Mannosyltransferase

Overview
NameMannosyltransferase
Smed IDSMED30031892
Length (bp)1648
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Mannosyltransferase (SMED30031892) t-SNE clustered cells

Violin plots show distribution of expression levels for Mannosyltransferase (SMED30031892) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Mannosyltransferase (SMED30031892) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Mannosyltransferase (SMED30031892) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031892

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30031892h1SMcG0022524 SmedASXL_012607SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30031892h1SMcG0022524 Contig32314uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031892h1SMcG0022524 Contig32314newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30031892h1SMcG0022524 dd_Smed_v4_8775_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30031892h1SMcG0022524 dd_Smed_v4_8775_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Mannosyltransferase vs. Ensembl Human
Match: ALG12 (ALG12 alpha-1,6-mannosyltransferase [Source:HGNC Symbol;Acc:HGNC:19358])

HSP 1 Score: 280.026 bits (715), Expect = 1.734e-87
Identity = 184/471 (39.07%), Postives = 275/471 (58.39%), Query Frame = 3
Query:   84 ILTCPYTKVEESFNMQAVHDILNYQFNVSKFDHLAFPGVVPRXXXXXXXXXXXXXXLKLISDILNLPKFYQQLISRFIILCFSLLAQNFFANSIKKTFGNSVKFYYLICTLTQFHINFYGSRSLPNNFALIIALFSISFYLRRKFKCFVILSGVAILLIRSEXXXXXXXXXXXXXXXKKFSITKFFITSFVTALILLGISIAFDSYFWQRIVWPEAEVLVFNTILNRSSEWGTLPFFWYFYSALPRCLLASTLPSILNCVVNSKAKSTELMLYGLGFVFIYSFLPHKELRFVIYVVPILNAAAAHFWQFVYEKSEKSKPFXXXXXXXXXXXXXNIIMTIFLLKVSHYNYPGGEAISKFNSLAHLENKDVHVHFCNLAAQTGVTRFIEQHENWTYNKTERIDYHPAE-MATFTHVILETPRKTEFETMMKSRDISYRLLFNVDSYNGLSSSW----PF-YKLRSSLVVLERL 1478
            ++ CPYTKVEESFN+QA HD+L +  ++ ++DHL FPGVVPRTF  P +I++FS P   +  +L + KFY QLI R ++    +         +++ FG  V   +   T  QFH+ FY +R+LPN  AL + L +++ +LR ++  F+ LS  AI++ R EL +  GL+LL  L  +K S+ +    +    ++ LG+++A DSYFW+++ WPE +VL +NT+LN+SS WGT P  WYFYSALPR L  S L   L  V       T L    LGF+ +YS LPHKELRF+IY  P+LN  AA    ++    +KS  +   +  +    ++N   +   L VSH+NYPGG A+ + + L   +  DV +H    AAQTGV+RF++ +  W Y+K E  D  P   M  +TH+++E         +   RD ++R+L +V    G+S +     PF   L++ LV+LERL
Sbjct:   25 LVICPYTKVEESFNLQATHDLLYHWQDLEQYDHLEFPGVVPRTFLGPVVIAVFSSPAVYVLSLLEMSKFYSQLIVRGVLGLGVIFGLWTLQKEVRRHFGAMVATMFCWVTAMQFHLMFYCTRTLPNVLALPVVLLALAAWLRHEWARFIWLSAFAIIVFRVELCLFLGLLLLLALGNRKVSVVRALRHAVPAGILCLGLTVAVDSYFWRQLTWPEGKVLWYNTVLNKSSNWGTSPLLWYFYSALPRGLGCSLLFIPLGLVDRRTHAPTVL---ALGFMALYSLLPHKELRFIIYAFPMLNITAARGCSYLLNNYKKSWLYKAGSLLVIGHLVVNAAYSATALYVSHFNYPGGVAMQRLHQLVPPQT-DVLLHIDVAAAQTGVSRFLQVNSAWRYDKRE--DVQPGTGMLAYTHILMEAAPG----LLALYRD-THRVLASVVGTTGVSLNLTQLPPFNVHLQTKLVLLERL 484          
BLAST of Mannosyltransferase vs. Ensembl Human
Match: ALG12 (ALG12 alpha-1,6-mannosyltransferase [Source:HGNC Symbol;Acc:HGNC:19358])

HSP 1 Score: 133.65 bits (335), Expect = 1.025e-35
Identity = 76/175 (43.43%), Postives = 109/175 (62.29%), Query Frame = 3
Query:  501 YLRRKFKCFVILSGVAILLIRSEXXXXXXXXXXXXXXXKKFSITKFFITSFVTALILLGISIAFDSYFWQRIVWPEAEVLVFNTILNRSSEWGTLPFFWYFYSALPRCLLASTLPSILNCVVNSKAKSTELMLYGLGFVFIYSFLPHKELRFVIYVVPILNAAAAHFWQFVYEKS 1025
            +LR ++  F+ LS  AI++ R EL +  GL+LL  L  +K S+ +    +    ++ LG+++A DSYFW+++ WPE +VL +NT+LN+SS WGT P  WYFYSALPR L  S L   L  V       T L    LGF+ +YS LPHKELRF+IY  P+LN  AA    +++ ++
Sbjct:    8 WLRHEWARFIWLSAFAIIVFRVELCLFLGLLLLLALGNRKVSVVRALRHAVPAGILCLGLTVAVDSYFWRQLTWPEGKVLWYNTVLNKSSNWGTSPLLWYFYSALPRGLGCSLLFIPLGLVDRRTHAPTVL---ALGFMALYSLLPHKELRFIIYAFPMLNITAARGCSYLWRRN 179          
BLAST of Mannosyltransferase vs. Ensembl Human
Match: ALG12 (ALG12 alpha-1,6-mannosyltransferase [Source:HGNC Symbol;Acc:HGNC:19358])

HSP 1 Score: 87.8113 bits (216), Expect = 2.635e-19
Identity = 58/151 (38.41%), Postives = 81/151 (53.64%), Query Frame = 3
Query:  807 SALPRCLLASTLPSILNCVVNSKAKSTELMLYGLGFVFIYSFLPHKELRFVIYVVPILNAAAAHFWQFVYEKSEKSKPFXXXXXXXXXXXXXNIIMTIFLLKVSHYNYPGGEAISKFNSLAHLENKDVHVHFCNLAAQTGVTRFIEQHENW 1259
            SALPR L  S L   L  V       T L    LGF+ +YS LPHKELRF+IY  P+LN  AA    ++    +KS  +   +  +    ++N   +   L VSH+NYPGG A+ + + L   +  DV +H    AAQTGV+RF++ +  W
Sbjct:    2 SALPRGLGCSLLFIPLGLVDRRTHAPTVL---ALGFMALYSLLPHKELRFIIYAFPMLNITAARGCSYLLNNYKKSWLYKAGSLLVIGHLVVNAAYSATALYVSHFNYPGGVAMQRLHQLVPPQT-DVLLHIDVAAAQTGVSRFLQVNSAW 148          
BLAST of Mannosyltransferase vs. Ensembl Celegans
Match: algn-12 (Probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase [Source:UniProtKB/Swiss-Prot;Acc:Q23361])

HSP 1 Score: 251.136 bits (640), Expect = 7.662e-77
Identity = 182/477 (38.16%), Postives = 270/477 (56.60%), Query Frame = 3
Query:   93 CPYTKVEESFNMQAVHDIL-NYQFNVSKFDHLAFPGVVPRXXXXXXXXXXXXXXLKLISDILNLPKFYQQLISRFIILCFSLLAQNFFANSIKKTFGNSVKFYYLICTLTQFHINFYGSRSLPNNFALIIALFSISFYLRRKFKCFVILSGVAILLIRSEXXXXXXXXXXXXXXXKKFSITKF---FITSFVTALILLGISIAFDSYFWQRIVWPEAEVLVFNTILNRSSEWGTLPFFWYFYSALPRCLLASTLPSILNCVVNSKAKSTELMLYGLGFVFIYSFLPHKELRFVIYVVPILNAAAAHFWQFVYEKSEKSKPFXXXXXXXXXXXXXNIIMTIFLLKVSHYNYPGGEAISKFNSLAHLE-NKDVHVHFCNLAAQTGVTRFIEQHENWTYNKTERIDYHPAEMATFTHVILETPRKTEFETMMKSRDISY-RLLFNVDSYNGLSSSWPFYKLRSSLVVLERLEG*LDKFPW 1505
             P TKVEESFN+QA HD++ +   N+S +DH  FPGVVPRTF  P  ++I S P+  I     +PK +Q L+ R  +   + +A  +FA S+ + FG     Y  +   TQFH  FY SR LPN FALI+ +      L  +++  V  +  +++L R EL++L+G + L  +I  +  +  F          A + L +SI  DSYFW R +WPE EV+ FN + NRS E+GT PF WYFYSALPRCLL +TL   L  +V+ +    +++L  + F+F+YSFLPHKELRF+IYV+PI   +AA F   +     KS   ++L   + L  + N++ T   L V+  NYPG +A++        +  K V V+  N  AQTGV RF+  ++ WTYNKTE +   PA++  F  ++L T   T  +T ++S+ +++ R LF V+S++        YK++ S            +FPW
Sbjct:   19 APGTKVEESFNVQATHDLMFHLPTNLSNYDHSQFPGVVPRTFIGPISLAILSSPMSFIFRFWAIPKMWQLLLIRATLGLMNAMAFLYFARSVNRKFGRETAMYLRLIMCTQFHYIFYMSRPLPNTFALILVMIVFERLLEGRYESAVRYATASVILFRCELVLLYGPIFLGYMISGRLKVFGFDGAIAIGVRIAAMCLAVSIPIDSYFWGRPLWPEGEVMFFNVVENRSHEYGTQPFLWYFYSALPRCLLTTTLLVPLGLLVDRRLP--QIVLPSVIFIFLYSFLPHKELRFIIYVLPIFCLSAAVFCARMLINRHKSFFRMILFFGVILHLLANVLCTGMFLLVASKNYPGFDALNYLQFQNRFDAKKPVTVYIDNACAQTGVNRFLHINDAWTYNKTENLK--PADLENFDFLVLGTYGNT-LKTEVESKFVTWHRPLFFVNSFHQ-------YKIKKS-----------RQFPW 472          
BLAST of Mannosyltransferase vs. Ensembl Celegans
Match: T27F7.4 (Mannosyltransferase [Source:UniProtKB/TrEMBL;Acc:G5EDN2])

HSP 1 Score: 52.373 bits (124), Expect = 6.383e-7
Identity = 44/200 (22.00%), Postives = 95/200 (47.50%), Query Frame = 3
Query:  414 LTQFHINFYGSRSLPNNFALIIALFSISFYL--RRKFKCFV---ILSGVAILLIRSEXXXXXXXXXXXXXXXKKFSITKFFITSFVTALILLGISIAFDSYFWQRIVWPEAEVLVFNTILNRSSEWGTLPFFWYFYSALPRCLLASTLPSILNCVVNSKAKSTELMLYG-LGFVFIYSFLPHKELRFVIYVVPILNAAAA 995
            L+ + + +   R+L N+    + L +++++    + FK      I  GV  ++IR  + +++ +  ++ L      +   F       L +L ++   DS+ +     P    L FN +   S+ +G  P++WY  S +P  L    +P I+  +  +  + + L  +  + ++ ++S LPHKE RF++ ++P+L   A 
Sbjct:  124 LSSWFVFYCAPRTLSNSLETSLTLIALNWFPFETKNFKGPTWPYIALGVLTIIIRPTVALIWLVFGVYHLYHSPTPVRLIFQLVLPVTLPILIVTTLIDSWAYGTPTIPLWNFLQFNVVQGGSALFGVHPWYWYIVSGIPAVLTVQMIPIIVGLLGPNIFRPSLLPFFATITYIIVHSLLPHKEQRFLLPIIPLLCIYAG 323          
BLAST of Mannosyltransferase vs. Ensembl Fly
Match: CG8412 (gene:FBgn0037743 transcript:FBtr0082130)

HSP 1 Score: 326.25 bits (835), Expect = 2.208e-103
Identity = 182/420 (43.33%), Postives = 270/420 (64.29%), Query Frame = 3
Query:   96 PYTKVEESFNMQAVHDILNYQFNVSKFDHLAFPGVVPRXXXXXXXXXXXXXXLKLISDILNLPKFYQQLISRFIILCFSLLAQNFFANSIKKTFGNSVKFYYLICTLTQFHINFYGSRSLPNNFALIIALFSISFYLRRKFKCFVILSGVAILLIRSEXXXXXXXXXXXXXXXKKFSITKFFITSFVTALILLGISIAFDSYFWQRIVWPEAEVLVFNTILNRSSEWGTLPFFWYFYSALPRCLLASTLPSILNCVVNSKAKSTELMLYGLGFVFIYSFLPHKELRFVIYVVPILNAAAAHFWQFVYEKSEKSKPFXXXXXXXXXXXXXNIIMTIFLLKVSHYNYPGGEAISKFNSLAHLENKDVHVHFCNLAAQTGVTRFIEQHENWTYNKTERIDYHPAEMATFTHVILETPRKTEFE 1355
            P+TKVEESFN+QA+HDIL  + N +++DH  +PGVVPRTF  P ++SI S P  L+ + L++ KF+ Q + R ++     +A N    ++ K +G  V+ ++   T+TQFH  FY +R LPN FAL I LF+I+++LR + K F+I SG++IL+ RSEL +  G++L+  L+ +K SI      +    + +L  ++  DS+FW+R++WPE EVL +NT+LN+SS WGT PF WYFYSALPR + AS +   +   +  + +   L+L  L FV +YS LPHKELRF+IYV P+LN AAA   Q ++  S KS     L        +LN+ +T+FLL +S  NYPGG A+S+ + L      +V VH  NLAAQ+GV+RF+E +  WTY+K E ++Y  A++  +TH+++E   K   E
Sbjct:   17 PFTKVEESFNLQAMHDILYLRNNFTQYDHHDYPGVVPRTFIGPLVVSIISAPFVLLFETLSINKFWAQYVVRLVLAGAISVAWNSLRQAVTKIYGVEVRLWFTAITITQFHFMFYMTRPLPNIFALPIVLFAIAYWLRDQHKPFIICSGISILVFRSELALFLGILLVVSLLRRKVSIDGLLKVALPAGVCILAATVLVDSFFWRRLLWPEGEVLWYNTVLNKSSNWGTSPFLWYFYSALPRAMGASLVLVPIGVALEPRIRP--LVLSALLFVLLYSILPHKELRFIIYVFPVLNIAAACACQRIWMNSAKSTWHSFLALACGAHLLLNVFITLFLLVISGTNYPGGAALSRLHRL-EAGTSNVSVHISNLAAQSGVSRFMEINNEWTYSKDETMNYTQADLVAYTHLLVEAKNKQNTE 433          
BLAST of Mannosyltransferase vs. Ensembl Fly
Match: PIG-B (gene:FBgn0035464 transcript:FBtr0073149)

