRPGTATK--TRSRLKLETPALPPWRHSDRCPKDIIRFNYLNN 245          
BLAST of F-box only protein 16 vs. Ensembl Medaka
Match: ccdc28a (epithelial cell transforming 2 like [Source:NCBI gene;Acc:101163642])

HSP 1 Score: 134.806 bits (338), Expect = 7.392e-34
Identity = 58/146 (39.73%), Postives = 87/146 (59.59%), Query Frame = 2
Query:   77 STWTPLNHEDSNIKVFEERRSLVNKWFEMWNTNQRKQILEDLLTSCNGNQVEYAKLILSTKAIQKHVDFTRILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLAECNEIWAPKCARLGWYFTGPINTMESGLWKKHFIENIIFLQI 514
            STWTPL+ +  N+++FEER SLV +WF++W   QR+ +L  LL  C+ + +   +  L+       +DFT +LPR + LYI SFL P  LCR+A+V WYW+ L E + +W  +C R GW+        E G WK H++  +  L +
Sbjct:   19 STWTPLSDKQGNLQLFEERVSLVTRWFDLWTRAQREHLLRSLLARCSKSHLSSCRDWLTEMVPVSQLDFTAVLPRFLSLYIMSFLSPLDLCRAAKVSWYWRILTEQDCLWVDRCVRRGWFLPYTPAEKEFGAWKNHYVSCLSTLDL 164          
BLAST of F-box only protein 16 vs. Ensembl Medaka
Match: ENSORLT00000003546.2 (F-box/WD repeat-containing protein 7 [Source:NCBI gene;Acc:101171440])

HSP 1 Score: 73.9442 bits (180), Expect = 6.820e-14
Identity = 35/92 (38.04%), Postives = 54/92 (58.70%), Query Frame = 2
Query:  155 FEMWNTNQRKQILEDLLTSCNGNQVEYAKLILSTKAIQKHVDFTRILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLAECNEIWAPKCARLG 430
            F+MW+  +R   L++L+  C  +QV++   ++     Q   DF  +LP+ + LY+ +FL PR L R+AQ C YW+ LAE N +W  KC   G
Sbjct:   85 FQMWSGPERLLALDELIDRCETSQVKHVMQVIEP---QFQRDFISLLPKELALYVLTFLPPRDLLRAAQTCRYWRILAEDNLLWREKCREEG 173          
BLAST of F-box only protein 16 vs. Ensembl Medaka
Match: fbxw7 (F-box and WD repeat domain containing 7 [Source:NCBI gene;Acc:101155087])

HSP 1 Score: 72.4034 bits (176), Expect = 3.040e-13
Identity = 33/92 (35.87%), Postives = 53/92 (57.61%), Query Frame = 2
Query:  155 FEMWNTNQRKQILEDLLTSCNGNQVEYAKLILSTKAIQKHVDFTRILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLAECNEIWAPKCARLG 430
            F+ W   ++   L++L+ SC   QV++   ++     Q   DF  +LP+ + LY+ SFL+P+ L ++AQ C YW+ LAE N +W  KC   G
Sbjct:  312 FQSWTGPEKLLALDELIDSCEPTQVKHMMQVIEP---QFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCREEG 400          
BLAST of F-box only protein 16 vs. Ensembl Medaka
Match: fbxw7 (F-box and WD repeat domain containing 7 [Source:NCBI gene;Acc:101155087])

HSP 1 Score: 70.4774 bits (171), Expect = 9.733e-13
Identity = 33/92 (35.87%), Postives = 53/92 (57.61%), Query Frame = 2
Query:  155 FEMWNTNQRKQILEDLLTSCNGNQVEYAKLILSTKAIQKHVDFTRILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLAECNEIWAPKCARLG 430
            F+ W   ++   L++L+ SC   QV++   ++     Q   DF  +LP+ + LY+ SFL+P+ L ++AQ C YW+ LAE N +W  KC   G
Sbjct:   87 FQSWTGPEKLLALDELIDSCEPTQVKHMMQVIEP---QFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCREEG 175          
BLAST of F-box only protein 16 vs. Planmine SMEST
Match: SMESG000017118.1 (SMESG000017118.1)

