SMED30031908

Overview
NameSMED30031908
Smed IDSMED30031908
Length (bp)1363
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30031908 (SMED30031908) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30031908 (SMED30031908) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30031908 (SMED30031908) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30031908 (SMED30031908) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031908

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30031908SMESG000054111.1 SmedASXL_010249SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30031908SMESG000054111.1 dd_Smed_v4_9796_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30031908SMESG000054111.1 dd_Smed_v4_9796_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30031908SMESG000054111.1 dd_Smed_v6_9796_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30031908SMESG000054111.1 dd_Smed_v4_9796_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30031908 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000401:125226..129532 +6638
Homology
BLAST of SMED30031908 vs. Ensembl Human
Match: TMEM231 (transmembrane protein 231 [Source:HGNC Symbol;Acc:HGNC:37234])

HSP 1 Score: 78.5666 bits (192), Expect = 1.596e-15
Identity = 76/260 (29.23%), Postives = 123/260 (47.31%), Query Frame = -3
Query:  456 IAAYRAYGFYTTSVFIPSQPIVSLQQDM---ALMFLSDSGVYSWSNLQA-----STPTCLPVISITETDSNFDGINESLNMTVKL---YNKTISGIKFLLQFDYNVSTTISTLKIQQPIVIFLDAQQTV--RKLVVTGRLDVYQKRRLPNSGVLTIXXXXXXXXXXXXNVLANPFDNLPGNISGRNFTLKLMDLSTGWQLSPNPDL-FEVNIEILYNPVE-LQYHTEFWSMVKWAWVQWFYFLVLFVFCFQRFKDFVFES 1190
            + A+R++GF+        QP V  Q  +   AL+     G  +WS   A          +P++S  E D N DG  + L+  ++L     + + G++ +L F Y +   ++TL +Q   + FL +   V   +L V G L + QK+ L + G L    N    + +S         ++      RN T  L D +  W +    D  F +N  I Y PVE + Y   FW MVK+AWVQ+   L++F++ F+R K FVF++
Sbjct:   40 LVAFRSHGFWLKRSSYEEQPTVRFQHQVLLVALLGPESDGFLAWSTFPAFNRLQGDRLRVPLVSTREEDRNQDGKTDMLHFKLELPLQSTEHVLGVQLILTFSYRLHR-MATLVMQS--MAFLQSSFPVPGSQLYVNGDLRLQQKQPL-SCGGLDARYNISVINGTSPFAYDYDLTHIVAAYQERNVTTVLNDPNPIWLVGRAADAPFVINAIIRY-PVEVISYQPGFWEMVKFAWVQYVSILLIFLWVFERIKIFVFQN 294          
BLAST of SMED30031908 vs. Ensembl Human
Match: TMEM231 (transmembrane protein 231 [Source:HGNC Symbol;Acc:HGNC:37234])

HSP 1 Score: 70.8626 bits (172), Expect = 8.632e-13
Identity = 74/253 (29.25%), Postives = 117/253 (46.25%), Query Frame = -3
Query:  456 GFYTTSVFIPSQPIVSLQQDM---ALMFLSDSGVYSWSNLQA-----STPTCLPVISITETDSNFDGINESLNMTVKL---YNKTISGIKFLLQFDYNVSTTISTLKIQQPIVIFLDAQQTV--RKLVVTGRLDVYQKRRLPNSGVLTIXXXXXXXXXXXXNVLANPFDNLPGNISGRNFTLKLMDLSTGWQLSPNPDL-FEVNIEILYNPVE-LQYHTEFWSMVKWAWVQWFYFLVLFVFCFQRFKDFVFES 1169
            GF+        QP V  Q  +   AL+     G  +WS   A          +P++S  E D N DG  + L+  ++L     + + G++ +L F Y +   ++TL +Q   + FL +   V   +L V G L + QK+ L + G L    N    + +S         ++      RN T  L D +  W +    D  F +N  I Y PVE + Y   FW MVK+AWVQ+   L++F++ F+R K FVF++
Sbjct:   76 GFWLKRSSYEEQPTVRFQHQVLLVALLGPESDGFLAWSTFPAFNRLQGDRLRVPLVSTREEDRNQDGKTDMLHFKLELPLQSTEHVLGVQLILTFSYRLHR-MATLVMQS--MAFLQSSFPVPGSQLYVNGDLRLQQKQPL-SCGGLDARYNISVINGTSPFAYDYDLTHIVAAYQERNVTTVLNDPNPIWLVGRAADAPFVINAIIRY-PVEVISYQPGFWEMVKFAWVQYVSILLIFLWVFERIKIFVFQN 323          
BLAST of SMED30031908 vs. Ensembl Human
Match: TMEM231 (transmembrane protein 231 [Source:HGNC Symbol;Acc:HGNC:37234])

HSP 1 Score: 64.6994 bits (156), Expect = 4.632e-11
Identity = 66/258 (25.58%), Postives = 102/258 (39.53%), Query Frame = -3
Query:  456 IAAYRAYGFYTTSVFIPSQPIVSLQQDM---ALMFLSDSGVYSWSNLQA-----STPTCLPVISITETDSNFDGINESLNMTVKL---YNKTISGIKFLLQFDYNVSTTISTLKIQQPIVIFLDAQQTVRKLVVTGRLDVYQKRRLPNSGVLTIXXXXXXXXXXXXNVLANPFDNLPGNISGRNFTLKLMDLSTGWQLSPNPDL-FEVNIEILYNPVE-LQYHTEFWSMVKWAWVQWFYFLVLFVFCFQRFKDFVFES 1190
            + A+R++GF+        QP V  Q  +   AL+     G  +WS   A          +P++S  E D N DG  + L+  ++L     + + G++ +L F Y +   IS +    P     D    V           YQ+R                                       N T  L D +  W +    D  F +N  I Y PVE + Y   FW MVK+AWVQ+   L++F++ F+R K FVF++
Sbjct:   40 LVAFRSHGFWLKRSSYEEQPTVRFQHQVLLVALLGPESDGFLAWSTFPAFNRLQGDRLRVPLVSTREEDRNQDGKTDMLHFKLELPLQSTEHVLGVQLILTFSYRLH--ISVINGTSPFAYDYDLTHIV---------AAYQER---------------------------------------NVTTVLNDPNPIWLVGRAADAPFVINAIIRY-PVEVISYQPGFWEMVKFAWVQYVSILLIFLWVFERIKIFVFQN 246          
BLAST of SMED30031908 vs. Ensembl Zebrafish
Match: tmem231 (transmembrane protein 231 [Source:NCBI gene;Acc:393358])