HSP 1 Score: 53.1434 bits (126), Expect = 4.917e-7
Identity = 45/187 (24.06%), Postives = 87/187 (46.52%), Query Frame = 3
Query:  435 FYGSRSLPNNFALIIALFSISFYLRRKFKCFVILSGVAILLIRSEXXXXXXXXXXXXXXXKKFSITKFFITSFV-TALILLGISIAFDSYFWQRIVWPEAEVLVFNTILNRSSEWGTLPFFWYFYSALPRCLLASTLPSILNCVVNSKAK-----STELMLYGLGFVFIYSFLPHKELRFVIYVVPI 977
            + GSR+L N     +   ++S++         +        +R    +++  + L+ L   + ++ +  +  FV   L++ G+ IA D+Y+  +++    E L +N   N  S +G+ P+ WYF   LP  L  +TLP I   +   K       S +L++     + + S + HKE RFV  ++P+
Sbjct:  123 YTGSRTLANTLEASLTTIALSYFPWYGESTAYLWPAAICCFLRPTAAVIWLPLSLYHLRRSRQNVLELILKRFVLIGLLVAGLGIAIDTYWHGQLIVTPYEFLKYNIFNNIGSFYGSHPWHWYFSVGLPTVLGINTLPFIFGVMETVKKSEKYPVSKQLLITIFLTLVVLSAVEHKEFRFVSPLLPL 309          
BLAST of Mannosyltransferase vs. Ensembl Fly
Match: PIG-B (gene:FBgn0035464 transcript:FBtr0073150)

HSP 1 Score: 52.7582 bits (125), Expect = 5.618e-7
Identity = 45/187 (24.06%), Postives = 87/187 (46.52%), Query Frame = 3
Query:  435 FYGSRSLPNNFALIIALFSISFYLRRKFKCFVILSGVAILLIRSEXXXXXXXXXXXXXXXKKFSITKFFITSFV-TALILLGISIAFDSYFWQRIVWPEAEVLVFNTILNRSSEWGTLPFFWYFYSALPRCLLASTLPSILNCVVNSKAK-----STELMLYGLGFVFIYSFLPHKELRFVIYVVPI 977
            + GSR+L N     +   ++S++         +        +R    +++  + L+ L   + ++ +  +  FV   L++ G+ IA D+Y+  +++    E L +N   N  S +G+ P+ WYF   LP  L  +TLP I   +   K       S +L++     + + S + HKE RFV  ++P+
Sbjct:  123 YTGSRTLANTLEASLTTIALSYFPWYGESTAYLWPAAICCFLRPTAAVIWLPLSLYHLRRSRQNVLELILKRFVLIGLLVAGLGIAIDTYWHGQLIVTPYEFLKYNIFNNIGSFYGSHPWHWYFSVGLPTVLGINTLPFIFGVMETVKKSEKYPVSKQLLITIFLTLVVLSAVEHKEFRFVSPLLPL 309          
BLAST of Mannosyltransferase vs. Ensembl Zebrafish
Match: alg12 (ALG12 alpha-1,6-mannosyltransferase [Source:ZFIN;Acc:ZDB-GENE-041210-295])

HSP 1 Score: 304.679 bits (779), Expect = 3.612e-97
Identity = 175/417 (41.97%), Postives = 265/417 (63.55%), Query Frame = 3
Query:   84 ILTCPYTKVEESFNMQAVHDILNYQFNVSKFDHLAFPGVVPRXXXXXXXXXXXXXXLKLISDILNLPKFYQQLISRFIILCFSLLAQNFFANSIKKTFGNSV-KFYYLICTLTQFHINFYGSRSLPNNFALIIALFSISFYLRRKFKCFVILSGVAILLIRSEXXXXXXXXXXXXXXXKKFSITKFFITSFVTALILLGISIAFDSYFWQRIVWPEAEVLVFNTILNRSSEWGTLPFFWYFYSALPRCLLASTLPSILNCVVNSKAKSTELMLYGLGFVFIYSFLPHKELRFVIYVVPILNAAAAHFWQFVYEKSEKSKPFXXXXXXXXXXXXXNIIMTIFLLKVSHYNYPGGEAISKFNSLAHLENKDVHVHFCNLAAQTGVTRFIEQHENWTYNKTERIDYHPAEMATFTHVILE 1331
            + TCPYTKVEESFN+QA+HDIL ++F+  K+DH  FPGVVPRTF  P +IS  S P+  +  +   PKFY Q++ R ++    +L+       +++ FG+ V   +  ICT TQFH+ FY +R+LPN FAL + L + + +L ++   F+ LS +A ++ RSEL + FGLMLL  L+ +K +  +    +     + LG++I FDS FW +++WPE +VL +NT+LN+SS WGT PF WYFYSALPR  LAST+  I   +++ + +  +L++  +GF+ +YS LPHKELRF+IY  P+ N   A    F+ +  +KS+ + + +  +    +LN   T   L VSH+NYPGG+A+ + + L      DV +H   LAAQTGV+RF+E + NW Y+K E +      M T++H+++E
Sbjct:   24 LFTCPYTKVEESFNLQAIHDILYHRFDFEKYDHHEFPGVVPRTFLGPLVISALSAPMTCVLVLFQAPKFYTQILVRGVLGLCVILSLWLMQKEVRRQFGSLVASLFCFICT-TQFHLMFYITRTLPNVFALPLVLLAFTSWLAQRHGAFIWLSALAAIVFRSELCLFFGLMLLMSLLNRKLNFGQLLYHAIPAGFVSLGLTIMFDSLFWNKLLWPEGQVLWYNTVLNKSSNWGTSPFLWYFYSALPRA-LASTILFIPLGLLDRRTR--KLLVVSIGFILLYSLLPHKELRFIIYTFPVFNVIGACGCSFILKNYQKSRIYKIGSIVVVGHLMLNATYTSISLYVSHHNYPGGKAMQELHRLMP-TTADVSLHIDVLAAQTGVSRFLELNSNWRYDKKEDLTVEDPVMKTYSHLLME 435          
BLAST of Mannosyltransferase vs. Ensembl Zebrafish
Match: alg12 (ALG12 alpha-1,6-mannosyltransferase [Source:ZFIN;Acc:ZDB-GENE-041210-295])

HSP 1 Score: 290.812 bits (743), Expect = 1.134e-91
Identity = 174/425 (40.94%), Postives = 262/425 (61.65%), Query Frame = 3
Query:   84 ILTCPYTKVEESFNMQAVHDILNYQFNVSKFDHLAFPGVVPRXXXXXXXXXXXXXXLKLISDILNLPKFYQQLISRFIILCFSLLAQNFFANSIKKTFGNSV-KFYYLICTLTQFHINFYGSRSLPNNFALIIALFSISFYLRRKFKCFVILSGVAILLIRSEXXXXXXXXXXXXXXXKKFSITKFFITSFVTALILLGISIAFDSYFWQRIVWPEAEVLVFNTILNRSSEWG-------TLPFFWYFYSALPRCLLASTLPSILNCVVNSKAKSTELMLYGLGFVFIYSFLPHKELRFVIYVVPILNAAAAHFWQFVYE-KSEKSKPFXXXXXXXXXXXXXNIIMTIFLLKVSHYNYPGGEAISKFNSLAHLENKDVHVHFCNLAAQTGVTRFIEQHENWTYNKTERIDYHPAEMATFTHVILE 1331
            + TCPYTKVEESFN+QA+HDIL ++F+  K+DH  FPGVVPRTF  P +IS  S P+  +  +   PKFY Q++ R ++    +L+       +++ FG+ V   +  ICT TQFH+ FY +R+LPN FAL + L + + +L ++   F+ LS +A ++ RSEL + FGLMLL  L+ +K +  +    +     + LG++I FDS FW +++WPE +VL +NT+LN+SS WG       T PF WYFYSALPR  LAST+  I   +++ + +  +L++  +GF+ +YS LPHKELRF+IY  P+ N        F      +KS+ + + +  +    +LN   T   L VSH+NYPGG+A+ + + L      DV +H   LAAQTGV+RF+E + NW Y+K E +      M T++H+++E
Sbjct:   24 LFTCPYTKVEESFNLQAIHDILYHRFDFEKYDHHEFPGVVPRTFLGPLVISALSAPMTCVLVLFQAPKFYTQILVRGVLGLCVILSLWLMQKEVRRQFGSLVASLFCFICT-TQFHLMFYITRTLPNVFALPLVLLAFTSWLAQRHGAFIWLSALAAIVFRSELCLFFGLMLLMSLLNRKLNFGQLLYHAIPAGFVSLGLTIMFDSLFWNKLLWPEGQVLWYNTVLNKSSNWGISFCKMLTSPFLWYFYSALPRA-LASTILFIPLGLLDRRTR--KLLVVSIGFILLYSLLPHKELRFIIYTFPVFNVIGVSGLSFTSNFNYQKSRIYKIGSIVVVGHLMLNATYTSISLYVSHHNYPGGKAMQELHRLMP-TTADVSLHIDVLAAQTGVSRFLELNSNWRYDKKEDLTVEDPVMKTYSHLLME 443          
BLAST of Mannosyltransferase vs. Ensembl Zebrafish
Match: pigb (phosphatidylinositol glycan anchor biosynthesis, class B [Source:NCBI gene;Acc:393448])

HSP 1 Score: 58.5362 bits (140), Expect = 1.253e-8
Identity = 35/108 (32.41%), Postives = 58/108 (53.70%), Query Frame = 3
Query:  651 FVTALILLGISIAFDSYFWQRIVWPEAEVLVFNTILNRSSEWGTLPFFWYFYSALPRCLLASTLPSILNCVVNSKAKSTELMLYGLGFVFIYSFLPHKELRFVIYVVP 974
            F    + LG+S   DS+F+ + ++ +   L FN + N    +G+ P+ WY+   LP  ++   LP +L+  + S  K T L+L  +    +YS L HKE RF+  V+P
Sbjct:  244 FPIGALALGVSTLIDSFFYGKWIFVQWNFLKFNVLHNVGEFYGSHPWHWYWTQGLP-VVIGPHLPLVLHGCLLSTRKHTILLLTIIWTTAVYSLLAHKEFRFIYPVLP 350          
BLAST of Mannosyltransferase vs. Ensembl Xenopus
Match: mgat4c (MGAT4 family member C [Source:Xenbase;Acc:XB-GENE-954666])

HSP 1 Score: 308.916 bits (790), Expect = 1.095e-98
Identity = 189/473 (39.96%), Postives = 281/473 (59.41%), Query Frame = 3
Query:   84 ILTCPYTKVEESFNMQAVHDILNYQFNVSKFDHLAFPGVVPRXXXXXXXXXXXXXXLKLISDILNLPKFYQQLISRFIILCFSLLAQNFFANSIKKTFGNSVKFYYLICTLTQFHINFYGSRSLPNNFALIIALFSISFYLRRKFKCFVILSGVAILLIRSEXXXXXXXXXXXXXXXKKFSITKFFITSFVTALILLGISIAFDSYFWQRIVWPEAEVLVFNTILNRSSEWGTLPFFWYFYSALPRCLLAST--LPSILNCVVNSKAKSTELMLYG-LGFVFIYSFLPHKELRFVIYVVPILNAAAAHFWQFVYEKSEKSKPFXXXXXXXXXXXXXNIIMTIFLLKVSHYNYPGGEAISKFNSLAHLENKDVHVHFCNLAAQTGVTRFIEQHENWTYNKTERIDYHPAEMATFTHVILETPRKTEFETMMKSRDISYRLLFNVDSYNG----LSSSWPFY-KLRSSLVVLERL 1478
            ++ CP+TKVEESFN+QA HDIL +  ++ K+DH  FPGVVPRTF  P  +S  S P   +  +L + KFY QLI R  +    + A       + K FG++V   + + T TQFH  FY +R+LPN FA+   LF+++ +++++   F+ LS +AI++ RSEL I  GL+LL  L+ K  S+ K  + +     + LGI++  DSYFW+R++WPE EVL +NTILN+SS+WGT PF WYFYSA+PR L  S   LP      V  + K T +++   +GF+F+YSFLPHKELRF+IY  P+LN   +    ++     KS  F   +  +    + N   +   L VSH+NYPGG A+   ++L H  + DV VH    AAQTGV+RF E H +W Y+K E I      M  ++H+I+E+       + +     ++++L  + + +G    L++  P Y KL   L++LE+L
Sbjct:   17 LMACPFTKVEESFNLQATHDILYHALDLDKYDHHDFPGVVPRTFLGPLFLSALSAPAVCLLSVLEVSKFYSQLIVRGSLGMTVIFALWTLQKEVHKQFGSTVSTLFCLITATQFHFMFYCTRTLPNIFAVPFVLFAVTSWIKKEHGQFIWLSALAIIVFRSELCIFLGLLLLVALLRKNISVLKILLHAVPAGFLWLGITVVVDSYFWKRLLWPEGEVLWYNTILNKSSDWGTSPFLWYFYSAIPRALAFSCFFLP------VGLQDKRTHILIAPVIGFIFLYSFLPHKELRFIIYTFPVLNIVVSRGCAYLINNYNKSWIFKAGSFCVVAHILANATYSGTSLYVSHFNYPGGAAMQALHTLLH-PSTDVSVHIDVAAAQTGVSRFFEIHPHWRYDKREDILPGDENMMHYSHIIMES-----VASHLSLYRATHKVLSTIPAMSGIGLNLTALPPVYIKLTEKLIILEKL 477          
BLAST of Mannosyltransferase vs. Ensembl Xenopus
Match: mgat4c (MGAT4 family member C [Source:Xenbase;Acc:XB-GENE-954666])