HSP 1 Score: 678.707 bits (1750), Expect = 0.000e+0
Identity = 332/355 (93.52%), Postives = 334/355 (94.08%), Query Frame = 2
Query:   44 MTSKYAKGIVKSTWTPLNHEDSNIKVFEERRSLVNKWFEMWNTNQRKQILEDLLTSCNGNQVEYAKLILSTKAIQKHVDFTRILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLAECNEIWAPKCARLGWYFTGPINTMESGLWKKHFIENIIFLQITRPAXXXXXXXXXXXXXXXXXXXXQAEKDEALRKAKRLKEKQLQAQKTSFAPWRGPDPRPIDIVRNNYIDNDIENGARFKMTFQKSHQKTRRLSHNDGNLSAKEKVHASITTKQVDQNYILTLVKSKLETEDIKCNSPAVPVENIHRPGPINGHIRTSVIKPAENNIADNNSSVNAKEEITDIPSGRPWILPIGDQED 1108
            MTSKYAKGIVKSTWTPLNHEDSNIKVFEERRSLVNKWFEMWNTNQRKQILEDLLTSCNGNQVEYAKLILSTKAIQKHVDFTRILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLAECNEIWAPKCARLGWYFTGPINTMESGLWKKHFIENIIFLQITRPAK     +             QAEKDEALRKAKRLKEKQLQAQKTSFAPWRGPDPRPIDIVRNNYIDNDIENGARFKMT QKSHQKTRRLSHNDGNLSAKEKVHASITTKQVDQN+ILT VKSKLETEDIKCNSP VPVENIHRPGPINGHIRTSVIKPAENNIADNNSSVNAKEEITDIPSGRPWILPIGDQED
Sbjct:    1 MTSKYAKGIVKSTWTPLNHEDSNIKVFEERRSLVNKWFEMWNTNQRKQILEDLLTSCNGNQVEYAKLILSTKAIQKHVDFTRILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLAECNEIWAPKCARLGWYFTGPINTMESGLWKKHFIENIIFLQITRPAKELTTIEITK----------QAEKDEALRKAKRLKEKQLQAQKTSFAPWRGPDPRPIDIVRNNYIDNDIENGARFKMTIQKSHQKTRRLSHNDGNLSAKEKVHASITTKQVDQNFILTPVKSKLETEDIKCNSPVVPVENIHRPGPINGHIRTSVIKPAENNIADNNSSVNAKEEITDIPSGRPWILPIGDQED 345          
BLAST of F-box only protein 16 vs. Planmine SMEST
Match: SMESG000017118.1 (SMESG000017118.1)

HSP 1 Score: 677.552 bits (1747), Expect = 0.000e+0
Identity = 334/355 (94.08%), Postives = 339/355 (95.49%), Query Frame = 2
Query:   44 MTSKYAKGIVKSTWTPLNHEDSNIKVFEERRSLVNKWFEMWNTNQRKQILEDLLTSCNGNQVEYAKLILSTKAIQKHVDFTRILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLAECNEIWAPKCARLGWYFTGPINTMESGLWKKHFIENIIFLQITRPAXXXXXXXXXXXXXXXXXXXXQAEKDEALRKAKRLKEKQLQAQKTSFAPWRGPDPRPIDIVRNNYIDNDIENGARFKMTFQKSHQKTRRLSHNDGNLSAKEKVHASITTKQVDQNYILTLVKSKLETEDIKCNSPAVPVENIHRPGPINGHIRTSVIKPAENNIADNNSSVNAKEEITDIPSGRPWILPIGDQED 1108
            MTSKYAKGIVKSTWTPLNHEDSNIKVFEERRSLVNKWFEMWNTNQRKQILEDLLTSCNGNQVEYAKLILSTKAIQKHVDFTRILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLAECNEIWAPKCARLGWYFTGPINTMESGLWKKHFIENIIFLQITRPAK +  ++    E+T      QAEKDEALRKAKRLKEKQLQAQKTSFAPWRGPDPRPIDIVRNNYIDNDIENGARFKMT QKSHQKTRRLSHNDGNLSAKEKVHASITTKQVDQN+ILT VKSKLETEDIKCNSP VPVENIHRPGPINGHIRTSVIKPAENNIADNNSSVNAKEEITDIPSGRPWILPIGDQED
Sbjct:    1 MTSKYAKGIVKSTWTPLNHEDSNIKVFEERRSLVNKWFEMWNTNQRKQILEDLLTSCNGNQVEYAKLILSTKAIQKHVDFTRILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLAECNEIWAPKCARLGWYFTGPINTMESGLWKKHFIENIIFLQITRPAKPEPKEELTTIEITK-----QAEKDEALRKAKRLKEKQLQAQKTSFAPWRGPDPRPIDIVRNNYIDNDIENGARFKMTIQKSHQKTRRLSHNDGNLSAKEKVHASITTKQVDQNFILTPVKSKLETEDIKCNSPVVPVENIHRPGPINGHIRTSVIKPAENNIADNNSSVNAKEEITDIPSGRPWILPIGDQED 350          
BLAST of F-box only protein 16 vs. Planmine SMEST
Match: SMESG000017118.1 (SMESG000017118.1)

