Protein phosphatase 1 regulatory inhibitor subunit 16a

Overview
NameProtein phosphatase 1 regulatory inhibitor subunit 16a
Smed IDSMED30031890
Length (bp)1923
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein phosphatase 1 regulatory inhibitor subunit 16a (SMED30031890) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein phosphatase 1 regulatory inhibitor subunit 16a (SMED30031890) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein phosphatase 1 regulatory inhibitor subunit 16a (SMED30031890) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein phosphatase 1 regulatory inhibitor subunit 16a (SMED30031890) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031890

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30031890SMESG000063189.1 dd_Smed_v4_5941_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30031890SMESG000063189.1 dd_Smed_v4_5941_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Human
Match: PPP1R16B (protein phosphatase 1 regulatory subunit 16B [Source:HGNC Symbol;Acc:HGNC:15850])

HSP 1 Score: 282.722 bits (722), Expect = 1.679e-86
Identity = 160/382 (41.88%), Postives = 235/382 (61.52%), Query Frame = 1
Query:  154 LERIKQARKKRITQLKNWYQYDKIMEKQKIRVGKPQKSNFLVKRVHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCEDPEINRKLHQIKQELERNYELKKSLQVRPNLSVLGXXXXXXXXXXXXPEDNTVPPGHLIVGSLRRTAS-------IRRSSMREKSLMSRNEARKEAMI 1278
            LER++ A+K+R  QLK W QY++ ++ +K +  + + +    K+V F  S+ LLEA+ R D +EV+  L    SPD+CNEDGLTALHQCCIDN   I +LLL  GANVNA D+E+WTPLHAAA C HI +   L+ YGA+LLA+N++GNMPYD+CE+E TLD+IE  MA +GI+Q++I+E R  PE +M+ D+  +     +L  ID+QGA+ LHIA + GYL     L++HGV +D+ D +GW+P+H AA WGQ++  E L+SHG ++ A T   E   DLCE+ E    L ++K   + +  +K  L+ + +LS                               RRT+S       +RR+S+ +++ + R E   EA++
Sbjct:   20 LERLRAAQKRRAQQLKKWAQYEQDLQHRKRKHERKRSTGGRRKKVSFEASVALLEASLRNDAEEVRYFLKNKVSPDLCNEDGLTALHQCCIDNFEEIVKLLLSHGANVNAKDNELWTPLHAAATCGHINLVKILVQYGADLLAVNSDGNMPYDLCEDEPTLDVIETCMAYQGITQEKINEMRVAPEQQMIADIHCMIAAGQDLDWIDAQGATLLHIAGANGYLRAAELLLDHGVRVDVKDWDGWEPLHAAAFWGQMQMAELLVSHGASLSARTSMDEMPIDLCEEEEFKVLLLELKH--KHDVIMKSQLRHKSSLS-------------------------------RRTSSAGSRGKVVRRASLSDRTNLYRKEYEGEAIL 368          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Human
Match: PPP1R16A (protein phosphatase 1 regulatory subunit 16A [Source:HGNC Symbol;Acc:HGNC:14941])

HSP 1 Score: 274.248 bits (700), Expect = 8.524e-84
Identity = 146/306 (47.71%), Postives = 203/306 (66.34%), Query Frame = 1
Query:  139 SRASDLERIKQARKKRITQLKNWYQYDKIMEKQKIRVGKPQK---SNFLVKRVHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCEDPEINRKLHQIKQE 1047
             R S  ER+K A+K+R  Q+K W Q +K  + +K    +P+K   S  L+K+V FP S+VLLEAA R D++EV++ L  G SPD+ NEDGLTALHQCCID+   + Q LL+ GAN+NA DSE WTPLHAAA C H+ +   LI  GANLLA+N +GNMPYD+C++E TLD +E AMA RGI+QD I+  R  PEL ML D++       +L      GA+ LH+AA+ G+ E    L+EH   +   D++GW+P+H AA WGQ+  +E L++HG +++A +   ET  D+C D E+  KL ++K +
Sbjct:   15 GRMSTQERLKHAQKRRAQQVKMWAQAEKEAQGKKGPGERPRKEAASQGLLKQVLFPPSVVLLEAAARNDLEEVRQFLGSGVSPDLANEDGLTALHQCCIDDFREMVQQLLEAGANINACDSECWTPLHAAATCGHLHLVELLIASGANLLAVNTDGNMPYDLCDDEQTLDCLETAMADRGITQDSIEAARAVPELRMLDDIRSRLQAGADLHAPLDHGATLLHVAAANGFSEAAALLLEHRASLSAKDQDGWEPLHAAAYWGQVPLVELLVAHGADLNAKSLMDETPLDVCGDEEVRAKLLELKHK 320          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Human
Match: PPP1R16A (protein phosphatase 1 regulatory subunit 16A [Source:HGNC Symbol;Acc:HGNC:14941])