HSP 1 Score: 308.916 bits (790), Expect = 1.265e-98
Identity = 189/473 (39.96%), Postives = 281/473 (59.41%), Query Frame = 3
Query:   84 ILTCPYTKVEESFNMQAVHDILNYQFNVSKFDHLAFPGVVPRXXXXXXXXXXXXXXLKLISDILNLPKFYQQLISRFIILCFSLLAQNFFANSIKKTFGNSVKFYYLICTLTQFHINFYGSRSLPNNFALIIALFSISFYLRRKFKCFVILSGVAILLIRSEXXXXXXXXXXXXXXXKKFSITKFFITSFVTALILLGISIAFDSYFWQRIVWPEAEVLVFNTILNRSSEWGTLPFFWYFYSALPRCLLAST--LPSILNCVVNSKAKSTELMLYG-LGFVFIYSFLPHKELRFVIYVVPILNAAAAHFWQFVYEKSEKSKPFXXXXXXXXXXXXXNIIMTIFLLKVSHYNYPGGEAISKFNSLAHLENKDVHVHFCNLAAQTGVTRFIEQHENWTYNKTERIDYHPAEMATFTHVILETPRKTEFETMMKSRDISYRLLFNVDSYNG----LSSSWPFY-KLRSSLVVLERL 1478
            ++ CP+TKVEESFN+QA HDIL +  ++ K+DH  FPGVVPRTF  P  +S  S P   +  +L + KFY QLI R  +    + A       + K FG++V   + + T TQFH  FY +R+LPN FA+   LF+++ +++++   F+ LS +AI++ RSEL I  GL+LL  L+ K  S+ K  + +     + LGI++  DSYFW+R++WPE EVL +NTILN+SS+WGT PF WYFYSA+PR L  S   LP      V  + K T +++   +GF+F+YSFLPHKELRF+IY  P+LN   +    ++     KS  F   +  +    + N   +   L VSH+NYPGG A+   ++L H  + DV VH    AAQTGV+RF E H +W Y+K E I      M  ++H+I+E+       + +     ++++L  + + +G    L++  P Y KL   L++LE+L
Sbjct:   25 LMACPFTKVEESFNLQATHDILYHALDLDKYDHHDFPGVVPRTFLGPLFLSALSAPAVCLLSVLEVSKFYSQLIVRGSLGMTVIFALWTLQKEVHKQFGSTVSTLFCLITATQFHFMFYCTRTLPNIFAVPFVLFAVTSWIKKEHGQFIWLSALAIIVFRSELCIFLGLLLLVALLRKNISVLKILLHAVPAGFLWLGITVVVDSYFWKRLLWPEGEVLWYNTILNKSSDWGTSPFLWYFYSAIPRALAFSCFFLP------VGLQDKRTHILIAPVIGFIFLYSFLPHKELRFIIYTFPVLNIVVSRGCAYLINNYNKSWIFKAGSFCVVAHILANATYSGTSLYVSHFNYPGGAAMQALHTLLH-PSTDVSVHIDVAAAQTGVSRFFEIHPHWRYDKREDILPGDENMMHYSHIIMES-----VASHLSLYRATHKVLSTIPAMSGIGLNLTALPPVYIKLTEKLIILEKL 485          
BLAST of Mannosyltransferase vs. Ensembl Xenopus
Match: mgat4c (MGAT4 family member C [Source:Xenbase;Acc:XB-GENE-954666])

HSP 1 Score: 303.908 bits (777), Expect = 1.052e-96
Identity = 178/420 (42.38%), Postives = 256/420 (60.95%), Query Frame = 3
Query:   84 ILTCPYTKVEESFNMQAVHDILNYQFNVSKFDHLAFPGVVPRXXXXXXXXXXXXXXLKLISDILNLPKFYQQLISRFIILCFSLLAQNFFANSIKKTFGNSVKFYYLICTLTQFHINFYGSRSLPNNFALIIALFSISFYLRRKFKCFVILSGVAILLIRSEXXXXXXXXXXXXXXXKKFSITKFFITSFVTALILLGISIAFDSYFWQRIVWPEAEVLVFNTILNRSSEWGTLPFFWYFYSALPRCLLAST--LPSILNCVVNSKAKSTELMLYG-LGFVFIYSFLPHKELRFVIYVVPILNAAAAHFWQFVYEKSEKSKPFXXXXXXXXXXXXXNIIMTIFLLKVSHYNYPGGEAISKFNSLAHLENKDVHVHFCNLAAQTGVTRFIEQHENWTYNKTERIDYHPAEMATFTHVILET 1334
            ++ CP+TKVEESFN+QA HDIL +  ++ K+DH  FPGVVPRTF  P  +S  S P   +  +L + KFY QLI R  +    + A       + K FG++V   + + T TQFH  FY +R+LPN FA+   LF+++ +++++   F+ LS +AI++ RSEL I  GL+LL  L+ K  S+ K  + +     + LGI++  DSYFW+R++WPE EVL +NTILN+SS+WGT PF WYFYSA+PR L  S   LP      V  + K T +++   +GF+F+YSFLPHKELRF+IY  P+LN   +    ++     KS  F   +  +    + N   +   L VSH+NYPGG A+   ++L H  + DV VH    AAQTGV+RF E H +W Y+K E I      M  ++H+I+E+
Sbjct:   25 LMACPFTKVEESFNLQATHDILYHALDLDKYDHHDFPGVVPRTFLGPLFLSALSAPAVCLLSVLEVSKFYSQLIVRGSLGMTVIFALWTLQKEVHKQFGSTVSTLFCLITATQFHFMFYCTRTLPNIFAVPFVLFAVTSWIKKEHGQFIWLSALAIIVFRSELCIFLGLLLLVALLRKNISVLKILLHAVPAGFLWLGITVVVDSYFWKRLLWPEGEVLWYNTILNKSSDWGTSPFLWYFYSAIPRALAFSCFFLP------VGLQDKRTHILIAPVIGFIFLYSFLPHKELRFIIYTFPVLNIVVSRGCAYLINNYNKSWIFKAGSFCVVAHILANATYSGTSLYVSHFNYPGGAAMQALHTLLH-PSTDVSVHIDVAAAQTGVSRFFEIHPHWRYDKREDILPGDENMMHYSHIIMES 437          
BLAST of Mannosyltransferase vs. Ensembl Xenopus
Match: pigb (phosphatidylinositol glycan anchor biosynthesis class B [Source:NCBI gene;Acc:100145769])

HSP 1 Score: 51.2174 bits (121), Expect = 3.574e-6
Identity = 54/233 (23.18%), Postives = 107/233 (45.92%), Query Frame = 3
Query:  303 ISRFIILCFSLLAQNFFANSIKKTFGNSVKFYYLICTLTQFHINFYGSRSLPNNFALIIALFSISFYL-----RRKFKCFVILSGVAILLIRSEXXXXXXXXXXXXXXXKKFSITKFFITSFVTALIL-LGISIAFDSYFWQRIVWPEAEVLVFNTILNRSSEWGTLPFFWYFYSALPRCLLASTLP-SILNCVVNSKAKSTELMLYGLGF-VFIYSFLPHKELRFVIYVVPI 977
            + R +   FS +A     + ++      +  +   C L  +   +  +R+L N    +++ F++ +Y       +    ++I   +A L+  + +++   L+       KK +     +  ++   IL L  S+  D  F+ +  + +   L FN + +  S +G+ P+ WYF   LP  +L + LP  I  C+V    K  +++L  +G+ V  YS L HKE RF+  V+P+
Sbjct:  130 VPRLVQAIFSGIADIRLYSLVRHLENTELAKWVFFCQLCSWFTWYCSTRTLTNTMEAVLSTFALYYYPLEGSNTKNSTKYLICVALAFLIRPTAVILWVPLLFYHFAKEKKKA--DLVVNQYLPVGILTLATSLIVDRIFFGKWTFVQWNFLKFNVLQDLGSFYGSHPWHWYFTQGLP-VILCTHLPFFIHGCMV--APKKYQILLVAVGWTVLTYSALSHKEFRFIYPVLPV 357          
BLAST of Mannosyltransferase vs. Ensembl Xenopus
Match: pigb (phosphatidylinositol glycan anchor biosynthesis class B [Source:NCBI gene;Acc:100145769])

HSP 1 Score: 50.8322 bits (120), Expect = 4.405e-6
Identity = 54/233 (23.18%), Postives = 107/233 (45.92%), Query Frame = 3
Query:  303 ISRFIILCFSLLAQNFFANSIKKTFGNSVKFYYLICTLTQFHINFYGSRSLPNNFALIIALFSISFYL-----RRKFKCFVILSGVAILLIRSEXXXXXXXXXXXXXXXKKFSITKFFITSFVTALIL-LGISIAFDSYFWQRIVWPEAEVLVFNTILNRSSEWGTLPFFWYFYSALPRCLLASTLP-SILNCVVNSKAKSTELMLYGLGF-VFIYSFLPHKELRFVIYVVPI 977
            + R +   FS +A     + ++      +  +   C L  +   +  +R+L N    +++ F++ +Y       +    ++I   +A L+  + +++   L+       KK +     +  ++   IL L  S+  D  F+ +  + +   L FN + +  S +G+ P+ WYF   LP  +L + LP  I  C+V    K  +++L  +G+ V  YS L HKE RF+  V+P+
Sbjct:  130 VPRLVQAIFSGIADIRLYSLVRHLENTELAKWVFFCQLCSWFTWYCSTRTLTNTMEAVLSTFALYYYPLEGSNTKNSTKYLICVALAFLIRPTAVILWVPLLFYHFAKEKKKA--DLVVNQYLPVGILTLATSLIVDRIFFGKWTFVQWNFLKFNVLQDLGSFYGSHPWHWYFTQGLP-VILCTHLPFFIHGCMV--APKKYQILLVAVGWTVLTYSALSHKEFRFIYPVLPV 357          
BLAST of Mannosyltransferase vs. Ensembl Mouse
Match: Alg12 (asparagine-linked glycosylation 12 (alpha-1,6-mannosyltransferase) [Source:MGI Symbol;Acc:MGI:2385025])

HSP 1 Score: 308.916 bits (790), Expect = 9.696e-99
Identity = 189/471 (40.13%), Postives = 283/471 (60.08%), Query Frame = 3
Query:   84 ILTCPYTKVEESFNMQAVHDILNYQFNVSKFDHLAFPGVVPRXXXXXXXXXXXXXXLKLISDILNLPKFYQQLISRFIILCFSLLAQNFFANSIKKTFGNSVKFYYLICTLTQFHINFYGSRSLPNNFALIIALFSISFYLRRKFKCFVILSGVAILLIRSEXXXXXXXXXXXXXXXKKFSITKFFITSFVTALILLGISIAFDSYFWQRIVWPEAEVLVFNTILNRSSEWGTLPFFWYFYSALPRCLLASTLPSILNCVVNSKAKSTELMLYGLGFVFIYSFLPHKELRFVIYVVPILNAAAAHFWQFVYEKSEKSKPFXXXXXXXXXXXXXNIIMTIFLLKVSHYNYPGGEAISKFNSLAHLENKDVHVHFCNLAAQTGVTRFIEQHENWTYNKTERIDYHPAEMATFTHVILET-PRKTEFETMMKSRDISYRLLFNVDSYNGLSSSW----PF-YKLRSSLVVLERL 1478
            ++ CPYTKVEESFN+QA HD+L +Q ++ K+DH  FPGVVPRTF  P +I+ FS P+  +  +L + KFY QLI R ++    +         +++ FG +V   +   + TQFH+ FY +R+LPN  AL + L +++ +L+R++  FV LS   I+  R+EL +L G+ LL  L  ++ ++ +    +    L+ LG+++A DSYFW+ +VWPE  VL +NT+LN+SS WGT P  WYFYSALPR L  S L   L  V     ++  L L  LGFV +YS LPHKELRF+IY  P+LN  AA    ++  K  KS P+ +    +    ++N+  T   L VSH+NYPGG A+ + + L      DV +H    AAQTGV+RF++ +++W Y+K+E  D   A M  +TH+++E  P           RD ++R+L +++   G+S +     PF   L++ LV+LERL
Sbjct:   26 LVICPYTKVEESFNLQATHDLLYHQLDIDKYDHHEFPGVVPRTFLGPLVIAAFSSPVVYVLSLLEVSKFYSQLIVRGVLGLGVISGLWTLQKEVRQQFGATVAVMFCWISATQFHLMFYCTRTLPNVLALAVVLPALTAWLQRRWALFVWLSAFVIIGFRAELAMLLGIALLLTLYQRRLTVARVLRHAIPAGLLCLGLTVAVDSYFWRYLVWPEGVVLWYNTVLNKSSNWGTSPLLWYFYSALPRGLGCSLLFIPLGAV---DRRTYALALPSLGFVALYSLLPHKELRFIIYTFPVLNIMAARGCTYILNK--KSWPYKVRAMLVTGHILVNVAYTATSLYVSHFNYPGGVAMQQLHELVP-PQTDVLLHIDVAAAQTGVSRFLQVNDDWRYDKSE--DVGAAAMLNYTHILMEAVPGHPALY-----RD-THRVLASIEGTTGISLNLMKLPPFDVNLQTKLVLLERL 482          
BLAST of Mannosyltransferase vs. Ensembl Mouse
Match: Alg12 (asparagine-linked glycosylation 12 (alpha-1,6-mannosyltransferase) [Source:MGI Symbol;Acc:MGI:2385025])