HSP 1 Score: 676.011 bits (1743), Expect = 0.000e+0
Identity = 349/360 (96.94%), Postives = 351/360 (97.50%), Query Frame = 2
Query:   44 MTSKYAKGIVKSTWTPLNHEDSNIKVFEERRSLVNKWFEMWNTNQRKQILEDLLTSCNGNQVEYAKLILSTKAIQKHVDFTRILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLAECNEIWAPKCARLGWYFTGPINTMESGLWKKHFIENIIFLQITRPAXXXXXXXXX-----XXXXXXXXXXXQAEKDEALRKAKRLKEKQLQAQKTSFAPWRGPDPRPIDIVRNNYIDNDIENGARFKMTFQKSHQKTRRLSHNDGNLSAKEKVHASITTKQVDQNYILTLVKSKLETEDIKCNSPAVPVENIHRPGPINGHIRTSVIKPAENNIADNNSSVNAKEEITDIPSGRPWILPIGDQED 1108
            MTSKYAKGIVKSTWTPLNHEDSNIKVFEERRSLVNKWFEMWNTNQRKQILEDLLTSCNGNQVEYAKLILSTKAIQKHVDFTRILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLAECNEIWAPKCARLGWYFTGPINTMESGLWKKHFIENIIFLQITRPAKIKQLQQQL      +ELTTIEITKQAEKDEALRKAKRLKEKQLQAQKTSFAPWRGPDPRPIDIVRNNYIDNDIENGARFKMT QKSHQKTRRLSHNDGNLSAKEKVHASITTKQVDQN+ILT VKSKLETEDIKCNSP VPVENIHRPGPINGHIRTSVIKPAENNIADNNSSVNAKEEITDIPSGRPWILPIGDQED
Sbjct:    1 MTSKYAKGIVKSTWTPLNHEDSNIKVFEERRSLVNKWFEMWNTNQRKQILEDLLTSCNGNQVEYAKLILSTKAIQKHVDFTRILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLAECNEIWAPKCARLGWYFTGPINTMESGLWKKHFIENIIFLQITRPAKIKQLQQQLLQPEPKEELTTIEITKQAEKDEALRKAKRLKEKQLQAQKTSFAPWRGPDPRPIDIVRNNYIDNDIENGARFKMTIQKSHQKTRRLSHNDGNLSAKEKVHASITTKQVDQNFILTPVKSKLETEDIKCNSPVVPVENIHRPGPINGHIRTSVIKPAENNIADNNSSVNAKEEITDIPSGRPWILPIGDQED 360          
BLAST of F-box only protein 16 vs. Planmine SMEST
Match: SMESG000074748.1 (SMESG000074748.1)

HSP 1 Score: 135.961 bits (341), Expect = 9.906e-36
Identity = 65/157 (41.40%), Postives = 93/157 (59.24%), Query Frame = 2
Query:   47 TSKYAKGIVKSTWTPLNHEDSNIKVFEERRSLVNKWFEMWNTNQRKQILEDLLTSCNGNQVEYAKLILSTKAIQKHVDFTRILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLAECNEIWAPKCARLGWYFTGPINTMESGLWKKHFIENIIFLQIT 517
            TS+Y    V S WTP++++  N  +F+ER+ L+  WF++W   QR   L +L    +  Q+       + K   K VDFTRILPR I L IFS+LDPRSL RS+QV W+WK+L E + +W  KC   GWY     +  E G WK+H++ N I + ++
Sbjct:   37 TSQYQ--TVYSNWTPVSNKQYNKTIFKERKELIFNWFDIWTDQQRNDFLLELFGKFSAGQLLCVYDYFNKKMPLKRVDFTRILPRNISLKIFSYLDPRSLSRSSQVSWHWKFLTEQDVLWISKCRTFGWYLPYSPSEFEFGAWKRHYLSNAISVDMS 191          
BLAST of F-box only protein 16 vs. Planmine SMEST
Match: SMESG000074748.1 (SMESG000074748.1)