HSP 1 Score: 274.248 bits (700), Expect = 8.524e-84
Identity = 146/306 (47.71%), Postives = 203/306 (66.34%), Query Frame = 1
Query:  139 SRASDLERIKQARKKRITQLKNWYQYDKIMEKQKIRVGKPQK---SNFLVKRVHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCEDPEINRKLHQIKQE 1047
             R S  ER+K A+K+R  Q+K W Q +K  + +K    +P+K   S  L+K+V FP S+VLLEAA R D++EV++ L  G SPD+ NEDGLTALHQCCID+   + Q LL+ GAN+NA DSE WTPLHAAA C H+ +   LI  GANLLA+N +GNMPYD+C++E TLD +E AMA RGI+QD I+  R  PEL ML D++       +L      GA+ LH+AA+ G+ E    L+EH   +   D++GW+P+H AA WGQ+  +E L++HG +++A +   ET  D+C D E+  KL ++K +
Sbjct:   15 GRMSTQERLKHAQKRRAQQVKMWAQAEKEAQGKKGPGERPRKEAASQGLLKQVLFPPSVVLLEAAARNDLEEVRQFLGSGVSPDLANEDGLTALHQCCIDDFREMVQQLLEAGANINACDSECWTPLHAAATCGHLHLVELLIASGANLLAVNTDGNMPYDLCDDEQTLDCLETAMADRGITQDSIEAARAVPELRMLDDIRSRLQAGADLHAPLDHGATLLHVAAANGFSEAAALLLEHRASLSAKDQDGWEPLHAAAYWGQVPLVELLVAHGADLNAKSLMDETPLDVCGDEEVRAKLLELKHK 320          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Human
Match: PPP1R16B (protein phosphatase 1 regulatory subunit 16B [Source:HGNC Symbol;Acc:HGNC:15850])

HSP 1 Score: 208.379 bits (529), Expect = 4.358e-59
Identity = 124/298 (41.61%), Postives = 176/298 (59.06%), Query Frame = 1
Query:  154 LERIKQARKKRITQLKNWYQYDKIMEKQKIRVGKPQKSNFLVKRVHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCEDPEINRKLHQIKQE 1047
            LER++ A+K+R  QLK W QY++ ++ +K +  + + +    K+V F  S+ LLEA+ R D +EV+  L    SPD+CNEDGLTALHQCCIDN   I +LLL  GANVNA D+E+WTPLHAAA C HI +   L+ YGA+LLA+N++GNMPYD+CE+E TLD+IE  MA +GI+Q++I+E R  PE +M+ D+  +     +L  ID+QGA+ + +A                                          E L+SHG ++ A T   E   DLCE+ E    L ++K +
Sbjct:   20 LERLRAAQKRRAQQLKKWAQYEQDLQHRKRKHERKRSTGGRRKKVSFEASVALLEASLRNDAEEVRYFLKNKVSPDLCNEDGLTALHQCCIDNFEEIVKLLLSHGANVNAKDNELWTPLHAAATCGHINLVKILVQYGADLLAVNSDGNMPYDLCEDEPTLDVIETCMAYQGITQEKINEMRVAPEQQMIADIHCMIAAGQDLDWIDAQGATLMQMA------------------------------------------ELLVSHGASLSARTSMDEMPIDLCEEEEFKVLLLELKHK 275          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Human
Match: PPP1R12B (protein phosphatase 1 regulatory subunit 12B [Source:HGNC Symbol;Acc:HGNC:7619])