HSP 1 Score: 125.176 bits (313), Expect = 7.100e-31
Identity = 76/198 (38.38%), Postives = 121/198 (61.11%), Query Frame = 3
Query:   84 ILTCPYTKVEESFNMQAVHDILNYQFNVSKFDHLAFPGVVPRXXXXXXXXXXXXXXLKLISDILNLPKFYQQLISRFIILCFSLLAQNFFANSIKKTFGNSVKFYYLICTLTQFHINFYGSRSLPNNFALIIALFSISFYLRRKFKCFVILSGVAILLIRSEXXXXXXXXXXXXXXXKKFSITKFFITSFVTALILLG 677
            ++ CPYTKVEESFN+QA HD+L +Q ++ K+DH  FPGVVPRTF  P +I+ FS P+  +  +L + KFY QLI R ++    +         +++ FG +V   +   + TQFH+ FY +R+LPN  AL + L +++ +L+R++  FV LS   I+  R+EL +L G+ LL  L  ++ ++ +    +    L+ LG
Sbjct:   26 LVICPYTKVEESFNLQATHDLLYHQLDIDKYDHHEFPGVVPRTFLGPLVIAAFSSPVVYVLSLLEVSKFYSQLIVRGVLGLGVISGLWTLQKEVRQQFGATVAVMFCWISATQFHLMFYCTRTLPNVLALAVVLPALTAWLQRRWALFVWLSAFVIIGFRAELAMLLGIALLLTLYQRRLTVARVLRHAIPAGLLCLG 223          

HSP 2 Score: 79.337 bits (194), Expect = 1.935e-15
Identity = 53/158 (33.54%), Postives = 90/158 (56.96%), Query Frame = 3
Query: 1023 SEKSKPFXXXXXXXXXXXXXNIIMTIFLLKVSHYNYPGGEAISKFNSLAHLENKDVHVHFCNLAAQTGVTRFIEQHENWTYNKTERIDYHPAEMATFTHVILET-PRKTEFETMMKSRDISYRLLFNVDSYNGLSSSW----PF-YKLRSSLVVLERL 1478
            ++KS P+ +    +    ++N+  T   L VSH+NYPGG A+ + + L   +  DV +H    AAQTGV+RF++ +++W Y+K+E  D   A M  +TH+++E  P           RD ++R+L +++   G+S +     PF   L++ LV+LERL
Sbjct:  233 NKKSWPYKVRAMLVTGHILVNVAYTATSLYVSHFNYPGGVAMQQLHELVPPQT-DVLLHIDVAAAQTGVSRFLQVNDDWRYDKSE--DVGAAAMLNYTHILMEAVPGHPAL-----YRD-THRVLASIEGTTGISLNLMKLPPFDVNLQTKLVLLERL 381          
BLAST of Mannosyltransferase vs. Ensembl Mouse
Match: Alg12 (asparagine-linked glycosylation 12 (alpha-1,6-mannosyltransferase) [Source:MGI Symbol;Acc:MGI:2385025])

HSP 1 Score: 113.235 bits (282), Expect = 9.575e-29
Identity = 60/145 (41.38%), Postives = 94/145 (64.83%), Query Frame = 3
Query:   84 ILTCPYTKVEESFNMQAVHDILNYQFNVSKFDHLAFPGVVPRXXXXXXXXXXXXXXLKLISDILNLPKFYQQLISRFIILCFSLLAQNFFANSIKKTFGNSVKFYYLICTLTQFHINFYGSRSLPNNFALIIALFSISFYLRRKF 518
            ++ CPYTKVEESFN+QA HD+L +Q ++ K+DH  FPGVVPRTF  P +I+ FS P+  +  +L + KFY QLI R ++    +         +++ FG +V   +   + TQFH+ FY +R+LPN  AL + L +++ +L+R++
Sbjct:   26 LVICPYTKVEESFNLQATHDLLYHQLDIDKYDHHEFPGVVPRTFLGPLVIAAFSSPVVYVLSLLEVSKFYSQLIVRGVLGLGVISGLWTLQKEVRQQFGATVAVMFCWISATQFHLMFYCTRTLPNVLALAVVLPALTAWLQRRW 170          
BLAST of Mannosyltransferase vs. UniProt/SwissProt
Match: sp|Q9VH78|ALG12_DROME (Probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Drosophila melanogaster OX=7227 GN=CG8412 PE=2 SV=1)

HSP 1 Score: 326.25 bits (835), Expect = 2.214e-102
Identity = 182/420 (43.33%), Postives = 270/420 (64.29%), Query Frame = 3
Query:   96 PYTKVEESFNMQAVHDILNYQFNVSKFDHLAFPGVVPRXXXXXXXXXXXXXXLKLISDILNLPKFYQQLISRFIILCFSLLAQNFFANSIKKTFGNSVKFYYLICTLTQFHINFYGSRSLPNNFALIIALFSISFYLRRKFKCFVILSGVAILLIRSEXXXXXXXXXXXXXXXKKFSITKFFITSFVTALILLGISIAFDSYFWQRIVWPEAEVLVFNTILNRSSEWGTLPFFWYFYSALPRCLLASTLPSILNCVVNSKAKSTELMLYGLGFVFIYSFLPHKELRFVIYVVPILNAAAAHFWQFVYEKSEKSKPFXXXXXXXXXXXXXNIIMTIFLLKVSHYNYPGGEAISKFNSLAHLENKDVHVHFCNLAAQTGVTRFIEQHENWTYNKTERIDYHPAEMATFTHVILETPRKTEFE 1355
            P+TKVEESFN+QA+HDIL  + N +++DH  +PGVVPRTF  P ++SI S P  L+ + L++ KF+ Q + R ++     +A N    ++ K +G  V+ ++   T+TQFH  FY +R LPN FAL I LF+I+++LR + K F+I SG++IL+ RSEL +  G++L+  L+ +K SI      +    + +L  ++  DS+FW+R++WPE EVL +NT+LN+SS WGT PF WYFYSALPR + AS +   +   +  + +   L+L  L FV +YS LPHKELRF+IYV P+LN AAA   Q ++  S KS     L        +LN+ +T+FLL +S  NYPGG A+S+ + L      +V VH  NLAAQ+GV+RF+E +  WTY+K E ++Y  A++  +TH+++E   K   E
Sbjct:   17 PFTKVEESFNLQAMHDILYLRNNFTQYDHHDYPGVVPRTFIGPLVVSIISAPFVLLFETLSINKFWAQYVVRLVLAGAISVAWNSLRQAVTKIYGVEVRLWFTAITITQFHFMFYMTRPLPNIFALPIVLFAIAYWLRDQHKPFIICSGISILVFRSELALFLGILLVVSLLRRKVSIDGLLKVALPAGVCILAATVLVDSFFWRRLLWPEGEVLWYNTVLNKSSNWGTSPFLWYFYSALPRAMGASLVLVPIGVALEPRIRP--LVLSALLFVLLYSILPHKELRFIIYVFPVLNIAAACACQRIWMNSAKSTWHSFLALACGAHLLLNVFITLFLLVISGTNYPGGAALSRLHRL-EAGTSNVSVHISNLAAQSGVSRFMEINNEWTYSKDETMNYTQADLVAYTHLLVEAKNKQNTE 433          
BLAST of Mannosyltransferase vs. UniProt/SwissProt
Match: sp|Q8VDB2|ALG12_MOUSE (Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Mus musculus OX=10090 GN=Alg12 PE=2 SV=2)

HSP 1 Score: 308.916 bits (790), Expect = 6.783e-98
Identity = 189/471 (40.13%), Postives = 283/471 (60.08%), Query Frame = 3
Query:   84 ILTCPYTKVEESFNMQAVHDILNYQFNVSKFDHLAFPGVVPRXXXXXXXXXXXXXXLKLISDILNLPKFYQQLISRFIILCFSLLAQNFFANSIKKTFGNSVKFYYLICTLTQFHINFYGSRSLPNNFALIIALFSISFYLRRKFKCFVILSGVAILLIRSEXXXXXXXXXXXXXXXKKFSITKFFITSFVTALILLGISIAFDSYFWQRIVWPEAEVLVFNTILNRSSEWGTLPFFWYFYSALPRCLLASTLPSILNCVVNSKAKSTELMLYGLGFVFIYSFLPHKELRFVIYVVPILNAAAAHFWQFVYEKSEKSKPFXXXXXXXXXXXXXNIIMTIFLLKVSHYNYPGGEAISKFNSLAHLENKDVHVHFCNLAAQTGVTRFIEQHENWTYNKTERIDYHPAEMATFTHVILET-PRKTEFETMMKSRDISYRLLFNVDSYNGLSSSW----PF-YKLRSSLVVLERL 1478
            ++ CPYTKVEESFN+QA HD+L +Q ++ K+DH  FPGVVPRTF  P +I+ FS P+  +  +L + KFY QLI R ++    +         +++ FG +V   +   + TQFH+ FY +R+LPN  AL + L +++ +L+R++  FV LS   I+  R+EL +L G+ LL  L  ++ ++ +    +    L+ LG+++A DSYFW+ +VWPE  VL +NT+LN+SS WGT P  WYFYSALPR L  S L   L  V     ++  L L  LGFV +YS LPHKELRF+IY  P+LN  AA    ++  K  KS P+ +    +    ++N+  T   L VSH+NYPGG A+ + + L      DV +H    AAQTGV+RF++ +++W Y+K+E  D   A M  +TH+++E  P           RD ++R+L +++   G+S +     PF   L++ LV+LERL
Sbjct:   26 LVICPYTKVEESFNLQATHDLLYHQLDIDKYDHHEFPGVVPRTFLGPLVIAAFSSPVVYVLSLLEVSKFYSQLIVRGVLGLGVISGLWTLQKEVRQQFGATVAVMFCWISATQFHLMFYCTRTLPNVLALAVVLPALTAWLQRRWALFVWLSAFVIIGFRAELAMLLGIALLLTLYQRRLTVARVLRHAIPAGLLCLGLTVAVDSYFWRYLVWPEGVVLWYNTVLNKSSNWGTSPLLWYFYSALPRGLGCSLLFIPLGAV---DRRTYALALPSLGFVALYSLLPHKELRFIIYTFPVLNIMAARGCTYILNK--KSWPYKVRAMLVTGHILVNVAYTATSLYVSHFNYPGGVAMQQLHELVP-PQTDVLLHIDVAAAQTGVSRFLQVNDDWRYDKSE--DVGAAAMLNYTHILMEAVPGHPALY-----RD-THRVLASIEGTTGISLNLMKLPPFDVNLQTKLVLLERL 482          
BLAST of Mannosyltransferase vs. UniProt/SwissProt
Match: sp|Q9BV10|ALG12_HUMAN (Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Homo sapiens OX=9606 GN=ALG12 PE=1 SV=1)

HSP 1 Score: 280.026 bits (715), Expect = 8.329e-87
Identity = 184/471 (39.07%), Postives = 275/471 (58.39%), Query Frame = 3
Query:   84 ILTCPYTKVEESFNMQAVHDILNYQFNVSKFDHLAFPGVVPRXXXXXXXXXXXXXXLKLISDILNLPKFYQQLISRFIILCFSLLAQNFFANSIKKTFGNSVKFYYLICTLTQFHINFYGSRSLPNNFALIIALFSISFYLRRKFKCFVILSGVAILLIRSEXXXXXXXXXXXXXXXKKFSITKFFITSFVTALILLGISIAFDSYFWQRIVWPEAEVLVFNTILNRSSEWGTLPFFWYFYSALPRCLLASTLPSILNCVVNSKAKSTELMLYGLGFVFIYSFLPHKELRFVIYVVPILNAAAAHFWQFVYEKSEKSKPFXXXXXXXXXXXXXNIIMTIFLLKVSHYNYPGGEAISKFNSLAHLENKDVHVHFCNLAAQTGVTRFIEQHENWTYNKTERIDYHPAE-MATFTHVILETPRKTEFETMMKSRDISYRLLFNVDSYNGLSSSW----PF-YKLRSSLVVLERL 1478
            ++ CPYTKVEESFN+QA HD+L +  ++ ++DHL FPGVVPRTF  P +I++FS P   +  +L + KFY QLI R ++    +         +++ FG  V   +   T  QFH+ FY +R+LPN  AL + L +++ +LR ++  F+ LS  AI++ R EL +  GL+LL  L  +K S+ +    +    ++ LG+++A DSYFW+++ WPE +VL +NT+LN+SS WGT P  WYFYSALPR L  S L   L  V       T L    LGF+ +YS LPHKELRF+IY  P+LN  AA    ++    +KS  +   +  +    ++N   +   L VSH+NYPGG A+ + + L   +  DV +H    AAQTGV+RF++ +  W Y+K E  D  P   M  +TH+++E         +   RD ++R+L +V    G+S +     PF   L++ LV+LERL
Sbjct:   25 LVICPYTKVEESFNLQATHDLLYHWQDLEQYDHLEFPGVVPRTFLGPVVIAVFSSPAVYVLSLLEMSKFYSQLIVRGVLGLGVIFGLWTLQKEVRRHFGAMVATMFCWVTAMQFHLMFYCTRTLPNVLALPVVLLALAAWLRHEWARFIWLSAFAIIVFRVELCLFLGLLLLLALGNRKVSVVRALRHAVPAGILCLGLTVAVDSYFWRQLTWPEGKVLWYNTVLNKSSNWGTSPLLWYFYSALPRGLGCSLLFIPLGLVDRRTHAPTVL---ALGFMALYSLLPHKELRFIIYAFPMLNITAARGCSYLLNNYKKSWLYKAGSLLVIGHLVVNAAYSATALYVSHFNYPGGVAMQRLHQLVPPQT-DVLLHIDVAAAQTGVSRFLQVNSAWRYDKRE--DVQPGTGMLAYTHILMEAAPG----LLALYRD-THRVLASVVGTTGVSLNLTQLPPFNVHLQTKLVLLERL 484          
BLAST of Mannosyltransferase vs. UniProt/SwissProt
Match: sp|Q23361|ALG12_CAEEL (Probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Caenorhabditis elegans OX=6239 GN=algn-12 PE=1 SV=2)