HSP 1 Score: 88.1965 bits (217), Expect = 5.023e-19
Identity = 84/302 (27.81%), Postives = 146/302 (48.34%), Query Frame = -3
Query:  456 MTFYVVYRQKEYAKYYHNIFSRATIFVI----LFSLTPLFVSAIAAYRAYGFYTTSVFIPSQPIVSLQQDMALMFLSDS-GVY-SWS-----NLQASTPTCLPVISITETDSNFDGINESLNMTVKLYNKTIS---GIKFLLQFDYNVSTTISTLKIQQPIVIFLDAQQTVRKLVVTGRLDVYQKRRLPNSGVLTIXXXXXXXXXXXXNVLANPFD--NLPGNISGRNFTLKLMDLSTGWQLSPNPDL-FEVNIEILYNPVEL-QYHTEFWSMVKWAWVQWFYFLVLFVFCFQRFKDFVFES 1307
            M FY VY      +Y   + +RAT+FV     L  ++PL V    AYR+ GF+        QP+V  Q D+ L+ ++D+ G Y +WS     N        +P IS  E D N DG ++ L + + +  K       ++ LL F Y +   +ST+ +Q    I   +     +L + G L + Q+  LP+ G   +++    +    ++  A+ +D  N+      RN T  L  +   W +    +  F+++ +I Y PVE+  Y   FW  +K+AW+Q+   L++F++ FQ  + F+F++
Sbjct:    1 MAFYDVYAHPALIRYRTCVCTRATLFVCVVLGLTYISPLLV----AYRSQGFWLKRNSYEEQPVVKFQYDLILLGVTDTTGNYLAWSTFPNFNRLIGDNLRIPEISAQEEDKNQDGKSDVLLLQISVPLKPAEQMFSVQLLLTFSYQL-FRMSTVVMQTLAFIQHSSPVPGSQLFICGDLRLNQRTPLPHRG---LHSTYNVSVIDGSSPFASTYDLTNIIRLYQQRNLTTHLSGVIPVWTVGRAANAPFQISAQIHY-PVEMIDYRPGFWETIKFAWIQYVSVLLIFLWVFQHIQTFIFQN 293          
BLAST of SMED30031908 vs. Ensembl Zebrafish
Match: tmem231 (transmembrane protein 231 [Source:NCBI gene;Acc:393358])

HSP 1 Score: 72.0182 bits (175), Expect = 8.399e-14
Identity = 78/299 (26.09%), Postives = 131/299 (43.81%), Query Frame = -3
Query:  456 MTFYVVYRQKEYAKYYHNIFSRATIFVI----LFSLTPLFVSAIAAYRAYGFYTTSVFIPSQPIVSLQQDMALMFLSD-SGVY-SWS-----NLQASTPTCLPVISITETDSNFDGINESLNMTVKLYNKTIS---GIKFLLQFDYNVSTTISTLKIQQPIVIFLDAQQTVRKLVVTGRLDVYQKRRLPNSGVLTIXXXXXXXXXXXXNVLANPFDNLPGNISGRNFTLKLMDLSTGWQLSPNPDLFEVNIEILYNPVEL-QYHTEFWSMVKWAWVQWFYFLVLFVFCFQRFKDFVFES 1307
            M FY VY      +Y   + +RAT+FV     L  ++PL V    AYR+ GF+        QP+V  Q D+ L+ ++D +G Y +WS     N        +P IS  E D N DG ++ L + + +  K       ++ LL F Y +   +S +    P     D    +R         +YQ+R                              NL  ++SG      ++ + T  + +  P  F+++ +I Y PVE+  Y   FW  +K+AW+Q+   L++F++ FQ  + F+F++
Sbjct:    1 MAFYDVYAHPALIRYRTCVCTRATLFVCVVLGLTYISPLLV----AYRSQGFWLKRNSYEEQPVVKFQYDLILLGVTDTTGNYLAWSTFPNFNRLIGDNLRIPEISAQEEDKNQDGKSDVLLLQISVPLKPAEQMFSVQLLLTFSYQL--FVSVIDGSSPFASTYDLTNIIR---------LYQQR------------------------------NLTTHLSG------VIPVWTVGRAANAP--FQISAQIHY-PVEMIDYRPGFWETIKFAWIQYVSVLLIFLWVFQHIQTFIFQN 245          
BLAST of SMED30031908 vs. Ensembl Xenopus
Match: tmem231 (transmembrane protein 231 [Source:NCBI gene;Acc:100145127])

HSP 1 Score: 95.5153 bits (236), Expect = 2.500e-21
Identity = 92/302 (30.46%), Postives = 146/302 (48.34%), Query Frame = -3
Query:  456 MTFYVVYRQKEYAKYYHNIFSRATIFVILFSLTPLFVSAIAAYRAYGFYTTSVFIPSQPIVSLQQDMALMFLSDS-GVY-SWS-----NLQASTPTCLPVISITETDSNFDGINESLNMTVKLY---NKTISGIKFLLQFDYNVSTTISTLKIQQPIVIFLDAQQTVRKLVVTGRLDVYQKRRLPNSGVLTIXXXXXXXXXXXXNVLANPF------DNLPGNISGRNFTLKLMDLSTGWQLS-PNPDLFEVNIEILYNPVE-LQYHTEFWSMVKWAWVQWFYFLVLFVFCFQRFKDFVFES 1307
            M  Y VY      +Y  +I S+AT+F+++  L       + A+R+YGF+  +     QP V  Q D+ L+ LS + G Y +WS     N        LP IS  E D N DG  + LN  ++L       I G++ +L F Y +S  +ST  +Q   +I   +     +L + G L + Q++ L + G+ T YN +  N        ++PF       N+  +   RN T  L   +  W +     D F +   I Y PVE + Y   FW M+K+AW+Q+   L++F++ F+R K FVF++
Sbjct:    1 MALYEVYSHPALLRYRSSICSKATLFILIVLLLTYIPPLLVAFRSYGFWLKTSTYEEQPNVRFQYDVLLIALSSTTGNYLAWSTYPGFNNLVGDKLRLPHISAREEDRNQDGKMDLLNFQLELPLQPTDNIYGVQLILTFSYQLSK-MSTFIMQSMALIQYSSPIPGSQLYMNGDLKLQQRQPLNHRGLDTTYNVSVINR-------SSPFASTYALTNIISSYQERNVTTVLNAPNPLWIVGRAASDPFVIKAVIRY-PVESISYVPGFWEMLKYAWIQYVSILLIFLWVFERIKIFVFQN 293          
BLAST of SMED30031908 vs. Ensembl Mouse
Match: Tmem231 (transmembrane protein 231 [Source:MGI Symbol;Acc:MGI:2685024])