HSP 1 Score: 159.458 bits (402), Expect = 1.465e-42
Identity = 110/305 (36.07%), Postives = 172/305 (56.39%), Query Frame = 1
Query:  157 ERIKQARKKRITQLKNWYQYDKIMEKQKIR-VGKPQKSNFLVKRVHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKIDS--QGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCEDPEINR-KLHQIKQELERN 1059
            +R + AR +R  QL+ W       E  + R  G+   +     RV F    V L A    D DEV++LL  GA  +  N DGLTALHQ CID +L + + L++  ANVN  D+E WTPLHAAA+C ++ I    I++GA++  +N+EG +P D+ EE    DL+   +  +G+   ++++ RKE E +ML+D ++  L +G +  +     GA+ LH+AA+ GY EV R LI+ G  +++ D +GW P+H AA WG  E    L     ++D     G+T +D+ ++  +   +L Q KQ + R+
Sbjct:   10 KRAESARMRRAEQLRRWRGSLTEQEPAERRGAGRQPLTRRGSPRVRFEDGAVFLAACSSGDTDEVRKLLARGADINTVNVDGLTALHQACIDENLDMVKFLVENRANVNQQDNEGWTPLHAAASCGYLNIAEYFINHGASVGIVNSEGEVPSDLAEEPAMKDLLLEQVKKQGV---DLEQSRKEEEQQMLQDARQW-LNSGKIEDVRQARSGATALHVAAAKGYSEVLRLLIQAGYELNVQDYDGWTPLHAAAHWGVKEACSILAEALCDMDIRNKLGQTPFDVADEGLVEHLELLQKKQNVLRS 310          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Celegans
Match: gfi-2 (GEI-4 (Four) Interacting protein [Source:UniProtKB/TrEMBL;Acc:Q95ZS1])

HSP 1 Score: 234.958 bits (598), Expect = 6.861e-70
Identity = 135/261 (51.72%), Postives = 171/261 (65.52%), Query Frame = 1
Query:  286 VHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCEDPEINRKLHQIKQELERNYEL 1068
            +HF   + LLEA  R D  EV+RLL + A+P++ N+DGLT LHQC ID++  I  LLL+ GANVNA D+E WTPLHAAA CAHI I   LI  GANLLA+NAEGNMPYDIC+ E TLD+IE+ MAARGI+Q  IDE R  PE  ML D++ L  +   L      G++YLH+A++ GY +V  FL+   V   I D + WQP+H AACW Q + IE L  +G +I A T +GET  DLCED    + + Q+ Q   R   L
Sbjct:   53 LHFAAEVELLEATCRADYAEVERLLNDNANPNLHNDDGLTPLHQCAIDDNQQIMLLLLERGANVNAQDTEQWTPLHAAACCAHINIVKILIQAGANLLAVNAEGNMPYDICDHEETLDVIESEMAARGITQSYIDEMRGAPEKAMLDDMKMLHQQGRELDARAPDGSTYLHVASANGYYDVAAFLLTCSVSPLIRDNDFWQPVHAAACWAQPDLIELLCQYGGDIHAKTKNGETPMDLCEDMSTKQVISQLVQTEARRRRL 313          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Celegans
Match: gfi-2 (GEI-4 (Four) Interacting protein [Source:UniProtKB/TrEMBL;Acc:Q95ZS1])