HSP 1 Score: 251.136 bits (640), Expect = 9.746e-76
Identity = 182/477 (38.16%), Postives = 270/477 (56.60%), Query Frame = 3
Query:   93 CPYTKVEESFNMQAVHDIL-NYQFNVSKFDHLAFPGVVPRXXXXXXXXXXXXXXLKLISDILNLPKFYQQLISRFIILCFSLLAQNFFANSIKKTFGNSVKFYYLICTLTQFHINFYGSRSLPNNFALIIALFSISFYLRRKFKCFVILSGVAILLIRSEXXXXXXXXXXXXXXXKKFSITKF---FITSFVTALILLGISIAFDSYFWQRIVWPEAEVLVFNTILNRSSEWGTLPFFWYFYSALPRCLLASTLPSILNCVVNSKAKSTELMLYGLGFVFIYSFLPHKELRFVIYVVPILNAAAAHFWQFVYEKSEKSKPFXXXXXXXXXXXXXNIIMTIFLLKVSHYNYPGGEAISKFNSLAHLE-NKDVHVHFCNLAAQTGVTRFIEQHENWTYNKTERIDYHPAEMATFTHVILETPRKTEFETMMKSRDISY-RLLFNVDSYNGLSSSWPFYKLRSSLVVLERLEG*LDKFPW 1505
             P TKVEESFN+QA HD++ +   N+S +DH  FPGVVPRTF  P  ++I S P+  I     +PK +Q L+ R  +   + +A  +FA S+ + FG     Y  +   TQFH  FY SR LPN FALI+ +      L  +++  V  +  +++L R EL++L+G + L  +I  +  +  F          A + L +SI  DSYFW R +WPE EV+ FN + NRS E+GT PF WYFYSALPRCLL +TL   L  +V+ +    +++L  + F+F+YSFLPHKELRF+IYV+PI   +AA F   +     KS   ++L   + L  + N++ T   L V+  NYPG +A++        +  K V V+  N  AQTGV RF+  ++ WTYNKTE +   PA++  F  ++L T   T  +T ++S+ +++ R LF V+S++        YK++ S            +FPW
Sbjct:   19 APGTKVEESFNVQATHDLMFHLPTNLSNYDHSQFPGVVPRTFIGPISLAILSSPMSFIFRFWAIPKMWQLLLIRATLGLMNAMAFLYFARSVNRKFGRETAMYLRLIMCTQFHYIFYMSRPLPNTFALILVMIVFERLLEGRYESAVRYATASVILFRCELVLLYGPIFLGYMISGRLKVFGFDGAIAIGVRIAAMCLAVSIPIDSYFWGRPLWPEGEVMFFNVVENRSHEYGTQPFLWYFYSALPRCLLTTTLLVPLGLLVDRRLP--QIVLPSVIFIFLYSFLPHKELRFIIYVLPIFCLSAAVFCARMLINRHKSFFRMILFFGVILHLLANVLCTGMFLLVASKNYPGFDALNYLQFQNRFDAKKPVTVYIDNACAQTGVNRFLHINDAWTYNKTENLK--PADLENFDFLVLGTYGNT-LKTEVESKFVTWHRPLFFVNSFHQ-------YKIKKS-----------RQFPW 472          
BLAST of Mannosyltransferase vs. UniProt/SwissProt
Match: sp|A8MR93|ALG12_ARATH (Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Arabidopsis thaliana OX=3702 GN=ALG12 PE=1 SV=1)

HSP 1 Score: 237.269 bits (604), Expect = 2.147e-70
Identity = 160/419 (38.19%), Postives = 236/419 (56.32%), Query Frame = 3
Query:   81 FILTCPYTKVEESFNMQAVHDILNYQFNVSKFDHLAFPGVVPRXXXXXXXXXXXXXXLKLISDILNLPKFYQQLISRFIILCFSLLAQNFFANSIKKTFGNSVKFYYLICTLTQFHINFYGSRSLPNNFALIIALFSISFYLRRKFKCFVILSGVAILLIRSEXXXXXXXXXXXXXXXKKFSITKFFITSFVTALILLGISIAFDSYFWQRIVWPEAEVLVFNTILNRSSEWGTLPFFWYFYSALPRCLLASTLPSILNCVVNSKAKSTELMLYGLGFVFIYSFLPHKELRFVIYVVPILNAAAAHFWQFVYEKSEKSKPFXXXXXXXXXXXXXNIIMTIFLLKVSHYNYPGGEAISKFNSLAHLEN--KDVHVHFCNLAAQTGVTRFIEQHENWTYNKTERIDYHPAEMATFTHVILE 1331
            +++  PYTKVEESFN+Q++HDIL ++ ++  +DHL FPGVVPRTF   FI+S+F+ P+  I   L  PK Y  + +R ++ C  L    FF   IKK FGN V+ ++++ T  QFH  FY +R LPN  AL +   +   +L+  F   +     A ++ R + M+L G + L LL+ K  S  K       TAL+ +G++I  DS  W++ VWPE EV  FN+ILNRSS+WGT    WYF SALPR LL +   S+L  +V+ +      ++  L FV +YS LPHKELRF+I  VP+ N +AA     +Y   +K+  + L+N  +     ++   T+     S+YNYP G A+ + + + H  N   +  VH     A  G++RF E    W Y+K E I         FT+++ E
Sbjct:   27 YVVMAPYTKVEESFNVQSMHDILYHRHHLDSYDHLEFPGVVPRTFIGAFIVSVFASPVVSIISCLGFPKVYSLVAARLVLGCIILSTLRFFRIQIKKKFGNQVETFFVLFTSLQFHFLFYCTRPLPNILALGLVNLAYGNWLKGNFYPALSFLIFATVIFRCDTMLLLGPIGLELLLTKSISFWKALKYCVGTALLAVGLTIFVDSIMWKKFVWPEFEVFWFNSILNRSSDWGTHSIHWYFTSALPRSLLVAYPLSLLGTLVDRRVPF--FIVPVLSFVILYSKLPHKELRFIISSVPMFNLSAAVAASRIYNNRKKTI-WKLVNMVMLAFFAISAGCTVVTFMASYYNYPSGYALKRLHQIGHPANVAGEEWVHIDTFGAMNGISRFCEDDFPWRYSKEEEIVVEELRNRNFTYLVNE 442          
BLAST of Mannosyltransferase vs. TrEMBL
Match: B3MTY0 (Mannosyltransferase OS=Drosophila ananassae OX=7217 GN=Dana\GF23035 PE=3 SV=1)

HSP 1 Score: 338.961 bits (868), Expect = 1.073e-104
Identity = 189/450 (42.00%), Postives = 287/450 (63.78%), Query Frame = 3
Query:   75 VYFILTCPYTKVEESFNMQAVHDILNYQFNVSKFDHLAFPGVVPRXXXXXXXXXXXXXXLKLISDILNLPKFYQQLISRFIILCFSLLAQNFFANSIKKTFGNSVKFYYLICTLTQFHINFYGSRSLPNNFALIIALFSISFYLRRKFKCFVILSGVAILLIRSEXXXXXXXXXXXXXXXKKFSITKFFITSFVTALILLGISIAFDSYFWQRIVWPEAEVLVFNTILNRSSEWGTLPFFWYFYSALPRCLLASTLPSILNCVVNSKAKSTELMLYGLGFVFIYSFLPHKELRFVIYVVPILNAAAAHFWQFVYEKSEKSKPFXXXXXXXXXXXXXNIIMTIFLLKVSHYNYPGGEAISKFNSLAHLENKDVHVHFCNLAAQTGVTRFIEQHENWTYNKTERIDYHPAEMATFTHVILETPRKTEFETMMKSRDISYRLLFNVDSYNGLS 1424
            V  ++  P+TKVEESFN+QA+HDIL  + N +++DH  FPGVVPRTF  P ++S+ S P  L+ + L++ KF+ Q + R ++     +A N    ++ K +G  V+ ++   T+TQFH  FY +R LPN FAL + L++I++++R + K F+I SG++IL+ RSEL +  GL+L   L+ +KFSI +    S    + +L  ++  DS+FW+R++WPE EVL +NTILN+SS WGT PFFWYFYSA+PR + AS +   +   +  + +   L L  L FV +YS LPHKELRF+IYV P+LN AAA   Q ++  S KS     L        +LN+ MT+FLL +S  NYPGGEA+S+ + L  + + +V VH  NLAAQ+GV+RF+E  + W Y+K E ++Y  AE+A++TH+++E   K   +     +D  +  +  +D +N + 
Sbjct:   10 VAHLVYTPFTKVEESFNLQAMHDILYLRDNFTQYDHHEFPGVVPRTFIGPLVVSMLSAPFVLLFETLDINKFWAQYVVRLVLAGAITVAWNNLRQAVTKIYGVEVRLWFTAITITQFHFMFYMTRPLPNIFALPLVLYAIAYWMRYQHKPFIICSGISILVFRSELALFLGLLLAVSLLQRKFSIDRLLKISLPAGICILAATVLVDSFFWRRLLWPEGEVLWYNTILNKSSNWGTSPFFWYFYSAMPRAMGASLVFVPIGIFLEKRIRP--LALSALAFVLLYSLLPHKELRFIIYVFPVLNIAAACACQRIWMNSAKSTWHSFLALCSGAHLLLNVFMTVFLLVISGTNYPGGEALSRLHRL-EVGSSNVSVHISNLAAQSGVSRFMEVRDEWAYSKNESMNYTQAELASYTHLLVEAKNKQNTDVWASLQD-EFDTVEFIDCFNSIG 455          
BLAST of Mannosyltransferase vs. TrEMBL
Match: A0A3B0K0F5 (Mannosyltransferase OS=Drosophila guanche OX=7266 GN=DGUA_6G015546 PE=3 SV=1)

HSP 1 Score: 336.65 bits (862), Expect = 7.213e-104
Identity = 189/443 (42.66%), Postives = 280/443 (63.21%), Query Frame = 3
Query:   96 PYTKVEESFNMQAVHDILNYQFNVSKFDHLAFPGVVPRXXXXXXXXXXXXXXLKLISDILNLPKFYQQLISRFIILCFSLLAQNFFANSIKKTFGNSVKFYYLICTLTQFHINFYGSRSLPNNFALIIALFSISFYLRRKFKCFVILSGVAILLIRSEXXXXXXXXXXXXXXXKKFSITKFFITSFVTALILLGISIAFDSYFWQRIVWPEAEVLVFNTILNRSSEWGTLPFFWYFYSALPRCLLASTLPSILNCVVNSKAKSTELMLYGLGFVFIYSFLPHKELRFVIYVVPILNAAAAHFWQFVYEKSEKSKPFXXXXXXXXXXXXXNIIMTIFLLKVSHYNYPGGEAISKFNSLAHLENKDVHVHFCNLAAQTGVTRFIEQHENWTYNKTERIDYHPAEMATFTHVILETPRKTEFETMMKSRDISYRLLFNVDSYNGLS 1424
            P+TKVEESFN+QA+HDIL  + N +++DH  +PGVVPRTF  P ++S+ S P  L+ + L L KF+ Q + R ++     +A N    ++ K +G  V+ ++   T+TQFH  FY +R LPN FAL I L++I+F++R + K F+I SG++IL+ RSEL +  G++L   L+ ++ SI +    +    + +L  S+  DS+FW+R++WPE EVL +NT+ N+SS WGT PF WYFYSALPR + AS +   + CV+  + +   L L  L FV +YS LPHKELRF+IYV P+LN AAA   Q ++  S KS     L        +LN+ +T+FLL +S  NYPGG A+S+ + L    + +V VH  NLAAQ+GV+RF+E  + WTY+K E ++Y  AE+A +TH+++E   K   E     +D  +  L  VD +N + 
Sbjct:   19 PFTKVEESFNLQAMHDILYLRSNFTQYDHHEYPGVVPRTFIGPLVVSMLSAPFVLLFETLRLNKFWAQYVVRLMLAGAISVAWNNLRQAVTKIYGVEVRLWFTAITITQFHFMFYMTRPLPNIFALPIVLYAIAFWMRDQQKPFIICSGISILVFRSELALFLGILLAINLLQRRLSIDRLLKIALPAGVCILAASVLVDSFFWRRLLWPEGEVLWYNTVQNKSSNWGTSPFLWYFYSALPRAMGASLIFVPIGCVLERRIRP--LALSALAFVLLYSVLPHKELRFIIYVFPVLNIAAACACQRIWMNSAKSTWHSCLALGSAGHLLLNVFVTVFLLVISGTNYPGGAALSRLHRLES-ASPNVSVHIANLAAQSGVSRFMEIRDEWTYSKDESMNYTQAEIARYTHLLVEAKNKHNTELWASLQD-DFDTLEFVDCFNSIG 457          
BLAST of Mannosyltransferase vs. TrEMBL
Match: A0A2C9K046 (Mannosyltransferase OS=Biomphalaria glabrata OX=6526 GN=106074820 PE=3 SV=1)