HSP 1 Score: 70.0922 bits (170), Expect = 8.703e-13
Identity = 70/263 (26.62%), Postives = 120/263 (45.63%), Query Frame = -3
Query:  444 IAAYRAYGFYTTSVFIPSQPIVSLQQDM---ALMFLSDSGVYSWS-----NLQASTPTCLPVISITETDSNFDGINESLNMTVKLY---NKTISGIKFLLQFDYNVSTTISTLKIQQPIVIFLDAQQTV--RKLVVTGRLDVYQKRRLPNSGVLTIXXXXXXXXXXXXNVLANPFDNLPGNISGRNFTLKLMDLSTGWQLSPNPDL-FEVNIEILYNPVELQYHTEFWSMVKWAWVQWFYFLVLFVFCFQRFKDFVFESFAVS 1190
            + A+R++GF+        QP V  Q  +   AL+        +WS     N        +P++S  E D N DG  + L   ++L     + + G++ +L F Y +   +ST ++Q   + FL +   V   +L V G L + QK+ L   G L I  N    + +S         ++      RN T  L D +  W +    +  F ++  I Y    + Y   FW M+K+AW+Q+   L++F++ F+R K FVF++  V+
Sbjct:   40 LVAFRSHGFWLKRSSYEEQPNVRFQHQVLLVALLGPEPEAFLAWSTFPTFNRLQGAHLRVPLVSSREEDRNQDGKMDVLYFKLELPLQPTEHVLGVQLILTFSYQLHR-MSTFEMQS--MAFLQSSFAVPGSQLYVNGDLRLQQKQPLSYRG-LDIRYNVSVINGTSPFAQDYDLTHIVAAYQERNVTTVLSDPNPIWLVGRAAEAPFVIHAVIRYPTEVISYQPGFWEMIKFAWIQYVSILLIFLWVFERIKIFVFQNQVVT 298          
BLAST of SMED30031908 vs. UniProt/SwissProt
Match: sp|F7B645|TM231_XENTR (Transmembrane protein 231 OS=Xenopus tropicalis OX=8364 GN=tmem231 PE=2 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 1.103e-20
Identity = 92/302 (30.46%), Postives = 146/302 (48.34%), Query Frame = -3
Query:  456 MTFYVVYRQKEYAKYYHNIFSRATIFVILFSLTPLFVSAIAAYRAYGFYTTSVFIPSQPIVSLQQDMALMFLSDS-GVY-SWS-----NLQASTPTCLPVISITETDSNFDGINESLNMTVKLY---NKTISGIKFLLQFDYNVSTTISTLKIQQPIVIFLDAQQTVRKLVVTGRLDVYQKRRLPNSGVLTIXXXXXXXXXXXXNVLANPF------DNLPGNISGRNFTLKLMDLSTGWQLS-PNPDLFEVNIEILYNPVE-LQYHTEFWSMVKWAWVQWFYFLVLFVFCFQRFKDFVFES 1307
            M  Y VY      +Y  +I S+AT+F+++  L       + A+R+YGF+  +     QP V  Q D+ L+ LS + G Y +WS     N        LP IS  E D N DG  + LN  ++L       I G++ +L F Y +S  +ST  +Q   +I   +     +L + G L + Q++ L + G+ T YN +  N        ++PF       N+  +   RN T  L   +  W +     D F +   I Y PVE + Y   FW M+K+AW+Q+   L++F++ F+R K FVF++
Sbjct:    1 MALYEVYSHPALLRYRSSICSKATLFILIVLLLTYIPPLLVAFRSYGFWLKTSTYEEQPNVRFQYDVLLIALSSTTGNYLAWSTYPGFNNLVGDKLRLPHISAREEDRNQDGKMDLLNFQLELPLQPTDNIYGVQLILTFSYQLSK-MSTFIMQSMALIQYSSPIPGSQLYMNGDLKLQQRQPLNHRGLDTTYNVSVINR-------SSPFASTYALTNIISSYQERNVTTVLNAPNPLWIVGRAASDPFVIKAVIRY-PVESISYVPGFWEMLKYAWIQYVSILLIFLWVFERIKIFVFQN 293          
BLAST of SMED30031908 vs. UniProt/SwissProt
Match: sp|Q7T316|TM231_DANRE (Transmembrane protein 231 OS=Danio rerio OX=7955 GN=tmem231 PE=2 SV=2)