HSP 1 Score: 234.958 bits (598), Expect = 6.861e-70
Identity = 135/261 (51.72%), Postives = 171/261 (65.52%), Query Frame = 1
Query:  286 VHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCEDPEINRKLHQIKQELERNYEL 1068
            +HF   + LLEA  R D  EV+RLL + A+P++ N+DGLT LHQC ID++  I  LLL+ GANVNA D+E WTPLHAAA CAHI I   LI  GANLLA+NAEGNMPYDIC+ E TLD+IE+ MAARGI+Q  IDE R  PE  ML D++ L  +   L      G++YLH+A++ GY +V  FL+   V   I D + WQP+H AACW Q + IE L  +G +I A T +GET  DLCED    + + Q+ Q   R   L
Sbjct:   53 LHFAAEVELLEATCRADYAEVERLLNDNANPNLHNDDGLTPLHQCAIDDNQQIMLLLLERGANVNAQDTEQWTPLHAAACCAHINIVKILIQAGANLLAVNAEGNMPYDICDHEETLDVIESEMAARGITQSYIDEMRGAPEKAMLDDMKMLHQQGRELDARAPDGSTYLHVASANGYYDVAAFLLTCSVSPLIRDNDFWQPVHAAACWAQPDLIELLCQYGGDIHAKTKNGETPMDLCEDMSTKQVISQLVQTEARRRRL 313          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Celegans
Match: gfi-2 (GEI-4 (Four) Interacting protein [Source:UniProtKB/TrEMBL;Acc:Q95ZS1])

HSP 1 Score: 234.958 bits (598), Expect = 6.861e-70
Identity = 135/261 (51.72%), Postives = 171/261 (65.52%), Query Frame = 1
Query:  286 VHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCEDPEINRKLHQIKQELERNYEL 1068
            +HF   + LLEA  R D  EV+RLL + A+P++ N+DGLT LHQC ID++  I  LLL+ GANVNA D+E WTPLHAAA CAHI I   LI  GANLLA+NAEGNMPYDIC+ E TLD+IE+ MAARGI+Q  IDE R  PE  ML D++ L  +   L      G++YLH+A++ GY +V  FL+   V   I D + WQP+H AACW Q + IE L  +G +I A T +GET  DLCED    + + Q+ Q   R   L
Sbjct:   53 LHFAAEVELLEATCRADYAEVERLLNDNANPNLHNDDGLTPLHQCAIDDNQQIMLLLLERGANVNAQDTEQWTPLHAAACCAHINIVKILIQAGANLLAVNAEGNMPYDICDHEETLDVIESEMAARGITQSYIDEMRGAPEKAMLDDMKMLHQQGRELDARAPDGSTYLHVASANGYYDVAAFLLTCSVSPLIRDNDFWQPVHAAACWAQPDLIELLCQYGGDIHAKTKNGETPMDLCEDMSTKQVISQLVQTEARRRRL 313          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Celegans
Match: gfi-2 (GEI-4 (Four) Interacting protein [Source:UniProtKB/TrEMBL;Acc:Q95ZS1])

HSP 1 Score: 234.572 bits (597), Expect = 9.540e-70
Identity = 135/261 (51.72%), Postives = 171/261 (65.52%), Query Frame = 1
Query:  286 VHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCEDPEINRKLHQIKQELERNYEL 1068
            +HF   + LLEA  R D  EV+RLL + A+P++ N+DGLT LHQC ID++  I  LLL+ GANVNA D+E WTPLHAAA CAHI I   LI  GANLLA+NAEGNMPYDIC+ E TLD+IE+ MAARGI+Q  IDE R  PE  ML D++ L  +   L      G++YLH+A++ GY +V  FL+   V   I D + WQP+H AACW Q + IE L  +G +I A T +GET  DLCED    + + Q+ Q   R   L
Sbjct:   53 LHFAAEVELLEATCRADYAEVERLLNDNANPNLHNDDGLTPLHQCAIDDNQQIMLLLLERGANVNAQDTEQWTPLHAAACCAHINIVKILIQAGANLLAVNAEGNMPYDICDHEETLDVIESEMAARGITQSYIDEMRGAPEKAMLDDMKMLHQQGRELDARAPDGSTYLHVASANGYYDVAAFLLTCSVSPLIRDNDFWQPVHAAACWAQPDLIELLCQYGGDIHAKTKNGETPMDLCEDMSTKQVISQLVQTEARRRRL 313          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Celegans
Match: gfi-2 (GEI-4 (Four) Interacting protein [Source:UniProtKB/TrEMBL;Acc:Q95ZS1])