HSP 1 Score: 327.02 bits (837), Expect = 1.577e-102
Identity = 186/444 (41.89%), Postives = 274/444 (61.71%), Query Frame = 3
Query:   93 CPYTKVEESFNMQAVHDILNYQFNVSKFDHLAFPGVVPRXXXXXXXXXXXXXXLKLISDILNLPKFYQQLISRFIILCFSLLAQNFFANSIKKTFGNSVKFYYLICTLTQFHINFYGSRSLPNNFALIIALFSISFYLRRKFKCFVILSGVAILLIRSEXXXXXXXXXXXXXXXKKFSITKFFITSFVTALILLGISIAFDSYFWQRIVWPEAEVLVFNTILNRSSEWGTLPFFWYFYSALPRCLLASTLPSILNCVVNSKAKSTELMLYGLGFVFIYSFLPHKELRFVIYVVPILNAAAAHFWQFVYEKSEKSKPFXXXXXXXXXXXXXNIIMTIFLLKVSHYNYPGGEAISKFNSLAHLENKDVHVHFCNLAAQTGVTRFIEQHENWTYNKTERIDYHPAEMATFTHVILETPRKTEFETMMKSRDISYRLLFNVDSYNGLS 1424
            CPYTKVEESFN+QAVHDI+NY F++ K+DHL FPGVVPR+F  P  I+  S P  ++S++    KF QQ I+R  +   + L+   F  +I+  FG S+K + ++ T+TQFH  FY SR LPN FALI+ + +++ +L +K K F+ LSG +I++ R +L++  GL+ L  L+  + ++ KF + +F+    LLG+++  DSYFWQR +WPE EV+ FN +LN+SSEWGT PF WYFYS LPR L AS +  ++   V      T L+   +G++ ++SFLPHKELRF+IY  P+ N  AA     +    +KS    L+      L +LN   T+  L ++H+NYPGG AI   + L   ++  VHVH     AQTGVTRF +  ++W YNKTE +     +M  +TH++L  P        + +   ++ +L  V  Y+G+S
Sbjct:   20 CPYTKVEESFNIQAVHDIINYGFDLEKYDHLEFPGVVPRSFLGPLAIAALSSPFVILSNLTGATKFAQQYIARGTLGLATSLSFIIFCRAIESGFGKSIKRWLILITMTQFHFMFYMSRPLPNIFALILVMLALACWLYQKHKSFIWLSGASIIIFRFDLIMFLGLIALHELVVGRLAVVKFIVNTFLAGACLLGLTVVVDSYFWQRWLWPEGEVMWFNVVLNKSSEWGTSPFLWYFYSVLPRALSASFI--LVPVGVYLMRHVTVLLWPAVGYIVLFSFLPHKELRFIIYTFPVFNTVAACALSTLVHNKDKSALRKLVALGAIGLLLLNTATTLGFLLIAHHNYPGGAAIKLLHQL-EADSSGVHVHIDVFTAQTGVTRFTQLRQDWIYNKTEDLAPGGPDMMQYTHLLLGVPDGASKPLAVYAD--THTVLATVSGYSGIS 458          
BLAST of Mannosyltransferase vs. TrEMBL
Match: A0A3S1B8U6 (Mannosyltransferase (Fragment) OS=Elysia chlorotica OX=188477 GN=EGW08_009692 PE=3 SV=1)

HSP 1 Score: 325.094 bits (832), Expect = 3.956e-102
Identity = 183/444 (41.22%), Postives = 277/444 (62.39%), Query Frame = 3
Query:   93 CPYTKVEESFNMQAVHDILNYQFNVSKFDHLAFPGVVPRXXXXXXXXXXXXXXLKLISDILNLPKFYQQLISRFIILCFSLLAQNFFANSIKKTFGNSVKFYYLICTLTQFHINFYGSRSLPNNFALIIALFSISFYLRRKFKCFVILSGVAILLIRSEXXXXXXXXXXXXXXXKKFSITKFFITSFVTALILLGISIAFDSYFWQRIVWPEAEVLVFNTILNRSSEWGTLPFFWYFYSALPRCLLASTLPSILNCVVNSKAKSTELMLYGLGFVFIYSFLPHKELRFVIYVVPILNAAAAHFWQFVYEKSEKSKPFXXXXXXXXXXXXXNIIMTIFLLKVSHYNYPGGEAISKFNSLAHLENKDVHVHFCNLAAQTGVTRFIEQHENWTYNKTERIDYHPAEMATFTHVILETPRKTEFETMMKSRDISYRLLFNVDSYNGLS 1424
            CPYTKVEESFN+QAVHDILN+   + K+DHL FPGVVPRTF  P +++  S P  L+ ++    K  QQ I+R  I   + ++   F  +++  FG +VK + ++ ++TQFH  FY SR LPN  AL I L ++S +L +K + F+ LSG +I++ R ++++  GL+ +  L   +  + +F  T+ +  + LLG+++  DSYFW+R +WPE EV+ FNT+LN+SS+WGTLPF WYFYS LPR L A+ +  ++   V      T L+   LG+V ++S LPHKELRF+IY  P+ N  AA     +++  EKS    LL      L + N+I+T   L V+H NYPGG+AI+  + L   E K+VHVH     AQTGVTRF +  ++W YNKTE +     +M  +TH+++    + E E ++ + + ++ +L  + +Y G+S
Sbjct:    8 CPYTKVEESFNIQAVHDILNHGTELEKYDHLEFPGVVPRTFVGPLVVAAVSSPFVLLCNMTGANKMAQQYIARASIGLATAISFIVFCRAVESGFGGNVKKWLILMSVTQFHFMFYMSRPLPNVLALSIVLLALSSWLHQKHRTFIWLSGASIIIFRFDVIMFLGLIAVKELAIGRVGLFRFVSTTIIAGICLLGLTLFVDSYFWRRWLWPEGEVMWFNTVLNKSSQWGTLPFLWYFYSVLPRALGATLV--LVPVGVYLMRHVTVLLWPALGYVMLFSLLPHKELRFIIYTFPVFNTVAACALAMLWQSKEKSILRKLLALGSSCLILGNVIITSGFLYVAHNNYPGGDAITALHRLERHE-KNVHVHIDVFTAQTGVTRFGQLRKDWIYNKTEDLVPGGWDMQQYTHLLVGGSAR-ETEDLLGTYNATHTVLARIPAYKGIS 447          
BLAST of Mannosyltransferase vs. TrEMBL
Match: B4G559 (Mannosyltransferase OS=Drosophila persimilis OX=7234 GN=Dper\GL24301 PE=3 SV=1)

HSP 1 Score: 332.028 bits (850), Expect = 4.943e-102
Identity = 190/443 (42.89%), Postives = 276/443 (62.30%), Query Frame = 3
Query:   96 PYTKVEESFNMQAVHDILNYQFNVSKFDHLAFPGVVPRXXXXXXXXXXXXXXLKLISDILNLPKFYQQLISRFIILCFSLLAQNFFANSIKKTFGNSVKFYYLICTLTQFHINFYGSRSLPNNFALIIALFSISFYLRRKFKCFVILSGVAILLIRSEXXXXXXXXXXXXXXXKKFSITKFFITSFVTALILLGISIAFDSYFWQRIVWPEAEVLVFNTILNRSSEWGTLPFFWYFYSALPRCLLASTLPSILNCVVNSKAKSTELMLYGLGFVFIYSFLPHKELRFVIYVVPILNAAAAHFWQFVYEKSEKSKPFXXXXXXXXXXXXXNIIMTIFLLKVSHYNYPGGEAISKFNSLAHLENKDVHVHFCNLAAQTGVTRFIEQHENWTYNKTERIDYHPAEMATFTHVILETPRKTEFETMMKSRDISYRLLFNVDSYNGLS 1424
            P+TKVEESFN+QA+HDIL  + N +++DH  +PGVVPRTF  P ++S+ S P  L+ + L L KF+ Q + R ++     LA N    ++ K +G  V+ ++   T+TQFH  FY +R LPN FAL I L++I++++R + K F++ SG+AIL+ RSEL I  GL+L   L+ ++ SI +    +    + +L  S+  DS+FW+R++WPE EVL +NTILN+SS WGT PF WYFYSALPR + AS L   + CV+  + +   L L  L FV +YS LPHKELRF+IYV P+LN AAA   Q ++    KS     L        +LN+ +T+FLL +S  NYPGG A+S+ + L      +V VH  NL  + GV+RF+E  + WTY+K E ++Y  AE+A +TH+++E   K   E     +D  +  L  VD +N + 
Sbjct:   19 PFTKVEESFNLQAMHDILYLRSNFTQYDHHEYPGVVPRTFIGPLVVSMLSAPFVLLFETLRLNKFWAQYVVRLVLAGAISLAWNNLRQAVTKIYGVEVRLWFTAITITQFHFMFYMTRPLPNIFALPIVLYAIAYWMRGQQKPFIVCSGIAILVFRSELAIFLGLLLAINLLQRQLSIDRLLKIALPAGVCILAASVLVDSFFWRRLLWPEGEVLWYNTILNKSSNWGTSPFLWYFYSALPRAMGASLLFVPIGCVLEPRIRP--LALSALAFVLLYSVLPHKELRFIIYVFPVLNIAAACACQRIWMNCAKSTWHSCLALGSVGHLLLNVFVTVFLLVISGTNYPGGAALSRLHRLES-ATPNVSVHIANLLPKVGVSRFMEVRDEWTYSKDESMNYTQAEIARYTHLLVEAKNKHNTELWSSLQD-DFDTLEFVDCFNSIG 457          
BLAST of Mannosyltransferase vs. Ensembl Cavefish
Match: alg12 (ALG12 alpha-1,6-mannosyltransferase [Source:ZFIN;Acc:ZDB-GENE-041210-295])

HSP 1 Score: 145.206 bits (365), Expect = 1.447e-37
Identity = 89/231 (38.53%), Postives = 139/231 (60.17%), Query Frame = 3
Query:   84 ILTCPYTKVEESFNMQAVHDILNYQFNVSKFDHLAFPGVVPRXXXXXXXXXXXXXXLKLISDILNLPKFYQQLISRFIILCFSLLAQNFFANSIKKTFGNSVKFYYLICTLTQFHINFYGSRSLPNNFALIIALFSISFYLRRKFKCFVILSGVAILLIRSEXXXXXXXXXXXXXXXKKFSITKFFITSFVTALILLGISIAFDSYFWQRIVWPEAEVLVFNTILNRSSEW 776
            + TCP+TKVEESFN+QA HD+L ++  + K+DH  FPGVVPRTF  P  IS  S P+  +  ++  PKFY Q+I R ++     L+       +++ FG+ V   + +   +QFH+ FY +R+LPN FAL I L + + ++ +K   F+ LS   I + RSEL +L GLMLL  L+ ++ S+ +    +    ++ LG+++  DS FW++++WPE +VL  N   N    W
Sbjct:   76 LFTCPFTKVEESFNLQAAHDLLYHRAELEKYDHHEFPGVVPRTFLGPLFISALSSPMAGLLSLIEAPKFYTQIIVRAVLGVCVCLSLWHMQKEVRRQFGSLVAGIFCLICASQFHLMFYSTRTLPNVFALPIVLLAFTSWMAQKHGSFIWLSAFVITVFRSELCLLQGLMLLMSLLSRRLSVPRLLYYAVPAGILSLGLTVCVDSVFWKKLLWPEGQVLCLN---NYQKSW 303          

HSP 2 Score: 78.1814 bits (191), Expect = 4.911e-15
Identity = 47/130 (36.15%), Postives = 71/130 (54.62%), Query Frame = 3
Query: 1107 LKVSHYNYPGGEAISKFNSLAHLENKDVHVHFCNLAAQTGVTRFIEQHENWTYNKTERIDYHPAEMATFTHVILET-PRKTEFETMMKSRDISYRLLFNVDSYNGLSSSWPFY-----KLRSSLVVLERL 1478
            L VSH+NYPGG+ I + +SL    N DV VH    AAQTGV+RF+E +  W Y+K E +      M  ++H+++E  P +    +       S+R +  V  Y G++ +   +     KL + LV+LERL
Sbjct:  327 LYVSHHNYPGGKGIQELHSLVP-ANSDVSVHIDVYAAQTGVSRFLELNSKWRYDKREDLAPGDPLMKAYSHILMEANPDQISLLSG------SHRAVLFVQGYEGMTVNVSLFPPLSIKLNNKLVLLERL 449          
BLAST of Mannosyltransferase vs. Ensembl Sea Lamprey
Match: alg12 (ALG12 alpha-1,6-mannosyltransferase [Source:ZFIN;Acc:ZDB-GENE-041210-295])