HSP 1 Score: 135.191 bits (339), Expect = 1.306e-35
Identity = 65/157 (41.40%), Postives = 93/157 (59.24%), Query Frame = 2
Query:   47 TSKYAKGIVKSTWTPLNHEDSNIKVFEERRSLVNKWFEMWNTNQRKQILEDLLTSCNGNQVEYAKLILSTKAIQKHVDFTRILPRVICLYIFSFLDPRSLCRSAQVCWYWKYLAECNEIWAPKCARLGWYFTGPINTMESGLWKKHFIENIIFLQIT 517
            TS+Y    V S WTP++++  N  +F+ER+ L+  WF++W   QR   L +L    +  Q+       + K   K VDFTRILPR I L IFS+LDPRSL RS+QV W+WK+L E + +W  KC   GWY     +  E G WK+H++ N I + ++
Sbjct:   37 TSQYQ--TVYSNWTPVSNKQYNKTIFKERKELIFNWFDIWTDQQRNDFLLELFGKFSAGQLLCVYDYFNKKMPLKRVDFTRILPRNISLKIFSYLDPRSLSRSSQVSWHWKFLTEQDVLWISKCRTFGWYLPYSPSEFEFGAWKRHYLSNAISVDMS 191          
The following BLAST results are available for this feature:
BLAST of F-box only protein 16 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FBXO161.020e-5643.38F-box protein 16 [Source:HGNC Symbol;Acc:HGNC:1361... [more]
FBXO162.719e-5643.38F-box protein 16 [Source:HGNC Symbol;Acc:HGNC:1361... [more]
FBXO163.720e-4739.73F-box protein 16 [Source:HGNC Symbol;Acc:HGNC:1361... [more]
FBXO165.039e-4739.73F-box protein 16 [Source:HGNC Symbol;Acc:HGNC:1361... [more]
ECT2L6.853e-3334.65epithelial cell transforming 2 like [Source:HGNC S... [more]
back to top
BLAST of F-box only protein 16 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fbxl-14.770e-658.82Uncharacterized F-box/LRR-repeat protein C02F5.7 ... [more]
fbxl-14.770e-658.82Uncharacterized F-box/LRR-repeat protein C02F5.7 ... [more]
fbxl-14.770e-658.82Uncharacterized F-box/LRR-repeat protein C02F5.7 ... [more]
fbxl-14.770e-658.82Uncharacterized F-box/LRR-repeat protein C02F5.7 ... [more]
fbxl-15.722e-658.82Uncharacterized F-box/LRR-repeat protein C02F5.7 ... [more]
back to top
BLAST of F-box only protein 16 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ago1.913e-1132.22gene:FBgn0041171 transcript:FBtr0073246[more]
ago1.913e-1132.22gene:FBgn0041171 transcript:FBtr0073245[more]
ago1.913e-1132.22gene:FBgn0041171 transcript:FBtr0073247[more]
back to top
BLAST of F-box only protein 16 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fbxo163.496e-5740.00F-box protein 16 [Source:ZFIN;Acc:ZDB-GENE-041015-... [more]
fbxo163.496e-5740.00F-box protein 16 [Source:ZFIN;Acc:ZDB-GENE-041015-... [more]
fbxo163.606e-5740.00F-box protein 16 [Source:ZFIN;Acc:ZDB-GENE-041015-... [more]
fbxo163.606e-5740.00F-box protein 16 [Source:ZFIN;Acc:ZDB-GENE-041015-... [more]
fbxo163.791e-5453.02F-box protein 16 [Source:ZFIN;Acc:ZDB-GENE-041015-... [more]
back to top
BLAST of F-box only protein 16 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gucd12.350e-5343.56guanylyl cyclase domain containing 1 [Source:Xenba... [more]
ENSXETT00000008237.15.018e-1336.17F-box and WD repeat domain containing 7 [Source:NC... [more]
ENSXETT00000008111.15.532e-1331.16F-box and WD repeat domain containing 7 [Source:NC... [more]
ENSXETT00000008205.18.145e-1336.17F-box and WD repeat domain containing 7 [Source:NC... [more]
ENSXETT00000008122.11.203e-1236.17F-box and WD repeat domain containing 7 [Source:NC... [more]
back to top
BLAST of F-box only protein 16 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fbxo161.070e-5437.01F-box protein 16 [Source:MGI Symbol;Acc:MGI:135470... [more]
Fbxo161.607e-5442.47F-box protein 16 [Source:MGI Symbol;Acc:MGI:135470... [more]
Fbxo161.640e-5442.47F-box protein 16 [Source:MGI Symbol;Acc:MGI:135470... [more]
Ect2l1.284e-3340.58epithelial cell transforming sequence 2 oncogene-l... [more]
Ect2l1.310e-3340.58epithelial cell transforming sequence 2 oncogene-l... [more]
back to top
BLAST of F-box only protein 16 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8IX29|FBX16_HUMAN4.898e-5643.38F-box only protein 16 OS=Homo sapiens OX=9606 GN=F... [more]
sp|Q9QZM9|FBX16_MOUSE1.147e-5342.47F-box only protein 16 OS=Mus musculus OX=10090 GN=... [more]
sp|Q008S8|ECT2L_HUMAN3.291e-3234.65Epithelial cell-transforming sequence 2 oncogene-l... [more]
sp|D3Z902|FBXW7_RAT1.256e-1236.17F-box/WD repeat-containing protein 7 OS=Rattus nor... [more]
sp|Q969H0|FBXW7_HUMAN1.307e-1236.17F-box/WD repeat-containing protein 7 OS=Homo sapie... [more]
back to top