HSP 1 Score: 234.572 bits (597), Expect = 9.540e-70
Identity = 135/261 (51.72%), Postives = 171/261 (65.52%), Query Frame = 1
Query:  286 VHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCEDPEINRKLHQIKQELERNYEL 1068
            +HF   + LLEA  R D  EV+RLL + A+P++ N+DGLT LHQC ID++  I  LLL+ GANVNA D+E WTPLHAAA CAHI I   LI  GANLLA+NAEGNMPYDIC+ E TLD+IE+ MAARGI+Q  IDE R  PE  ML D++ L  +   L      G++YLH+A++ GY +V  FL+   V   I D + WQP+H AACW Q + IE L  +G +I A T +GET  DLCED    + + Q+ Q   R   L
Sbjct:   53 LHFAAEVELLEATCRADYAEVERLLNDNANPNLHNDDGLTPLHQCAIDDNQQIMLLLLERGANVNAQDTEQWTPLHAAACCAHINIVKILIQAGANLLAVNAEGNMPYDICDHEETLDVIESEMAARGITQSYIDEMRGAPEKAMLDDMKMLHQQGRELDARAPDGSTYLHVASANGYYDVAAFLLTCSVSPLIRDNDFWQPVHAAACWAQPDLIELLCQYGGDIHAKTKNGETPMDLCEDMSTKQVISQLVQTEARRRRL 313          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Fly
Match: MYPT-75D (gene:FBgn0036801 transcript:FBtr0331420)

HSP 1 Score: 267.314 bits (682), Expect = 2.698e-80
Identity = 153/334 (45.81%), Postives = 210/334 (62.87%), Query Frame = 1
Query:  280 KRVHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCEDPEINRKLHQIKQELERNYELKKSLQVRPNLSVLGXXXXXXXXXXXXPEDNTVPPGHLIVGSLRRTASIRRSSMREKSLMSRNEARKEAMIR 1281
            + + F  S+VLLEAA R D+ EV  LL  G +PD  NEDGLTA+HQ CIDN++ + QLLL++GANV+A DS+ WTPLHAAA C H+E+   LI +GANLLA+N +GNMPYD+C++E TLD IE  MA RG++Q+ IDE R   E  MLRDL EL    G+L + D Q A+ LHIAA+ GY+ V  FL+E  V +D +DK+ W P+H AACWG LE +E L   G +++      ET  D+CEDPEI  ++ Q+K E E +  L ++ + R   S                 +NT            R  S+RR+S+R+K+L ++ +A +E  +R
Sbjct:  113 RHISFENSVVLLEAASRNDMPEVAALLQHGITPDAANEDGLTAMHQACIDNNVEMLQLLLEYGANVDAQDSDKWTPLHAAATCGHLELVRILIRHGANLLAVNTDGNMPYDLCDDEKTLDFIEGEMAQRGVTQELIDETRSSTERIMLRDLMELARTGGDLEEPDYQCATPLHIAAANGYVRVVEFLLEQHVNVDAMDKDLWTPVHAAACWGHLEVLEMLAQCGADLNVRNKDDETPSDICEDPEIRERIEQLKTEQE-SKRLAEAQRRRVRRS---------------QSNNT------------RAQSVRRTSLRDKTLTTKKDAVEETRLR 418          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Fly
Match: MYPT-75D (gene:FBgn0036801 transcript:FBtr0075049)