HSP 1 Score: 259.61 bits (662), Expect = 1.931e-80
Identity = 169/415 (40.72%), Postives = 242/415 (58.31%), Query Frame = 3
Query:   84 ILTCPYTKVEESFNMQAVHDILNYQFNVSKFDHLAFPGVVPRXXXXXXXXXXXXXXLKLISDILNLPKFYQQLISRFIILCFSLLAQNFFANSIKKTFGNSVKFYYLICTLTQFHINFYGSRSLPNNFALIIALFSISFYLRRKFKCFVILSGVAILLIRSEXXXXXXXXXXXXXXXKKFSITKFFITSFVTALILLGISIAFDSYFWQRIVWPEAEVLVFNTILNRSSEWGTLPFFWYFYSALPRCLLASTLPSILNCVVNSKAKSTELMLYGLGFVFIYSFLPHKELRFVIYVVPILNAAAAHFWQFVYEKSEKSKPFXXXXXXXXXXXXXNIIMTIFLLKVSHYNYPGGEAISKFNSLAHLENKDVHVHFCNLAAQTGVTRFIEQHENWTYNKTERIDYHPAEMA-TFTHVI 1325
            +  CP+TKVEESFN+QA HD+L +  ++ ++DH  FPGVVPR+F  P +I++ + P   +S  L   KF  Q I R  +    LLA   +  +++  FG+ V  +  + T +QFH+ FY SRSLPN+ AL + L +++ +L  +   FV  S  A+L+ R E+ +L G MLL  L  ++ S+      +    L  LG+++A DS FW+R +WPE EV  FN ILN+SS+W T P  WYF SALPR  LAS+ P +       +     L+L  L FV  YS LPHKELRFVIYVVP LNAAAA     V+    KS    L    +     LN   +  LL  S +NYPGGEAI++ + L    +++V +H    A QTGV+RF + H++W Y+K E +D    + +  +TH++
Sbjct:   25 LAVCPFTKVEESFNLQAAHDLLYHGSDLQQYDHHEFPGVVPRSFLGPLVIAVMAAPWMHLSHALGASKFVSQYIVRGCLGVCVLLALCRYIGAVRAAFGHHVSVFTALVTASQFHLLFYSSRSLPNSMALPLVLEAMAAWLGSRHAAFVWCSACAVLVFRVEIALLVGPMLLLSLWRRQLSVADALRLAVPAGLFFLGLTVAVDSLFWRRPLWPEGEVFWFNAILNKSSQWVTQPLPWYFVSALPRA-LASSAPLVAVGAWCDRRVLPVLLLPPLIFVSAYSALPHKELRFVIYVVPALNAAAARACALVFNTVHKSAWRKLAALAVCGHLALNGAYSACLLYASSHNYPGGEAITRLHELVP-PSQNVSIHMDVAAVQTGVSRFTQIHDHWRYDKREDLDPSDVDGSLAYTHLL 437          
BLAST of Mannosyltransferase vs. Ensembl Yeast
Match: ALG12 (Alpha-1,6-mannosyltransferase localized to the ER; responsible for addition of alpha-1,6 mannose to dolichol-linked Man7GlcNAc2; acts in the dolichol pathway for N-glycosylation; human homolog ALG12 complements yeast null mutant [Source:SGD;Acc:S000005313])

HSP 1 Score: 157.918 bits (398), Expect = 2.228e-42
Identity = 145/461 (31.45%), Postives = 227/461 (49.24%), Query Frame = 3
Query:   78 YFILTCPYTKVEESFNMQAVHDILNYQ-FNVSKFDHLAFPGVVPRXXXXXXXXXXXXXXLKLISDILNLPK---FYQQLISRFIILCFSLLAQNFFANSIKKTFG------------------NSVKFYYLICTLTQFHINFYGSRSLPNNFALIIAL--FSISFYLRRKFKCFVILSGVAILLIRSEXXXXXXXXXXXXXXXKKFSITKFFITSFVTALILLG--ISIAFDSYFWQRIVWPEAEVLVFNTILNRSSEWGTLPFFWYFYSALPRCLLASTLPSILNCVVNSKAKSTELMLYGLGFVF---IYSFLPHKELRFVIYVVP---ILNA-AAAHFWQFVYEKSEKSKPFXXXXXXXXXXXXXNIIMTIFLLKVSHYNYPGGEAISKFNSLAHLEN-KDVHVHFCNLAAQTGVTRFIEQH---ENWTYNKTERIDYHPAEMATFTHVILETPRKTE 1349
            + ++  P+TKVEESFN+QA+HDIL Y  F++S++DHL FPGVVPRTF    II++ S P   +S ++   +      QL+ R I+   + L+  +  N ++  F                   +S   ++L+  +  FH+ FY +R+LPN F + + L   ++ + L  ++   + LS +  ++ R E+  L   + LF +I KK S+  F    F    + LG  ISI  DSYFWQ    PE +  +FN +   +S+WG  P   YF   L    +  T+  +L      K    +L +  L  +F   + SF PHKE RF+IY VP   +L A  AAH W+ +  K   +   +L    L L  + +  +++  L +S  NYPGGEA++ FN +   +N  +  VH       TGVT F E +       Y+KTE          +F  +I   P  ++
Sbjct:   16 FHLIQAPFTKVEESFNIQAIHDILTYSVFDISQYDHLKFPGVVPRTFVGAVIIAMLSRPYLYLSSLIQTSRPTSIDVQLVVRGIVGLTNGLSFIYLKNCLQDMFDEITEKKKEENEDKDIYIYDSAGTWFLLFLIGSFHLMFYSTRTLPN-FVMTLPLTNVALGWVLLGRYNAAIFLSALVAIVFRLEVSALSAGIALFSVIFKKISL--FDAIKFGIFGLGLGSAISITVDSYFWQEWCLPEVDGFLFNVVAGYASKWGVEPVTAYFTHYLRMMFMPPTV--LLLNYFGYKLAPAKLKIVSLASLFHIIVLSFQPHKEWRFIIYAVPSIMLLGATGAAHLWENMKVKKITN---VLCLAILPLSIMTSFFISMAFLYISRMNYPGGEALTSFNDMIVEKNITNATVHISIPPCMTGVTLFGELNYGVYGINYDKTENTTLLQEMWPSFDFLITHEPTASQ 468          
BLAST of Mannosyltransferase vs. Ensembl Nematostella
Match: EDO48762 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIR3])

HSP 1 Score: 275.404 bits (703), Expect = 1.983e-86
Identity = 174/427 (40.75%), Postives = 253/427 (59.25%), Query Frame = 3
Query:   84 ILTCPYTKVEESFNMQAVHDILNYQFNVSKFDHLAFPGVVPRXXXXXXXXXXXXXXLKLISDILNLPKFYQQLISRFIILCFSLLAQNFFANSIKKTFGNSVKFYYLICTLTQFHINFYGSRSLPNNFALIIALFSISFYLRRKFKCFVILSGVAILLIRSEXXXXXXXXXXXXXXXKKFSITKFFITSFVTALILLGISIAFDSYFWQRIVWPEAEVLVFNTILNRSSEWGTLPFFWYFYSALPRCLLASTLPSILNCVVNSKAKSTELMLYGLGFVFIYSFLPHKELRFVIYVVPILNAAAAHFWQFVYEKSEKSKPFXXXXXXXXXXXXX--NIIMTIFLLKVSHYNYPGGEAISKFNSLAHLENKDVHVHFCNLAAQTGVTRFIEQHENWTYNKTERIDYHPAEMATFTHVILETPRKTEFET 1358
            I+ CP+TKVEESFN+QA HD+L +  ++SK+DH  FPGVVPR+F  P ++++ S P   +  +LN PK Y Q   R ++   +L A   +  ++ K FG++V    ++ T TQFH  FY SR LPN FAL + L ++   L R    F+  S  AI++ R+EL IL GL+ L  L  ++ +  K  + S    +  LG+++  DS FWQR +WPE EV  FN +LN+SS+WGT PF WYFYS LPR LL +    ++   +    ++  L    L FV ++SFLPHKELRF++YV P+ N  AA    F+ +   K + F+ L   L  LA L  N + +I  L +S++NYPGG A+ + + L    +  V++H C  AA+TGV+RF E +  W Y+K E I     EM  FTH++ E P    ++T
Sbjct:   22 IVCCPFTKVEESFNLQATHDLLYHGSDLSKYDHREFPGVVPRSFIGPLVLALLSSPAVTVLKLLNAPKLYSQYAVRAVLGLMTLYAFVKYKRAVSKKFGSTVGHLLVLITSTQFHFLFYASRPLPNTFALCLVLLALHHLLLRNHSQFIWTSAFAIIIFRTELCILLGLLFLIELGTRRLTFCKALLHSVGAGVTGLGLTVCIDSIFWQRWLWPEGEVFYFNAVLNKSSQWGTSPFPWYFYSVLPRALLCAIF--LVPIGLWRDRRTWTLAGPALLFVVMFSFLPHKELRFIVYVFPVFNTVAACGLFFIVQNYCKWRRFISLTVLLASLACLVFNSLASIGFLYISNHNYPGGVAMQRVHHLT--PSNPVNMHICVAAAETGVSRFGEVNSKWRYSKAENISVDSREMLAFTHLLAEAPCSHFYQT 444          
BLAST of Mannosyltransferase vs. Ensembl Nematostella
Match: EDO45709 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSA4])

HSP 1 Score: 52.7582 bits (125), Expect = 2.459e-7
Identity = 52/224 (23.21%), Postives = 102/224 (45.54%), Query Frame = 3
Query:  369 KTFGNSVKFYYLICTLTQFHINFYGSRSLPNNFALIIALFSISFY-----LRRKFKCFVILSGVAILLI--------RSEXXXXXXXXXXXXXXXKKFSITKFFITSFVTALILLGISIAFDSYFWQRIVWPEAEVLVFNTILNRSSEWGTLPFFWYFYSALPRCLLASTLPSILNCVVNSKAKSTELMLYGLGFVFIYSFLPHKELRFVIYVVPILNAAAAHF 1001
            K FG     + L+C L+ +   +  +R+L N++  ++   ++ ++        K K     S ++I LI        R    IL+  +    +I  +  +    + +    L+ L  S+  DS+F+   +  +   L+FN + +  + +G+ P+ WYF    P  ++ + LP  L  V  S  +    ++  +  + +YSFL HKE RF+  V+PI    A ++
Sbjct:  102 KLFGPQAAKWALLCNLSSWFTFYCVTRTLSNSWETVLTTIALYYWPLELLQTTKVKDIDQSSNISISLIVAAFACIIRPTSAILWLPLSTLHIIRTERKLYFILLQALPVGLLALCWSLVIDSFFYGHWMVVQLNFLLFNVVKDLGTFYGSHPWHWYFTQGFP-AIIFTHLPLFLCGVYKSSQRILAALV--MWVLMVYSFLGHKEFRFIFPVLPICMCYAGNY 322          
BLAST of Mannosyltransferase vs. Ensembl Medaka
Match: alg12 (ALG12 alpha-1,6-mannosyltransferase [Source:NCBI gene;Acc:101171875])

HSP 1 Score: 280.796 bits (717), Expect = 4.729e-88
Identity = 163/414 (39.37%), Postives = 250/414 (60.39%), Query Frame = 3
Query:   93 CPYTKVEESFNMQAVHDILNYQFNVSKFDHLAFPGVVPRXXXXXXXXXXXXXXLKLISDILNLPKFYQQLISRFIILCFSLLAQNFFANSIKKTFGNSVKFYYLICTLTQFHINFYGSRSLPNNFALIIALFSISFYLRRKFKCFVILSGVAILLIRSEXXXXXXXXXXXXXXXKKFSITKFFITSFVTALILLGISIAFDSYFWQRIVWPEAEVLVFNTILNRSSEWGTLPFFWYFYSALPRCLLASTLPSILNCVVNSKAKSTELMLYGLGFVFIYSFLPHKELRFVIYVVPILNAAAAHFWQFVYEKSEKSKPFXXXXXXXXXXXXXNIIMTIFLLKVSHYNYPGGEAISKFNSLAHLENKDVHVHFCNLAAQTGVTRFIEQHENWTYNKTERIDYHPAEMATFTHVILET 1334
            CP+TKVEESFN+QA HDIL ++ +  K+DH  FPGVVPRTF  P  +S+ S P   +S +L+ PKFY QLI R  +      A        +K FG++V   + +   +QFH+ FY +R+LPN FAL I L + + ++ +K   FV LS   I++ RSEL I  GLMLL  L+ ++  + +    +    ++ L +++A D++FW++++WPE +VL +NTILN+SS WGT P  WYFYSA+PR L  + L   L  +    A+   L+L  +GFV +YS LPHKELRF+IY  P+ +  AA    F+     KS  + + +  +    ++N + +   L +SH+NYPGG+ + + + +      DV +H    AA+TGV+RF++Q+ NW Y+K E +     E+ T +H+++E 
Sbjct:   27 CPFTKVEESFNLQATHDILYHRLDFDKYDHHEFPGVVPRTFLGPLFLSVISSPFVFVSSLLDAPKFYSQLIVRASLGLCVTAALWHMQKEARKQFGSTVSSLFCLICASQFHLMFYSTRTLPNVFALPIVLLAFTAWMAQKHGQFVGLSAFVIVVFRSELCIFLGLMLLLSLLSRRLGLLRLLWYAAPAGILSLALTVAVDTFFWRKMLWPEGQVLWYNTILNKSSNWGTSPLLWYFYSAVPRGLGCTLLFVPLGLL---DARMRPLLLPTVGFVLVYSLLPHKELRFIIYTFPVFSLVAARGCSFILNNYRKSWMYKVGSVVVVGQLLVNALYSSVCLYISHHNYPGGQGMLELHRMLP-PTADVSLHIDTYAAETGVSRFLQQNTNWRYDKREDVGPTSPEIQTLSHLLMEA 436          
BLAST of Mannosyltransferase vs. Planmine SMEST
Match: SMESG000016336.1 (SMESG000016336.1)