HSP 1 Score: 88.1965 bits (217), Expect = 3.792e-18
Identity = 84/302 (27.81%), Postives = 146/302 (48.34%), Query Frame = -3
Query:  456 MTFYVVYRQKEYAKYYHNIFSRATIFVI----LFSLTPLFVSAIAAYRAYGFYTTSVFIPSQPIVSLQQDMALMFLSDS-GVY-SWS-----NLQASTPTCLPVISITETDSNFDGINESLNMTVKLYNKTIS---GIKFLLQFDYNVSTTISTLKIQQPIVIFLDAQQTVRKLVVTGRLDVYQKRRLPNSGVLTIXXXXXXXXXXXXNVLANPFD--NLPGNISGRNFTLKLMDLSTGWQLSPNPDL-FEVNIEILYNPVEL-QYHTEFWSMVKWAWVQWFYFLVLFVFCFQRFKDFVFES 1307
            M FY VY      +Y   + +RAT+FV     L  ++PL V    AYR+ GF+        QP+V  Q D+ L+ ++D+ G Y +WS     N        +P IS  E D N DG ++ L + + +  K       ++ LL F Y +   +ST+ +Q    I   +     +L + G L + Q+  LP+ G   +++    +    ++  A+ +D  N+      RN T  L  +   W +    +  F+++ +I Y PVE+  Y   FW  +K+AW+Q+   L++F++ FQ  + F+F++
Sbjct:    1 MAFYDVYAHPALIRYRTCVCTRATLFVCVVLGLTYISPLLV----AYRSQGFWLKRNSYEEQPVVKFQYDLILLGVTDTTGNYLAWSTFPNFNRLIGDNLRIPEISAQEEDKNQDGKSDVLLLQISVPLKPAEQMFSVQLLLTFSYQL-FRMSTVVMQTLAFIQHSSPVPGSQLFICGDLRLNQRTPLPHRG---LHSTYNVSVIDGSSPFASTYDLTNIIRLYQQRNLTTHLSGVIPVWTVGRAANAPFQISAQIHY-PVEMIDYRPGFWETIKFAWIQYVSVLLIFLWVFQHIQTFIFQN 293          
BLAST of SMED30031908 vs. UniProt/SwissProt
Match: sp|Q9H6L2|TM231_HUMAN (Transmembrane protein 231 OS=Homo sapiens OX=9606 GN=TMEM231 PE=1 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 7.665e-15
Identity = 76/260 (29.23%), Postives = 123/260 (47.31%), Query Frame = -3
Query:  456 IAAYRAYGFYTTSVFIPSQPIVSLQQDM---ALMFLSDSGVYSWSNLQA-----STPTCLPVISITETDSNFDGINESLNMTVKL---YNKTISGIKFLLQFDYNVSTTISTLKIQQPIVIFLDAQQTV--RKLVVTGRLDVYQKRRLPNSGVLTIXXXXXXXXXXXXNVLANPFDNLPGNISGRNFTLKLMDLSTGWQLSPNPDL-FEVNIEILYNPVE-LQYHTEFWSMVKWAWVQWFYFLVLFVFCFQRFKDFVFES 1190
            + A+R++GF+        QP V  Q  +   AL+     G  +WS   A          +P++S  E D N DG  + L+  ++L     + + G++ +L F Y +   ++TL +Q   + FL +   V   +L V G L + QK+ L + G L    N    + +S         ++      RN T  L D +  W +    D  F +N  I Y PVE + Y   FW MVK+AWVQ+   L++F++ F+R K FVF++
Sbjct:   40 LVAFRSHGFWLKRSSYEEQPTVRFQHQVLLVALLGPESDGFLAWSTFPAFNRLQGDRLRVPLVSTREEDRNQDGKTDMLHFKLELPLQSTEHVLGVQLILTFSYRLHR-MATLVMQS--MAFLQSSFPVPGSQLYVNGDLRLQQKQPL-SCGGLDARYNISVINGTSPFAYDYDLTHIVAAYQERNVTTVLNDPNPIWLVGRAADAPFVINAIIRY-PVEVISYQPGFWEMVKFAWVQYVSILLIFLWVFERIKIFVFQN 294          
BLAST of SMED30031908 vs. UniProt/SwissProt
Match: sp|A7MB75|TM231_BOVIN (Transmembrane protein 231 OS=Bos taurus OX=9913 GN=TMEM231 PE=2 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 2.133e-14
Identity = 75/266 (28.20%), Postives = 126/266 (47.37%), Query Frame = -3
Query:  444 IAAYRAYGFYTTSVFIPSQPIVSLQQDMALMFLSDS---GVYSWSNLQA-----STPTCLPVISITETDSNFDGINESLNMTVKL---YNKTISGIKFLLQFDYNVSTTISTLKIQQPIVIFLDAQQTV--RKLVVTGRLDVYQKRRLPNSGVLTIXXXXXXXXXXXXNVLANPFD--NLPGNISGRNFTLKLMDLSTGWQLSPNPDL-FEVNIEILYNPVE-LQYHTEFWSMVKWAWVQWFYFLVLFVFCFQRFKDFVFESFAVS 1190
            + A+R++GF+        QP V  Q  + L+ L  S   G  +WS   A          +P++S  E D N DG  + L+  ++L     + + G++ +L F Y +   +ST  +Q   + FL +   +   +L V G L + QK+ L   G   +      +  +  +  A+ +D   +      RN T  L D S  W +    +  F VN  I Y PVE + Y   FW M+K+AW+Q+   L++F++ F+R K FVF++  V+
Sbjct:   40 LVAFRSHGFWLKRSSYEEQPTVRFQHQVLLVALLGSEPGGFLAWSTFPAFNRLQEGHLRVPLVSAREEDRNQDGKMDMLHFKLELPLQSTEQVLGVQLILTFSYQLHR-MSTFVMQS--MAFLQSSFALPGSQLYVNGDLRLQQKQPLGYGG---LDVRYNVSVINGTSPFASDYDLTRIVAAYQERNVTTILTDPSPIWLVGRAAEAPFVVNAVIRY-PVEVISYLPGFWEMIKFAWIQYVSILLIFLWAFERIKRFVFQNQVVT 298          
BLAST of SMED30031908 vs. UniProt/SwissProt
Match: sp|Q5RBT8|TM231_PONAB (Transmembrane protein 231 OS=Pongo abelii OX=9601 GN=TMEM231 PE=2 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 3.064e-14
Identity = 77/264 (29.17%), Postives = 124/264 (46.97%), Query Frame = -3
Query:  444 IAAYRAYGFYTTSVFIPSQPIVSLQQDM---ALMFLSDSGVYSWSNLQA-----STPTCLPVISITETDSNFDGINESLNMTVKL---YNKTISGIKFLLQFDYNVSTTISTLKIQQPIVIFLDAQQTV--RKLVVTGRLDVYQKRRLPNSGVLTIXXXXXXXXXXXXNVLANPFDNLPGNISGRNFTLKLMDLSTGWQLSPNPDL-FEVNIEILYNPVE-LQYHTEFWSMVKWAWVQWFYFLVLFVFCFQRFKDFVFESFAVS 1190
            + A+R++GF+        QP V  Q  +   AL+     G  +WS   A          +P++S  E D N DG  + L+  ++L     + + G++ +L F Y +   ++T  +Q   + FL +   V   +L V G L + QK+ L + G L    N    + +S         ++      RN T  L D +  W +    D  F +N  I Y PVE + Y   FW MVK+AWVQ+   L++FV+ F+R K FVF++  V+
Sbjct:   40 LVAFRSHGFWLKRSSYEEQPTVRFQHQVLLVALLGPESGGFLAWSTFPAFNRLQGDRLRVPLVSTREEDRNQDGKMDMLHFKLELPLQSTEHVLGVQLILTFSYQLHR-MATPVMQS--MAFLQSSFPVPGSQLYVNGDLRLQQKQPL-SCGGLDARYNVSVINGTSPFAYDYDLTHVIAAYQERNVTTILNDPNPIWLVGRAADAPFVINAIIRY-PVEVISYQPGFWEMVKFAWVQYVSILLIFVWVFERIKIFVFQNQVVT 298          
BLAST of SMED30031908 vs. TrEMBL
Match: A0A1S3MMS7 (transmembrane protein 231 OS=Salmo salar OX=8030 GN=tmem231 PE=4 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 2.589e-21
Identity = 96/303 (31.68%), Postives = 156/303 (51.49%), Query Frame = -3
Query:  456 MTFYVVYRQKEYAKYYHNIFSRATIFV-ILFSLT---PLFVSAIAAYRAYGFYTTSVFIPSQPIVSLQ-QDMALMFLSDSGVY-SWS------NLQASTPTCLPVISITETDSNFDGINESLNMTVKL---YNKTISGIKFLLQFDYNVSTTISTLKIQQPIVIFLDAQQTVRKLVVTGRLDVYQKRRLPNSGVLTIXXXXXXXXXXXXNVLANPFD--NLPGNISGRNFTLKLMDLSTGWQLSPNPDL-FEVNIEILYNPVEL-QYHTEFWSMVKWAWVQWFYFLVLFVFCFQRFKDFVFES 1307
            M FY VY      +Y  ++ ++AT+F+ I+  LT   PL V    AYR+ GF+        QP+V  Q Q + +   S SG Y +WS      N+Q  T   +P IS+ E D N DG  + L   + L    ++ +  I+ LL F Y +   +ST+ +Q    +   +     +L ++G L + Q+  LP+ G+LT+YN +  + +S     A+ +D  N+ G+   RN T  L   S  W +       F++N E+ Y PVE+  Y   FW M+K+AW+Q+   L++F++ F R + FVF++
Sbjct:    1 MAFYEVYSHPASIRYKTSVCTKATLFLGIVLCLTYIPPLLV----AYRSQGFWVKRSTYEEQPVVRFQYQVLIIAATSTSGDYVAWSTFPNFNNMQG-TNLRIPSISVREEDQNQDGKLDRLKFRLDLPLRSDEQVYSIQLLLTFSYQL-FRMSTVVMQTLAFVQHSSSVPGSQLFISGDLRLQQRTPLPHRGLLTVYNVSVIDGTSP---FASAYDLANIIGSYQDRNLTTFLSCPSPVWTVGRAAGTPFQINAEVRY-PVEVVSYRPGFWEMIKFAWIQYVSVLLIFLWVFNRIQTFVFQN 293          
BLAST of SMED30031908 vs. TrEMBL
Match: A0A1S3HUF0 (transmembrane protein 231 OS=Lingula unguis OX=7574 GN=LOC106157552 PE=4 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 2.746e-21
Identity = 92/301 (30.56%), Postives = 139/301 (46.18%), Query Frame = -3
Query:  456 MTFYVVYRQKEYAKYYHNIFSRAT----IFVILFSLTPLFVSAIAAYRAYGFYTTSVFIPSQPIVSLQQD--MALMFLSDSGVYSWS-----NLQASTPTCLPVISITETDSNFDGINESLNMTVK---LYNKTISGIKFLLQFDYNVSTTISTLKIQQPIVIFLDAQQTVRKLVVTGRLDVYQKRRLPNSGVLTIXXXXXXXXXXXXNVLANPFD--NLPGNISGRNFTLKLMDLSTGWQLSPNPDL-FEVNIEILYNPVELQYHTEFWSMVKWAWVQWFYFLVLFVFCFQRFKDFVFES 1307
            M  Y VY   E  +Y  N+ SRAT    I  +L  L PLF+     Y + GF+  S     QP V  +    M L    +S   +WS     N        +P++   E DSN DG+ ++L +TV+   L  + I G+K LL FDY ++  +S+ +++    I  D+ ++  +L V G L + QK  L + GV    N          ++ A+ +D  N+  + S RN T  L      W         F +   I Y    L Y   FW ++KWAWVQ+   L++FV  F R K F+F++
Sbjct:    1 MAVYEVYNHPEVRRYRTNVCSRATYVQLITTLLTFLPPLFI----GYGSQGFWQKSDTYQEQPDVHFKHQVLMVLETAQESSYIAWSTYQNFNRMQQAHLRVPIVKSREEDSNRDGLYDTLYLTVQVPLLDTEHIHGVKLLLIFDYKLNI-LSSFQMESMAYIQHDSPRSGAELKVIGDLRLVQKDLLLHRGV---DNRFNSPVIDDTSIYADAYDLANIFSSYSSRNVTTVLDSSYPVWTTGRGTGQPFVITATIRYPRETLFYIPGFWQLIKWAWVQYVAILIIFVAAFDRIKTFIFQN 293          
BLAST of SMED30031908 vs. TrEMBL
Match: A0A4Z2C9D0 (Uncharacterized protein OS=Takifugu bimaculatus OX=433685 GN=fugu_012046 PE=4 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 5.138e-21
Identity = 92/301 (30.56%), Postives = 150/301 (49.83%), Query Frame = -3
Query:  444 MTFYVVYRQKEYAKYYHNIFSRATIFVILFSLTPLFVSAIAAYRAYGFYTTSVFIPSQPIVSLQ-QDMALMFLSDSGVY-SWS------NLQASTPTCLPVISITETDSNFDGINESLNMTVKLY---NKTISGIKFLLQFDYNVSTTISTLKIQQPIVIFLDAQQTVRKLVVTGRLDVYQKRRLPNSGVLTIXXXXXXXXXXXXNVLANPFDNLPGNISGRNFTLKLMDLSTGWQLSPNP-DLFEVNIEILYNPVE-LQYHTEFWSMVKWAWVQWFYFLVLFVFCFQRFKDFVFESFAVS 1307
            M FY VY      +Y  ++ ++AT+F+++          + AYR+ GF+        QP+V  Q Q + +   S  G + +WS      N+ AS    +P +S+ E D N DG  + L + ++L     + +  ++ LL F Y +   +ST+ +Q    +   +     KL ++G L + QK  LP+ GV  IYN +  + SS     A   +N+ G    RN T  L      W + P     FE+N++I Y PVE + Y   FW  +K+AWVQ+   L++F++ F+R K FVF++  VS
Sbjct:    1 MAFYEVYSHPALLRYQTSVCTKATLFLLVVLCLTYISPLLVAYRSQGFWIKRATYEEQPVVRFQYQTLLVAATSIRGDFVAWSTFPHLNNMLASN-LRIPSVSVREEDQNQDGKLDFLILNLQLPLQPEEQVYSVQLLLTFSYQL-FRMSTVVMQSLAYLQHSSPVPGAKLFISGDLKLQQKTPLPHRGVYDIYNMSVIDGSSPFAS-AYDLENIIGRYRERNLTTVLSCPEPVWIIGPAAGSAFELNVKIRY-PVEVISYRPGFWETIKFAWVQYVSVLIIFLWVFERVKRFVFQNQIVS 297          
BLAST of SMED30031908 vs. TrEMBL
Match: H3CM39 (Uncharacterized protein OS=Tetraodon nigroviridis OX=99883 PE=4 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 1.020e-20
Identity = 90/304 (29.61%), Postives = 148/304 (48.68%), Query Frame = -3
Query:  456 LKMTFYVVYRQKEYAKYYHNIFSRATIFVI----LFSLTPLFVSAIAAYRAYGFYTTSVFIPSQPIVSLQQDMALMFLSDSG--VYSWS-----NLQASTPTCLPVISITETDSNFDGINESLNMTVKLY---NKTISGIKFLLQFDYNVSTTISTLKIQQPIVIFLDAQQTV--RKLVVTGRLDVYQKRRLPNSGVLTIXXXXXXXXXXXXNVLANPFDNLPGNISGRNFTLKLMDLSTGWQLS-PNPDLFEVNIEILYNPVE-LQYHTEFWSMVKWAWVQWFYFLVLFVFCFQRFKDFVFES 1313
            L M FY VY      +Y  ++ ++AT+F++    L  ++PL V    AYR+ GF+        QP+V  Q    L+  + +G  + +WS     N    +   +P +S+ E D N DG  + L + ++L     + + G++ LL F Y +   +ST+ +Q   + +L    +V   KL ++G L + QK  LP+ G  T          SS    A   +N+ G+   RN T  L      W +       FE+N+ I Y P+E + Y   FW  +K+AWVQ+   L++F++ F+R K FVF +
Sbjct:    1 LAMAFYEVYSHPTLIRYQTSVCTKATLFLLVVLCLTYISPLLV----AYRSQGFWIKRATYEEQPVVRFQYQTLLVAATSAGGDLVAWSTFPHLNHLLGSSLRIPAVSVREEDQNHDGKLDLLVLNLQLPIRPEEQVYGVQLLLTFSYQL-FRMSTVAMQS--LAYLQHSSSVPGAKLFISGDLRLQQKTPLPHRGSTTFITQVSVIDGSSPFASAYDLENVIGSYRERNLTTVLSYPEPVWTVGRAAGSPFELNVRIRY-PLEVISYRPGFWETIKFAWVQYVSVLLIFLWVFERVKRFVFRN 296          
BLAST of SMED30031908 vs. TrEMBL
Match: W5U8D7 (Transmembrane protein 231 OS=Ictalurus punctatus OX=7998 GN=tmem231 PE=2 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 1.275e-20
Identity = 89/298 (29.87%), Postives = 146/298 (48.99%), Query Frame = -3
Query:  456 MTFYVVYRQKEYAKYYHNIFSRATIFVILFSLTPLFVSAIAAYRAYGFYTTSVFIPSQPIVSLQQDMALMFLSD-SGVY-SWS-----NLQASTPTCLPVISITETDSNFDGINESLNMTVKL---YNKTISGIKFLLQFDYNVSTTISTLKIQQPIVIFLDAQQTVRKLVVTGRLDVYQKRRLPNSGVLTIXXXXXXXXXXXXNVLANPFD--NLPGNISGRNFTLKLMDLSTGWQLSPNPDL-FEVNIEILYNPVE-LQYHTEFWSMVKWAWVQWFYFLVLFVFCFQRFKDFVFES 1307
            M FY VY      +Y  ++ SRA++FV++  L       +  YR+ GF+        QP+V  Q +M +M ++  SG Y +WS     N        +P +S+ E+D N DG  + L+M + +     + I  ++ LL F Y +   +S + +Q  +++   +   V +L ++G L + QK  L + GV T   +   +   SA+  AN +D   +  N   RN T  L      W      +  F++  EI Y PVE + Y   FW  VK+AWVQ+   L++F++ FQR + FVF +
Sbjct:    1 MGFYEVYSHPVLIRYKASVCSRASVFVLVVYLLTYIPPLLITYRSQGFWLKQSSYEEQPVVQFQYEMLMMGVTSVSGDYVAWSTFSNFNTLLGDKLRIPTVSVRESDRNGDGKADRLSMQLSIPLNSAEQIYSVQLLLTFSYQLHR-MSVVVMQSMLLLQSSSPVPVSQLFISGDLKLQQKEPLSHRGVHT---DYNVSVIDSASPFANSYDLTTIVRNYQERNLTTYLSCPVPVWTFGRAANAPFQIIAEIRY-PVETITYRPGFWETVKFAWVQYVSVLLIFLWIFQRIQTFVFHN 293          
BLAST of SMED30031908 vs. Ensembl Cavefish
Match: tmem231 (transmembrane protein 231 [Source:NCBI gene;Acc:103032427])