HSP 1 Score: 268.47 bits (685), Expect = 9.542e-80
Identity = 153/334 (45.81%), Postives = 210/334 (62.87%), Query Frame = 1
Query:  280 KRVHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCEDPEINRKLHQIKQELERNYELKKSLQVRPNLSVLGXXXXXXXXXXXXPEDNTVPPGHLIVGSLRRTASIRRSSMREKSLMSRNEARKEAMIR 1281
            + + F  S+VLLEAA R D+ EV  LL  G +PD  NEDGLTA+HQ CIDN++ + QLLL++GANV+A DS+ WTPLHAAA C H+E+   LI +GANLLA+N +GNMPYD+C++E TLD IE  MA RG++Q+ IDE R   E  MLRDL EL    G+L + D Q A+ LHIAA+ GY+ V  FL+E  V +D +DK+ W P+H AACWG LE +E L   G +++      ET  D+CEDPEI  ++ Q+K E E +  L ++ + R   S                 +NT            R  S+RR+S+R+K+L ++ +A +E  +R
Sbjct:  113 RHISFENSVVLLEAASRNDMPEVAALLQHGITPDAANEDGLTAMHQACIDNNVEMLQLLLEYGANVDAQDSDKWTPLHAAATCGHLELVRILIRHGANLLAVNTDGNMPYDLCDDEKTLDFIEGEMAQRGVTQELIDETRSSTERIMLRDLMELARTGGDLEEPDYQCATPLHIAAANGYVRVVEFLLEQHVNVDAMDKDLWTPVHAAACWGHLEVLEMLAQCGADLNVRNKDDETPSDICEDPEIRERIEQLKTEQE-SKRLAEAQRRRVRRS---------------QSNNT------------RAQSVRRTSLRDKTLTTKKDAVEETRLR 418          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Fly
Match: MYPT-75D (gene:FBgn0036801 transcript:FBtr0331422)

HSP 1 Score: 268.47 bits (685), Expect = 9.542e-80
Identity = 153/334 (45.81%), Postives = 210/334 (62.87%), Query Frame = 1
Query:  280 KRVHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCEDPEINRKLHQIKQELERNYELKKSLQVRPNLSVLGXXXXXXXXXXXXPEDNTVPPGHLIVGSLRRTASIRRSSMREKSLMSRNEARKEAMIR 1281
            + + F  S+VLLEAA R D+ EV  LL  G +PD  NEDGLTA+HQ CIDN++ + QLLL++GANV+A DS+ WTPLHAAA C H+E+   LI +GANLLA+N +GNMPYD+C++E TLD IE  MA RG++Q+ IDE R   E  MLRDL EL    G+L + D Q A+ LHIAA+ GY+ V  FL+E  V +D +DK+ W P+H AACWG LE +E L   G +++      ET  D+CEDPEI  ++ Q+K E E +  L ++ + R   S                 +NT            R  S+RR+S+R+K+L ++ +A +E  +R
Sbjct:  113 RHISFENSVVLLEAASRNDMPEVAALLQHGITPDAANEDGLTAMHQACIDNNVEMLQLLLEYGANVDAQDSDKWTPLHAAATCGHLELVRILIRHGANLLAVNTDGNMPYDLCDDEKTLDFIEGEMAQRGVTQELIDETRSSTERIMLRDLMELARTGGDLEEPDYQCATPLHIAAANGYVRVVEFLLEQHVNVDAMDKDLWTPVHAAACWGHLEVLEMLAQCGADLNVRNKDDETPSDICEDPEIRERIEQLKTEQE-SKRLAEAQRRRVRRS---------------QSNNT------------RAQSVRRTSLRDKTLTTKKDAVEETRLR 418          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Fly
Match: MYPT-75D (gene:FBgn0036801 transcript:FBtr0331421)

HSP 1 Score: 268.47 bits (685), Expect = 9.542e-80
Identity = 153/334 (45.81%), Postives = 210/334 (62.87%), Query Frame = 1
Query:  280 KRVHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCEDPEINRKLHQIKQELERNYELKKSLQVRPNLSVLGXXXXXXXXXXXXPEDNTVPPGHLIVGSLRRTASIRRSSMREKSLMSRNEARKEAMIR 1281
            + + F  S+VLLEAA R D+ EV  LL  G +PD  NEDGLTA+HQ CIDN++ + QLLL++GANV+A DS+ WTPLHAAA C H+E+   LI +GANLLA+N +GNMPYD+C++E TLD IE  MA RG++Q+ IDE R   E  MLRDL EL    G+L + D Q A+ LHIAA+ GY+ V  FL+E  V +D +DK+ W P+H AACWG LE +E L   G +++      ET  D+CEDPEI  ++ Q+K E E +  L ++ + R   S                 +NT            R  S+RR+S+R+K+L ++ +A +E  +R
Sbjct:  113 RHISFENSVVLLEAASRNDMPEVAALLQHGITPDAANEDGLTAMHQACIDNNVEMLQLLLEYGANVDAQDSDKWTPLHAAATCGHLELVRILIRHGANLLAVNTDGNMPYDLCDDEKTLDFIEGEMAQRGVTQELIDETRSSTERIMLRDLMELARTGGDLEEPDYQCATPLHIAAANGYVRVVEFLLEQHVNVDAMDKDLWTPVHAAACWGHLEVLEMLAQCGADLNVRNKDDETPSDICEDPEIRERIEQLKTEQE-SKRLAEAQRRRVRRS---------------QSNNT------------RAQSVRRTSLRDKTLTTKKDAVEETRLR 418          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Fly
Match: Mbs (gene:FBgn0005536 transcript:FBtr0308216)