HSP 1 Score: 818.535 bits (2113), Expect = 0.000e+0
Identity = 450/453 (99.34%), Postives = 450/453 (99.34%), Query Frame = 3
Query:  126 MQAVHDILNYQFNVSKFDHLAFPGVVPRXXXXXXXXXXXXXXLKLISDILNLPKFYQQLISRFIILCFSLLAQNFFANSIKKTFGNSVKFYYLICTLTQFHINFYGSRSLPNNFALIIALFSISFYLRRKFKCFVILSGVAILLIRSEXXXXXXXXXXXXXXXKKFSITKFFITSFVTALILLGISIAFDSYFWQRIVWPEAEVLVFNTILNRSSEWGTLPFFWYFYSALPRCLLASTLPSILNCVVNSKAKSTELMLYGLGFVFIYSFLPHKELRFVIYVVPILNAAAAHFWQFVYEKSEKSKPFXXXXXXXXXXXXXNIIMTIFLLKVSHYNYPGGEAISKFNSLAHLENKDVHVHFCNLAAQTGVTRFIEQHENWTYNKTERIDYHPAEMATFTHVILETPRKTEFETMMKSRDISYRLLFNVDSYNGLSSSWPFYKLRSSLVVLERLEG 1484
            MQAVHDILNYQFNVSKFDHLAFPGVVPRTFTIPFIISIFSFPLKLISDILNLPKFYQQLISRFIILCFSLLAQNFFANSIKKTFGNSVKFYYLICTLTQFHINFYGSRSLPNNFALIIALFSISFYLRRKFKCFVILSGVAILLIRSELMILFGLMLLFLLIGKKFSITKFFITSF TALILLGISIAFDSYFWQRIVWPEAEVLVFNTILNRSSEWGTLPFFWYFYSALPRCLLASTLPSILNCVVNSKAKSTELMLYGLGFVFIYSFLPHKELRFVIYVVPILN AAAHFWQFVYEKSEKSKPF LLNKFLWLLAILNIIMTIFLLKVSHYNYPGGEAISKFNSLAHLENKDVHVHFCNLAAQTGVTRFIEQHENWTYNKTERIDYHPAEMATFTHVILETPRKTEFETMMKSRDISYRLLFNVDSYNGLSSSWPFYKLRSSLVVLERLEG
Sbjct:    1 MQAVHDILNYQFNVSKFDHLAFPGVVPRTFTIPFIISIFSFPLKLISDILNLPKFYQQLISRFIILCFSLLAQNFFANSIKKTFGNSVKFYYLICTLTQFHINFYGSRSLPNNFALIIALFSISFYLRRKFKCFVILSGVAILLIRSELMILFGLMLLFLLIGKKFSITKFFITSFFTALILLGISIAFDSYFWQRIVWPEAEVLVFNTILNRSSEWGTLPFFWYFYSALPRCLLASTLPSILNCVVNSKAKSTELMLYGLGFVFIYSFLPHKELRFVIYVVPILNTAAAHFWQFVYEKSEKSKPFRLLNKFLWLLAILNIIMTIFLLKVSHYNYPGGEAISKFNSLAHLENKDVHVHFCNLAAQTGVTRFIEQHENWTYNKTERIDYHPAEMATFTHVILETPRKTEFETMMKSRDISYRLLFNVDSYNGLSSSWPFYKLRSSLVVLERLEG 453          
BLAST of Mannosyltransferase vs. Planmine SMEST
Match: SMESG000075191.1 (SMESG000075191.1)

HSP 1 Score: 53.1434 bits (126), Expect = 4.220e-7
Identity = 37/120 (30.83%), Postives = 60/120 (50.00%), Query Frame = 3
Query:  624 SITKFFITSFVTALILLGISIAFDSYFWQRIVWPEAEVLVFNTILNRSSEWGTLPFFWYFYSALPRCLLASTLPSILNCVVNSKAKSTELMLYGLGFVFIYSF--LPHKELRFVIYVVPI 977
            SI + FI      L++L  S+  + +F+ R    +   L FN + + S  +G  P+ WY  +ALP  LL + LP ++  + +         L GL    +YS+  + HKE RFV  ++PI
Sbjct:  258 SIYRTFINCLSVGLLILFASLIVEKHFYGRWTCSQLNFLHFNLLTDVSQMYGVHPWHWYISNALPSMLL-TQLPILVIGIWSEWNDHHSRKLIGLMLFVLYSYSCIGHKEFRFVFPIMPI 376          
The following BLAST results are available for this feature:
BLAST of Mannosyltransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ALG121.734e-8739.07ALG12 alpha-1,6-mannosyltransferase [Source:HGNC S... [more]
ALG121.025e-3543.43ALG12 alpha-1,6-mannosyltransferase [Source:HGNC S... [more]
ALG122.635e-1938.41ALG12 alpha-1,6-mannosyltransferase [Source:HGNC S... [more]
back to top
BLAST of Mannosyltransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
algn-127.662e-7738.16Probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,... [more]
T27F7.46.383e-722.00Mannosyltransferase [Source:UniProtKB/TrEMBL;Acc:... [more]
back to top
BLAST of Mannosyltransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CG84122.208e-10343.33gene:FBgn0037743 transcript:FBtr0082130[more]
PIG-B4.917e-724.06gene:FBgn0035464 transcript:FBtr0073149[more]
PIG-B5.618e-724.06gene:FBgn0035464 transcript:FBtr0073150[more]
back to top
BLAST of Mannosyltransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
alg123.612e-9741.97ALG12 alpha-1,6-mannosyltransferase [Source:ZFIN;A... [more]
alg121.134e-9140.94ALG12 alpha-1,6-mannosyltransferase [Source:ZFIN;A... [more]
pigb1.253e-832.41phosphatidylinositol glycan anchor biosynthesis, c... [more]
back to top
BLAST of Mannosyltransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mgat4c1.095e-9839.96MGAT4 family member C [Source:Xenbase;Acc:XB-GENE-... [more]
mgat4c1.265e-9839.96MGAT4 family member C [Source:Xenbase;Acc:XB-GENE-... [more]
mgat4c1.052e-9642.38MGAT4 family member C [Source:Xenbase;Acc:XB-GENE-... [more]
pigb3.574e-623.18phosphatidylinositol glycan anchor biosynthesis cl... [more]
pigb4.405e-623.18phosphatidylinositol glycan anchor biosynthesis cl... [more]
back to top
BLAST of Mannosyltransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Alg129.696e-9940.13asparagine-linked glycosylation 12 (alpha-1,6-mann... [more]
Alg127.100e-3138.38asparagine-linked glycosylation 12 (alpha-1,6-mann... [more]
Alg129.575e-2941.38asparagine-linked glycosylation 12 (alpha-1,6-mann... [more]
back to top
BLAST of Mannosyltransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9VH78|ALG12_DROME2.214e-10243.33Probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,... [more]
sp|Q8VDB2|ALG12_MOUSE6.783e-9840.13Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosy... [more]
sp|Q9BV10|ALG12_HUMAN8.329e-8739.07Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosy... [more]
sp|Q23361|ALG12_CAEEL9.746e-7638.16Probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,... [more]
sp|A8MR93|ALG12_ARATH2.147e-7038.19Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosy... [more]
back to top
BLAST of Mannosyltransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
B3MTY01.073e-10442.00Mannosyltransferase OS=Drosophila ananassae OX=721... [more]
A0A3B0K0F57.213e-10442.66Mannosyltransferase OS=Drosophila guanche OX=7266 ... [more]
A0A2C9K0461.577e-10241.89Mannosyltransferase OS=Biomphalaria glabrata OX=65... [more]
A0A3S1B8U63.956e-10241.22Mannosyltransferase (Fragment) OS=Elysia chlorotic... [more]
B4G5594.943e-10242.89Mannosyltransferase OS=Drosophila persimilis OX=72... [more]
back to top
BLAST of Mannosyltransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
alg121.447e-3738.53ALG12 alpha-1,6-mannosyltransferase [Source:ZFIN;A... [more]
back to top
BLAST of Mannosyltransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
alg121.931e-8040.72ALG12 alpha-1,6-mannosyltransferase [Source:ZFIN;A... [more]
back to top
BLAST of Mannosyltransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
ALG122.228e-4231.45Alpha-1,6-mannosyltransferase localized to the ER;... [more]
back to top
BLAST of Mannosyltransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO487621.983e-8640.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO457092.459e-723.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Mannosyltransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
alg124.729e-8839.37ALG12 alpha-1,6-mannosyltransferase [Source:NCBI g... [more]
back to top
BLAST of Mannosyltransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000016336.10.000e+099.34SMESG000016336.1[more]
SMESG000075191.14.220e-730.83SMESG000075191.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031892 ID=SMED30031892|Name=Mannosyltransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=1648bp
TTTCAGAGATCTAATTTAAATCTTTTGAATTTATCAATTATTTGTAAATG
ATAATTCTATTATTAATTATTAATGTTTATTTTATTTTAACTTGCCCTTA
CACGAAAGTGGAAGAAAGTTTTAATATGCAAGCCGTTCATGATATACTAA
ATTATCAATTCAATGTTAGCAAATTTGATCATTTAGCTTTTCCTGGAGTA
GTTCCAAGAACATTTACTATTCCTTTTATAATATCCATTTTTTCTTTCCC
TCTGAAATTAATTTCCGACATTTTAAATCTGCCGAAATTTTATCAACAAT
TAATTTCACGTTTTATTATTTTATGTTTTTCGCTATTGGCCCAAAACTTT
TTTGCAAATTCCATTAAGAAAACATTTGGAAATTCCGTCAAGTTTTACTA
TCTGATTTGCACATTAACCCAATTCCATATAAATTTCTACGGATCCAGAT
CTCTGCCAAATAATTTTGCTCTCATAATCGCTCTGTTTTCGATATCTTTC
TATTTACGGCGGAAATTCAAATGCTTCGTTATTTTGTCGGGAGTCGCGAT
TTTATTGATCCGGAGTGAACTGATGATTCTTTTCGGGTTGATGCTGCTTT
TTTTGTTGATTGGGAAAAAATTTTCAATCACAAAGTTTTTTATTACGAGT
TTTGTTACGGCTTTAATTTTATTGGGAATTTCTATCGCATTTGATTCGTA
TTTTTGGCAGCGAATCGTCTGGCCAGAAGCAGAAGTGCTTGTGTTTAATA
CGATTTTAAATCGCAGCTCAGAATGGGGGACCCTTCCGTTTTTCTGGTAT
TTTTATTCGGCTCTTCCGCGTTGCCTTTTAGCATCAACATTGCCCTCGAT
TCTCAACTGCGTTGTCAATAGCAAGGCCAAATCGACCGAACTGATGCTTT
ACGGTCTGGGTTTCGTTTTCATTTATTCATTTCTGCCACACAAGGAACTC
CGATTCGTGATTTATGTCGTGCCGATATTGAATGCCGCAGCAGCCCATTT
CTGGCAATTTGTCTATGAAAAATCCGAAAAATCCAAACCATTCCTGCTGT
TAAACAAATTCCTCTGGTTGCTGGCTATCCTCAACATAATTATGACAATC
TTTTTACTGAAGGTCTCCCATTATAATTATCCAGGAGGGGAAGCCATTTC
CAAATTCAATTCTCTGGCTCATCTTGAAAACAAAGATGTCCATGTTCACT
TTTGCAATTTAGCAGCCCAGACCGGGGTAACTAGGTTTATTGAGCAACAC
GAGAATTGGACGTACAACAAAACGGAACGCATCGACTATCACCCTGCTGA
AATGGCTACATTTACCCACGTAATACTGGAAACGCCTCGGAAAACTGAAT
TCGAAACGATGATGAAAAGTCGGGACATTTCATATCGGTTGCTTTTCAAT
GTCGATTCTTACAACGGCCTGTCGAGCAGTTGGCCATTCTATAAGCTTCG
TTCTTCTTTGGTAGTGTTAGAAAGGCTTGAGGGTTAATTGGATAAATTTC
CTTGGGACTTTTATTACTGTTTTGCTGGTGTCGGGCGCCCTGTGGCGCAT
GCCAGCATTAATTATGATTATTAATTAATTTATTTATTGATTTATAATAA
ATGTATTTTATCAATGCTTTTATAATTAAATGTTTAGTACAAAATGGC
back to top

protein sequence of SMED30031892-orf-1

>SMED30031892-orf-1 ID=SMED30031892-orf-1|Name=SMED30031892-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=480bp
MIILLLIINVYFILTCPYTKVEESFNMQAVHDILNYQFNVSKFDHLAFPG
VVPRTFTIPFIISIFSFPLKLISDILNLPKFYQQLISRFIILCFSLLAQN
FFANSIKKTFGNSVKFYYLICTLTQFHINFYGSRSLPNNFALIIALFSIS
FYLRRKFKCFVILSGVAILLIRSELMILFGLMLLFLLIGKKFSITKFFIT
SFVTALILLGISIAFDSYFWQRIVWPEAEVLVFNTILNRSSEWGTLPFFW
YFYSALPRCLLASTLPSILNCVVNSKAKSTELMLYGLGFVFIYSFLPHKE
LRFVIYVVPILNAAAAHFWQFVYEKSEKSKPFLLLNKFLWLLAILNIIMT
IFLLKVSHYNYPGGEAISKFNSLAHLENKDVHVHFCNLAAQTGVTRFIEQ
HENWTYNKTERIDYHPAEMATFTHVILETPRKTEFETMMKSRDISYRLLF
NVDSYNGLSSSWPFYKLRSSLVVLERLEG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005788endoplasmic reticulum lumen
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006488dolichol-linked oligosaccharide biosynthetic process
GO:0097502mannosylation
Vocabulary: molecular function
TermDefinition
GO:0052824dolichyl-pyrophosphate Man7GlcNAc2 alpha-1,6-mannosyltransferase activity
GO:0016757transferase activity, transferring glycosyl groups
GO:0016740transferase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR039485ALG12
IPR005599GPI_mannosylTrfase
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005599GPI mannosyltransferasePFAMPF03901Glyco_transf_22coord: 3..398
e-value: 3.3E-47
score: 161.7
IPR005599GPI mannosyltransferasePANTHERPTHR22760GLYCOSYLTRANSFERASEcoord: 3..461
IPR039485Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferasePANTHERPTHR22760:SF1DOL-P-MAN:MAN(7)GLCNAC(2)-PP-DOL ALPHA-1,6-MANNOSYLTRANSFERASEcoord: 3..461
NoneNo IPR availableSIGNALP_EUKSignalP-TMSignalP-TMcoord: 1..15
score: 0.511
NoneNo IPR availableTMHMMTMhelixcoord: 303..323
NoneNo IPR availableTMHMMTMhelixcoord: 247..269
NoneNo IPR availableTMHMMTMhelixcoord: 85..103
NoneNo IPR availableTMHMMTMhelixcoord: 338..360
NoneNo IPR availableTMHMMTMhelixcoord: 2..21
NoneNo IPR availableTMHMMTMhelixcoord: 160..182
NoneNo IPR availableTMHMMTMhelixcoord: 279..296
NoneNo IPR availableTMHMMTMhelixcoord: 50..72
NoneNo IPR availableTMHMMTMhelixcoord: 136..153
NoneNo IPR availableTMHMMTMhelixcoord: 197..219