HSP 1 Score: 95.1301 bits (235), Expect = 1.860e-21
Identity = 81/301 (26.91%), Postives = 144/301 (47.84%), Query Frame = -3
Query:  456 MTFYVVYRQKEYAKYYHNIFSRATIFVIL-FSLT---PLFVSAIAAYRAYGFYTTSVFIPSQPIVSLQQDMALMFLSDSG--VYSWS-----NLQASTPTCLPVISITETDSNFDGINESLNMTVKL---YNKTISGIKFLLQFDYNVSTTISTLKIQQPIVIFLDAQQTVRKLVVTGRLDVYQKRRLPNSGVLTIXXXXXXXXXXXXNVLANPFD--NLPGNISGRNFTLKLMDLSTGWQLSPNPDL-FEVNIEILYNPVELQYHTEFWSMVKWAWVQWFYFLVLFVFCFQRFKDFVFES 1307
            M FY VY      +Y  N+ +RAT+FV++ F LT   PL V    AY++ GF+        QP+V  Q  M ++  + +     +WS     N    +   +P +S+ E DSN DG ++ L + + +     + I  I+ LL F Y +   +ST+ +Q    I   +     +L + G L ++Q+  LP+ G   ++     +   + +  A  +D  ++      RN T  L   +  W +    +  F++N E+ Y    + Y   FW M+K+AW+Q+   L++F++ F   + FVF++
Sbjct:    1 MAFYEVYSHPALIRYKTNVCTRATLFVLMVFCLTYIPPLLV----AYKSQGFWLKRSTYEEQPVVQFQYQMLMIGATGTAGEFVAWSTFPDFNRLLGSNLRIPAVSVKEEDSNQDGKSDRLRLQLSVPLKAEEQIYSIQLLLTFSYQL-FRMSTVVMQSMAFIQHSSSVPGSQLFINGDLRLHQQIPLPHRG---LHAAYNVSVVETGSPFATSYDLASIIRAYQARNLTTYLSCPTPVWIIGRAVNAPFQINAEVRYPLETISYRPGFWEMIKFAWIQYVSVLLVFLWLFNHIQTFVFQN 293          
BLAST of SMED30031908 vs. Ensembl Sea Lamprey
Match: tmem231 (transmembrane protein 231 [Source:NCBI gene;Acc:393358])