HSP 1 Score: 151.754 bits (382), Expect = 1.753e-40
Identity = 109/319 (34.17%), Postives = 169/319 (52.98%), Query Frame = 1
Query:  160 RIKQARKKRITQLKNWYQYDKIMEKQKIRVGKPQKSNFLVKRVHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDIC---EEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKID----SQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCEDPEINRKLHQIKQELERNYELKK--SLQVR 1089
            R   A  KR  QLK W + D            P   +   +R+ F    V L A    D DEV +LL +GA  +  N DGLTALHQ CID++L + + L++ GA++N  D+E WTPLHA A+C  + I   L++ GA++ A+N++G++  D+    +    +D +E  +    I+   +DE RK  EL ML D +  K    + A++D      GA+ LH+AA+ GY +V   L+     +D  D +GW P+H A+ WGQ E  E L+    ++D   Y+G++  D+ +     RK+ +  +EL  N   K+  S Q+R
Sbjct:    7 RNNSAMMKRAEQLKRWEESD-------TNRAAPTPRHEHGRRIKFSSGCVFLAACLSGDKDEVVQLLDQGADINTANVDGLTALHQACIDDNLDMVEFLVERGADINRQDNEGWTPLHATASCGFVSIARYLVENGADVAAVNSDGDLALDLAIDVQHMAMIDYMEKMVQELNIN---VDEARKAEELAMLNDAK--KWLRSDAAEVDRPHPKTGATALHVAAAKGYTKVLGLLLAGRGNVDRQDNDGWTPLHAASHWGQRETAEMLVESLADMDIRNYAGQSCIDVAD-----RKIVKFLEELRANKRNKRRPSSQIR 308          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Zebrafish
Match: ppp1r16a (protein phosphatase 1, regulatory subunit 16A [Source:ZFIN;Acc:ZDB-GENE-121214-252])

HSP 1 Score: 288.5 bits (737), Expect = 5.224e-89
Identity = 171/391 (43.73%), Postives = 237/391 (60.61%), Query Frame = 1
Query:  127 FANRSRASDLERIKQARKKRITQLKNWYQYDKIMEKQKIRVGKPQKSNFLVK---RVHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCEDPEINRKLHQIKQE----LERNYELKKSLQVRPNLSVLGXXXXXXXXXXXXPEDNTVPPGHLIVGSLRRTASIRRSSMREKSLMSRNEARKEAMI 1278
             A+  R S  ER+KQA+K+R  QLK W Q    MEK   R  K       VK   RV F  +++LLEAA R DI+EV++LL  G SPD+ NEDGLTALHQ CID+ L + + LL  GANVNA DSE+WTPLHAAA C H ++   LI+ GA+LLA+NA+GNMPYD+CE+E TL+LIE  MA +GI+Q++IDE R   E  ML DL+E+     +L   D QGA+ LH+AA+ GY+ VG  L+EH +  D  D +GW P+H AACWGQ++ +E L++HG +++A +   ET  D+C D E+  K+ ++K +    ++   + K +LQ R                              +  +  R   +RRSS+ E+S + R E +KEA +
Sbjct:   11 MASIGRLSATERLKQAQKRRAQQLKGWAQ----MEKDSARGHKADHKGDGVKKSRRVTFNSNVMLLEAAARNDIEEVRQLLNNGVSPDLFNEDGLTALHQSCIDDFLEVARCLLDAGANVNACDSELWTPLHAAATCGHTDLVQMLIEAGADLLAVNADGNMPYDLCEDEATLELIEMIMAEQGITQEKIDECRGAKERVMLTDLREMVTNGADLNVKDEQGATMLHVAAANGYMSVGELLLEHRLSPDERDADGWTPLHAAACWGQIQMVELLVAHGASLNAKSELDETPLDVCTDEEVRAKMMELKHKHDAIMKGQDKHKNTLQRR------------------------------VSSTGSRGKVVRRSSVNERSSLYRREHQKEAKV 367          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Zebrafish
Match: ppp1r16a (protein phosphatase 1, regulatory subunit 16A [Source:ZFIN;Acc:ZDB-GENE-121214-252])