BLAST of F-box only protein 16 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2R2MTD81.399e-5945.00F-box only protein 16 isoform X3 OS=Lingula unguis... [more]
A0A2R2MTM81.883e-5945.00F-box only protein 16 isoform X2 OS=Lingula unguis... [more]
A0A2R2MSZ95.247e-5945.00F-box only protein 16 isoform X1 OS=Lingula unguis... [more]
A0A210PSQ19.656e-5935.42F-box only protein 16 OS=Mizuhopecten yessoensis O... [more]
R7TTL61.464e-5743.15F-box domain-containing protein OS=Capitella telet... [more]
back to top
BLAST of F-box only protein 16 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ccdc28a9.435e-3038.89epithelial cell transforming 2 like [Source:NCBI g... [more]
fbxw74.096e-1335.87F-box and WD repeat domain containing 7 [Source:NC... [more]
fbxw78.280e-1335.87F-box and WD repeat domain containing 7 [Source:NC... [more]
fbxw21.671e-728.91F-box and WD repeat domain containing 2 [Source:NC... [more]
back to top
BLAST of F-box only protein 16 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
FBXO164.699e-4750.00F-box protein 16 [Source:HGNC Symbol;Acc:HGNC:1361... [more]
ENSPMAT00000008862.19.228e-1436.96pep scaffold:Pmarinus_7.0:GL476579:86637:114999:1 ... [more]
fbxw25.492e-1030.40F-box and WD repeat domain containing 2 [Source:ZF... [more]
back to top
BLAST of F-box only protein 16 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
MET302.377e-834.02F-box protein containing five copies of the WD40 m... [more]
back to top
BLAST of F-box only protein 16 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO440135.622e-3635.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO366563.447e-2554.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO269205.544e-2550.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO423063.022e-1132.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO321981.847e-933.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of F-box only protein 16 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fbxo161.931e-4835.80F-box protein 16 [Source:NCBI gene;Acc:101159553][more]
ccdc28a7.392e-3439.73epithelial cell transforming 2 like [Source:NCBI g... [more]
ENSORLT00000003546.26.820e-1438.04F-box/WD repeat-containing protein 7 [Source:NCBI ... [more]
fbxw73.040e-1335.87F-box and WD repeat domain containing 7 [Source:NC... [more]
fbxw79.733e-1335.87F-box and WD repeat domain containing 7 [Source:NC... [more]
back to top
BLAST of F-box only protein 16 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017118.10.000e+093.52SMESG000017118.1[more]
SMESG000017118.10.000e+094.08SMESG000017118.1[more]
SMESG000017118.10.000e+096.94SMESG000017118.1[more]
SMESG000074748.19.906e-3641.40SMESG000074748.1[more]
SMESG000074748.11.306e-3541.40SMESG000074748.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031919 ID=SMED30031919|Name=F-box only protein 16|organism=Schmidtea mediterranea sexual|type=transcript|length=1215bp
GATCTTTTAGAACTACGGTAACTAAAAATTTAATTGTTGATAAATGACTT
CAAAATATGCCAAAGGCATTGTTAAAAGTACGTGGACACCATTAAATCAT
GAAGACTCAAACATCAAAGTTTTTGAAGAAAGACGATCACTCGTTAATAA
ATGGTTCGAGATGTGGAATACAAATCAACGAAAACAAATTCTTGAAGATT
TATTAACAAGCTGTAATGGAAATCAAGTTGAGTATGCCAAATTAATTCTT
AGCACAAAAGCAATACAAAAACACGTGGATTTCACAAGAATTTTACCCAG
AGTTATTTGCTTGTATATATTTTCTTTCCTTGATCCACGAAGTCTTTGCC
GCAGTGCTCAGGTCTGCTGGTATTGGAAGTATCTTGCAGAATGCAATGAA
ATATGGGCTCCAAAATGCGCTCGCCTCGGCTGGTATTTTACTGGCCCAAT
AAATACAATGGAATCTGGACTGTGGAAAAAGCACTTCATCGAAAACATTA
TCTTTCTGCAAATAACTCGCCCAGCAAAGATAAAACAATTACAGCAACAA
TTATTACAGGAATTAACAACAATAGAAATAACTAAGCAAGCTGAAAAAGA
CGAAGCGCTGAGAAAAGCGAAGAGGTTAAAAGAAAAACAATTGCAGGCCC
AGAAAACGAGTTTTGCTCCTTGGAGAGGCCCAGATCCAAGGCCAATCGAT
ATTGTCCGTAATAATTACATTGATAACGATATAGAAAACGGGGCTCGTTT
TAAAATGACATTCCAAAAGTCACATCAAAAAACCAGACGATTATCTCACA
ACGATGGCAATTTAAGTGCAAAAGAAAAAGTACACGCTTCGATTACTACT
AAACAAGTTGACCAGAATTACATTTTAACACTTGTGAAAAGTAAATTGGA
AACAGAGGACATCAAATGTAACAGCCCAGCGGTTCCAGTTGAGAATATCC
ACCGCCCTGGACCGATTAATGGTCACATAAGAACAAGTGTAATAAAACCA
GCAGAAAACAACATTGCCGATAATAATTCATCTGTAAATGCCAAAGAAGA
AATTACAGACATCCCCTCTGGGCGTCCCTGGATTCTCCCGATAGGAGACC
AAGAAGATATTTAATAGATCAAATTTGGAATTTTTATGATTATTTTGTAT
TTATATTTATATAATCTCATATTATCGAAATCTTGCTTGATTGCCTCTGA
AATCCCGAATTAAAT
back to top