HSP 1 Score: 87.0409 bits (214), Expect = 2.349e-19
Identity = 76/289 (26.30%), Postives = 129/289 (44.64%), Query Frame = -3
Query:  456 YVVYRQKEYAKYYHNIFSRATIFVILFSLTPLFVSAIAAYRAYGFYTTSVFIPSQPIVSLQQDMALMFLSDSGVYSWS---NLQASTPTC-LPVISITETDSNFDGINESLNMTVKL---YNKTISGIKFLLQFDYNVSTTISTLKIQQPIVIFLDAQQTVRKLVVTGRLDVYQKRRLPNSGVLTIXXXXXXXXXXXXNVLANPFDNLPGNISGRNFTLKLMDLSTGWQLSPNPDL-FEVNIEILYNPVELQYHTEFWSMVKWAWVQWFYFLVLFVFCFQRFKDFVFES 1298
            Y V+      +Y  ++FS+A++F++   L       +  YR+ GF+  +     QP V    D+ L+  ++S   +WS   NL +  P    P ++  E D N DG  + L+ ++ +       + G+  LL F Y +   + TL +Q   ++   +     +L V G L + Q+  L + G L    N    + SS    A  F  +      RN +  L +    W+      + F +N+ I Y      Y   FW  +K+ WVQ+   L++F + FQR K FVFE+
Sbjct:    3 YEVFSHPALVRYRTSLFSKASLFIVATLLLTYIPPLLVVYRSQGFWLRTASFVEQPTVKFNYDIMLLLETNSMPIAWSTFENLNSLLPKLHTPFVTAREEDVNLDGKADRLHCSLSMPMTAADEVVGVHLLLTFSYKL-FRMPTLVMQSMALVQHSSPLHGSELSVNGDLRLRQREPLAHRG-LDTRYNVSVVNGSSPFAEAYDFTEIIHAYQERNVSTVLGNTMAMWKSGRAGTIPFVINLLIRYPDAIDTYQPGFWEQIKFGWVQYVSVLLIFHWVFQRIKTFVFEN 289          
BLAST of SMED30031908 vs. Ensembl Nematostella
Match: EDO45914 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRA3])

HSP 1 Score: 87.8113 bits (216), Expect = 2.748e-19
Identity = 83/302 (27.48%), Postives = 137/302 (45.36%), Query Frame = -3
Query:  444 MTFYVVYRQKEYAKYYHNIFSRATIFVILFSLTPLFVSAIAAYRAYGFYTTSVFIPSQPIVSLQQDMALM--------FLSDSGVYSWSNLQASTPTCLPVISITETDSNFDGINESLNMTVKL---YNKTISGIKFLLQFDYNVSTTISTLKIQQPIVIFLDAQQTVRKLVVTGRLDVYQKRRLPNSGVLTIXXXXXXXXXXXXNVLANPFDNLPGNISGRNFTLKLMD---LSTGWQLSPNPDLFEVNIEILYNPVELQYHTEFWSMVKWAWVQWFYFLVLFVFCFQRFKDFVFESFAVS 1307
            M  Y V+R     KY  +I SRAT+F             I AY  YGF+        QP V  +  + L+        FL+ S   +++ L       +P+I   E D+N DG +++L+  + L    +++I  I+ +L FDY +   ++ L+++    I + +     +    G L + Q+  LP+ G+ + YN    + +S+     N        I  RN + + +    + TG + +  P  F V   + Y    + Y   FW M+KWAWVQ+   L +F+F F + K FVFE   VS
Sbjct:    1 MVMYEVHRHPVLQKYKTHICSRATLFQFFVVWLTFLPPLIIAYVTYGFWMKESTFREQPDVYYKHQLLLVAQGNTPGSFLAYSTFQNFNQLLKDN-LRIPMIKSWEEDTNLDGKHDALHFEIHLPLKNSESIYSIQLILIFDYRLHQYVN-LQMESLACISMSSPIAGAEFSTVGDLTLKQRSLLPHKGIYSTYNVPIIDGTSTLVDSYNLHQIFKSYIK-RNVSTEYVSPYSIWTGGRAAGQP--FVVKGTVNYPEETIMYRPGFWQMIKWAWVQYLAILFIFLFVFSQVKRFVFEEQIVS 297          
BLAST of SMED30031908 vs. Ensembl Medaka
Match: tmem231 (transmembrane protein 231 [Source:NCBI gene;Acc:101168706])

HSP 1 Score: 101.679 bits (252), Expect = 1.177e-23
Identity = 86/296 (29.05%), Postives = 145/296 (48.99%), Query Frame = -3
Query:  456 MTFYVVYRQKEYAKYYHNIFSRATIFVILFSLTPLFVSAIAAYRAYGFYTTSVFIPSQPIVSLQ-QDMALMFLSDSGVY-SWS-----NLQASTPTCLPVISITETDSNFDGINESLNMTVKL---YNKTISGIKFLLQFDYNVSTTISTLKIQQPIVIFLDAQQTVRKLVVTGRLDVYQKRRLPNSGVLTIXXXXXXXXXXXXNVLANPFDNLPGNISGRNFTLKLMDLSTGWQLSPNP-DLFEVNIEILYNPVE-LQYHTEFWSMVKWAWVQWFYFLVLFVFCFQRFKDFVFES 1307
            M FY VY      +Y  ++ ++AT+F+++          + AYR+ GF+        QP+V  Q Q + +      G Y +WS     N        +P +S+ E D N DG  + L   ++L    N+ +  ++ LL F Y +   +ST+ +Q    + L +     KL ++G L + Q+  LP+ G+  IYN +  + SS     A   +N+  +   RN T  L      W + P     FE+N+EI Y PVE + Y   FW  +K+AW+Q+   L++F++ F+R + FVF++
Sbjct:    1 MAFYEVYSHPAVIRYKTSVCTKATLFLVVVLCLTYIPPLLVAYRSQGFWLKRSTYEEQPVVRFQYQTLMVAATGTQGDYVAWSTFPHLNNMLGPNLRIPAVSVKEEDLNKDGKLDLLTFQLQLPLKNNEQVYSVQLLLTFSYQL-FRMSTVVMQSLAFVQLASPVPGAKLFISGDLRLQQRTPLPHRGLYNIYNVSVIDGSSPFAS-AYDLENIVRSYQARNLTTVLSCPMPVWTVGPAAGSPFELNVEIRY-PVEVITYRPGFWETIKFAWIQYVSILLIFIWVFERVQRFVFQN 293          
BLAST of SMED30031908 vs. Ensembl Medaka
Match: tmem231 (transmembrane protein 231 [Source:NCBI gene;Acc:101168706])

HSP 1 Score: 62.7734 bits (151), Expect = 1.141e-10
Identity = 71/295 (24.07%), Postives = 118/295 (40.00%), Query Frame = -3
Query:  456 MTFYVVYRQKEYAKYYHNIFSRATIFVILFSLTPLFVSAIAAYRAYGFYTTSVFIPSQPIVSLQ-QDMALMFLSDSGVY-SWS-----NLQASTPTCLPVISITETDSNFDGINESLNMTVKL---YNKTISGIKFLLQFDYNVSTTISTLKIQQPIVIFLDAQQTVRKLVVTGRLDVYQKRRLPNSGVLTIXXXXXXXXXXXXNVLANPFDNLPGNISGRNFTLKLMDLSTGWQLSPNP-DLFEVNIEILYNPVELQYHTEFWSMVKWAWVQWFYFLVLFVFCFQRFKDFVFES 1307
            M FY VY      +Y  ++ ++AT+F+++          + AYR+ GF+        QP+V  Q Q + +      G Y +WS     N        +P +S+ E D N DG  + L   ++L    N+ +  ++ LL F Y +   +S +    P     D +  VR          YQ R L                     VL+ P                       W + P     FE+N+EI Y PVE+  +        +AW+Q+   L++F++ F+R + FVF++
Sbjct:    1 MAFYEVYSHPAVIRYKTSVCTKATLFLVVVLCLTYIPPLLVAYRSQGFWLKRSTYEEQPVVRFQYQTLMVAATGTQGDYVAWSTFPHLNNMLGPNLRIPAVSVKEEDLNKDGKLDLLTFQLQLPLKNNEQVYSVQLLLTFSYQL--FVSVIDGSSPFASAYDLENIVRS---------YQARNL-------------------TTVLSCPMP--------------------VWTVGPAAGSPFELNVEIRY-PVEVITYP-----FCFAWIQYVSILLIFIWVFERVQRFVFQN 239          
BLAST of SMED30031908 vs. Planmine SMEST
Match: SMESG000054111.1 (SMESG000054111.1)

HSP 1 Score: 605.134 bits (1559), Expect = 0.000e+0
Identity = 309/309 (100.00%), Postives = 309/309 (100.00%), Query Frame = -3
Query:  381 MTFYVVYRQKEYAKYYHNIFSRATIFVILFSLTPLFVSAIAAYRAYGFYTTSVFIPSQPIVSLQQDMALMFLSDSGVYSWSNLQASTPTCLPVISITETDSNFDGINESLNMTVKLYNKTISGIKFLLQFDYNVSTTISTLKIQQPIVIFLDAQQTVRKLVVTGRLDVYQKRRLPNSGVLTIXXXXXXXXXXXXNVLANPFDNLPGNISGRNFTLKLMDLSTGWQLSPNPDLFEVNIEILYNPVELQYHTEFWSMVKWAWVQWFYFLVLFVFCFQRFKDFVFESFAVSYRKRLTQMHKCDIKPNGNTTI 1307
            MTFYVVYRQKEYAKYYHNIFSRATIFVILFSLTPLFVSAIAAYRAYGFYTTSVFIPSQPIVSLQQDMALMFLSDSGVYSWSNLQASTPTCLPVISITETDSNFDGINESLNMTVKLYNKTISGIKFLLQFDYNVSTTISTLKIQQPIVIFLDAQQTVRKLVVTGRLDVYQKRRLPNSGVLTIYNNTYYNSSSSANVLANPFDNLPGNISGRNFTLKLMDLSTGWQLSPNPDLFEVNIEILYNPVELQYHTEFWSMVKWAWVQWFYFLVLFVFCFQRFKDFVFESFAVSYRKRLTQMHKCDIKPNGNTTI
Sbjct:    1 MTFYVVYRQKEYAKYYHNIFSRATIFVILFSLTPLFVSAIAAYRAYGFYTTSVFIPSQPIVSLQQDMALMFLSDSGVYSWSNLQASTPTCLPVISITETDSNFDGINESLNMTVKLYNKTISGIKFLLQFDYNVSTTISTLKIQQPIVIFLDAQQTVRKLVVTGRLDVYQKRRLPNSGVLTIYNNTYYNSSSSANVLANPFDNLPGNISGRNFTLKLMDLSTGWQLSPNPDLFEVNIEILYNPVELQYHTEFWSMVKWAWVQWFYFLVLFVFCFQRFKDFVFESFAVSYRKRLTQMHKCDIKPNGNTTI 309          
BLAST of SMED30031908 vs. Planmine SMEST
Match: SMESG000032658.1 (SMESG000032658.1)