protein sequence of SMED30031919-orf-1

>SMED30031919-orf-1 ID=SMED30031919-orf-1|Name=SMED30031919-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=357bp
MTSKYAKGIVKSTWTPLNHEDSNIKVFEERRSLVNKWFEMWNTNQRKQIL
EDLLTSCNGNQVEYAKLILSTKAIQKHVDFTRILPRVICLYIFSFLDPRS
LCRSAQVCWYWKYLAECNEIWAPKCARLGWYFTGPINTMESGLWKKHFIE
NIIFLQITRPAKIKQLQQQLLQELTTIEITKQAEKDEALRKAKRLKEKQL
QAQKTSFAPWRGPDPRPIDIVRNNYIDNDIENGARFKMTFQKSHQKTRRL
SHNDGNLSAKEKVHASITTKQVDQNYILTLVKSKLETEDIKCNSPAVPVE
NIHRPGPINGHIRTSVIKPAENNIADNNSSVNAKEEITDIPSGRPWILPI
GDQEDI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR036047F-box-like_dom_sf
IPR001810F-box_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003674molecular_function
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
Vocabulary: biological process
TermDefinition
GO:0008150biological_process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 178..205
NoneNo IPR availableGENE3DG3DSA:1.20.1280.50coord: 66..159
e-value: 3.2E-18
score: 67.4
NoneNo IPR availablePANTHERPTHR46857:SF2F-BOX ONLY PROTEIN 16coord: 9..272
NoneNo IPR availablePANTHERPTHR46857FAMILY NOT NAMEDcoord: 9..272
IPR001810F-box domainPFAMPF12937F-box-likecoord: 83..122
e-value: 4.5E-9
score: 36.1
IPR036047F-box-like domain superfamilySUPERFAMILYSSF81383F-box domaincoord: 75..150