HSP 1 Score: 69.707 bits (169), Expect = 6.324e-13
Identity = 71/296 (23.99%), Postives = 130/296 (43.92%), Query Frame = -3
Query:  456 MTFYVVYRQKEYAKYYHNIFSRATIFVILFSLTPLFVSAIAAYRAYGFYTTSVFIPSQPIVSLQQD--MALMFLSDSGVYSW-----SNLQASTPTCLPVISITETDSNFDGINESLNMTVKL---YNKTISGIKFLLQFDYNVSTTISTLKIQQPIVIFLDAQQTVRKLVVTGRLDVYQKRRLPNSGVLTIXXXXXXXXXXXXNVLANPFDNLPGNISGRNFTLKLMDLSTGWQLS-PNPDLFEVNIEILYNPVELQYHTEFWSMVKWAWVQWFYFLVLFVFCFQRF-KDFVFES 1307
            M F  ++R     +Y+  + S+A      F +T +F+S I AY   GFY  +  I   P+V++ ++    ++ + +  +Y       SNL A++   +P ++    DSN DG+N+  N+ ++     N+ I   +  + FD+ +   ++ L+++               L V   L   Q   L     + I   T         +     D++  +   +  +L + +    WQ      D F+V I +  NP  L Y   FW   KWAW+Q F  + +F F FQ+  K+F+F++
Sbjct:    1 MAFVEIFRSPCRRRYFSTLISKAFFVHYGFIITAIFISLIIAYTTKGFYVFTNQIVEDPVVNILKNNIYCVLGIENKTLYYGLPSINSNLYANSYR-VPSLNFQAIDSNSDGLNDIHNINIEFPMNSNEKIYSFQIFIGFDFQLRR-LTRLELKDYAYFEYSGGLNAANLTVNADLLFQQNAPLNYQNYILISLPT---------ITPTNMDDVLDSFYSQKASLVVKNQFVQWQTGRSGTDAFKVKIALNINPATLIYKPGFWFTAKWAWIQ-FASIAIFAFYFQQLIKEFLFKN 284          
The following BLAST results are available for this feature:
BLAST of SMED30031908 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
TMEM2311.596e-1529.23transmembrane protein 231 [Source:HGNC Symbol;Acc:... [more]
TMEM2318.632e-1329.25transmembrane protein 231 [Source:HGNC Symbol;Acc:... [more]
TMEM2314.632e-1125.58transmembrane protein 231 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of SMED30031908 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30031908 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30031908 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tmem2315.023e-1927.81transmembrane protein 231 [Source:NCBI gene;Acc:39... [more]
tmem2318.399e-1426.09transmembrane protein 231 [Source:NCBI gene;Acc:39... [more]
back to top
BLAST of SMED30031908 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tmem2312.500e-2130.46transmembrane protein 231 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of SMED30031908 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Tmem2318.703e-1326.62transmembrane protein 231 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of SMED30031908 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|F7B645|TM231_XENTR1.103e-2030.46Transmembrane protein 231 OS=Xenopus tropicalis OX... [more]
sp|Q7T316|TM231_DANRE3.792e-1827.81Transmembrane protein 231 OS=Danio rerio OX=7955 G... [more]
sp|Q9H6L2|TM231_HUMAN7.665e-1529.23Transmembrane protein 231 OS=Homo sapiens OX=9606 ... [more]
sp|A7MB75|TM231_BOVIN2.133e-1428.20Transmembrane protein 231 OS=Bos taurus OX=9913 GN... [more]
sp|Q5RBT8|TM231_PONAB3.064e-1429.17Transmembrane protein 231 OS=Pongo abelii OX=9601 ... [more]
back to top
BLAST of SMED30031908 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3MMS72.589e-2131.68transmembrane protein 231 OS=Salmo salar OX=8030 G... [more]
A0A1S3HUF02.746e-2130.56transmembrane protein 231 OS=Lingula unguis OX=757... [more]
A0A4Z2C9D05.138e-2130.56Uncharacterized protein OS=Takifugu bimaculatus OX... [more]
H3CM391.020e-2029.61Uncharacterized protein OS=Tetraodon nigroviridis ... [more]
W5U8D71.275e-2029.87Transmembrane protein 231 OS=Ictalurus punctatus O... [more]
back to top
BLAST of SMED30031908 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tmem2311.860e-2126.91transmembrane protein 231 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of SMED30031908 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tmem2312.349e-1926.30transmembrane protein 231 [Source:NCBI gene;Acc:39... [more]
back to top
BLAST of SMED30031908 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30031908 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO459142.748e-1927.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30031908 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tmem2311.177e-2329.05transmembrane protein 231 [Source:NCBI gene;Acc:10... [more]
tmem2311.141e-1024.07transmembrane protein 231 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of SMED30031908 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000054111.10.000e+0100.00SMESG000054111.1[more]
SMESG000032658.16.324e-1323.99SMESG000032658.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031908 ID=SMED30031908|Name=SMED30031908|organism=Schmidtea mediterranea sexual|type=transcript|length=1363bp
GAGGGTCGCTAGTGACCCTGTTAGCGTTAGAGGGTTAAAAATTTTCCTTT
ATTAATATTACTTTCTTTGAATTTCGAACGACAAATTCATAAGTTTTAAA
ATCTACATTTGATTGAGAACTCCAACAACACGAGTACATTAAGACGTTCC
AAATACATTTCCTTGGATCAAATTAATTAAACTCCGCATAAAGATATTAT
ATATCCGTCCCTTGCTCGCATTCAGAGTTCTCTCGATATAATAACCATAT
TTATAATTTCACCACATGAAAACCGTGAAAGAACAGAAAGTCAGTCCAAG
TCAATAGGTAAATCAAGAAATATATTATTATTATCATCAACATCACCATT
ATCCAGGGAAATATGCATAAGATGATGTCAAATTGTTGTATTCCCGTTCG
GTTTGATGTCACATTTGTGCATTTGTGTCAATCGCTTTCTGTATGAAACA
GCAAAACTTTCAAAAACAAAATCTTTAAACCTTTGAAAACAAAACACGAA
TAAAACGAGAAAATAAAACCATTGCACCCAGGCCCATTTAACCATGGACC
AGAATTCCGTATGATATTGTAATTCAACCGGATTATAAAGGATTTCGATG
TTCACTTCGAAAAGGTCTGGGTTAGGAGACAACTGCCAACCAGTTGACAA
ATCCATCAACTTTAACGTAAAATTACGACCGGAAATATTTCCGGGGAGAT
TATCAAACGGGTTTGCGAGAACATTTGCACTTGAAGAGCTGTTGTAGTAC
GTATTATTGTAAATCGTCAGTACACCACTATTTGGCAATCTTCGCTTTTG
ATAGACATCCAGTCGGCCCGTAACTACTAATTTGCGGACCGTCTGTTGTG
CGTCCAGAAAGATGACTATCGGCTGCTGGATTTTCAGTGTGGAAATTGTA
GTGGAAACGTTGTAATCGAATTGCAGTAGAAATTTTATTCCGCTAATAGT
TTTGTTGTATAATTTCACAGTCATATTCAAAGATTCATTGATTCCATCGA
AATTAGAATCGGTTTCCGTAATTGAAATAACCGGCAGACAAGTTGGAGTT
GAAGCTTGTAAATTGCTCCAAGAATAGACTCCGGAATCTGATAGAAACAT
CAACGCCATATCTTGTTGCAAACTAACTATTGGTTGGCTTGGAATAAAAA
CAGATGTTGTATAGAAACCATAAGCTCTATATGCTGCGATAGCTGATACA
AATAGTGGAGTTAGTGAAAATAATATCACAAATATTGTGGCCCTTGAAAA
TATATTATGATAATATTTAGCATACTCTTTTTGACGATATACAACATAAA
ATGTCATTTTTAAACTTTTAAATATTACGTTACCATATGCTTTGTTATTT
TACTTAATAAAAC
back to top

protein sequence of SMED30031908-orf-1

>SMED30031908-orf-1 ID=SMED30031908-orf-1|Name=SMED30031908-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=310bp
MTFYVVYRQKEYAKYYHNIFSRATIFVILFSLTPLFVSAIAAYRAYGFYT
TSVFIPSQPIVSLQQDMALMFLSDSGVYSWSNLQASTPTCLPVISITETD
SNFDGINESLNMTVKLYNKTISGIKFLLQFDYNVSTTISTLKIQQPIVIF
LDAQQTVRKLVVTGRLDVYQKRRLPNSGVLTIYNNTYYNSSSSANVLANP
FDNLPGNISGRNFTLKLMDLSTGWQLSPNPDLFEVNIEILYNPVELQYHT
EFWSMVKWAWVQWFYFLVLFVFCFQRFKDFVFESFAVSYRKRLTQMHKCD
IKPNGNTTI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR019306TMEM231
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR019306Transmembrane protein 231PFAMPF10149TM231coord: 1..288
e-value: 1.8E-46
score: 158.9
IPR019306Transmembrane protein 231PANTHERPTHR14605CHST5 PROTEINcoord: 1..288
NoneNo IPR availableTMHMMTMhelixcoord: 20..42