HSP 1 Score: 288.5 bits (737), Expect = 5.224e-89
Identity = 171/391 (43.73%), Postives = 237/391 (60.61%), Query Frame = 1
Query:  127 FANRSRASDLERIKQARKKRITQLKNWYQYDKIMEKQKIRVGKPQKSNFLVK---RVHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCEDPEINRKLHQIKQE----LERNYELKKSLQVRPNLSVLGXXXXXXXXXXXXPEDNTVPPGHLIVGSLRRTASIRRSSMREKSLMSRNEARKEAMI 1278
             A+  R S  ER+KQA+K+R  QLK W Q    MEK   R  K       VK   RV F  +++LLEAA R DI+EV++LL  G SPD+ NEDGLTALHQ CID+ L + + LL  GANVNA DSE+WTPLHAAA C H ++   LI+ GA+LLA+NA+GNMPYD+CE+E TL+LIE  MA +GI+Q++IDE R   E  ML DL+E+     +L   D QGA+ LH+AA+ GY+ VG  L+EH +  D  D +GW P+H AACWGQ++ +E L++HG +++A +   ET  D+C D E+  K+ ++K +    ++   + K +LQ R                              +  +  R   +RRSS+ E+S + R E +KEA +
Sbjct:   11 MASIGRLSATERLKQAQKRRAQQLKGWAQ----MEKDSARGHKADHKGDGVKKSRRVTFNSNVMLLEAAARNDIEEVRQLLNNGVSPDLFNEDGLTALHQSCIDDFLEVARCLLDAGANVNACDSELWTPLHAAATCGHTDLVQMLIEAGADLLAVNADGNMPYDLCEDEATLELIEMIMAEQGITQEKIDECRGAKERVMLTDLREMVTNGADLNVKDEQGATMLHVAAANGYMSVGELLLEHRLSPDERDADGWTPLHAAACWGQIQMVELLVAHGASLNAKSELDETPLDVCTDEEVRAKMMELKHKHDAIMKGQDKHKNTLQRR------------------------------VSSTGSRGKVVRRSSVNERSSLYRREHQKEAKV 367          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Zebrafish
Match: ppp1r16a (protein phosphatase 1, regulatory subunit 16A [Source:ZFIN;Acc:ZDB-GENE-121214-252])

HSP 1 Score: 288.5 bits (737), Expect = 5.224e-89
Identity = 171/391 (43.73%), Postives = 237/391 (60.61%), Query Frame = 1
Query:  127 FANRSRASDLERIKQARKKRITQLKNWYQYDKIMEKQKIRVGKPQKSNFLVK---RVHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCEDPEINRKLHQIKQE----LERNYELKKSLQVRPNLSVLGXXXXXXXXXXXXPEDNTVPPGHLIVGSLRRTASIRRSSMREKSLMSRNEARKEAMI 1278
             A+  R S  ER+KQA+K+R  QLK W Q    MEK   R  K       VK   RV F  +++LLEAA R DI+EV++LL  G SPD+ NEDGLTALHQ CID+ L + + LL  GANVNA DSE+WTPLHAAA C H ++   LI+ GA+LLA+NA+GNMPYD+CE+E TL+LIE  MA +GI+Q++IDE R   E  ML DL+E+     +L   D QGA+ LH+AA+ GY+ VG  L+EH +  D  D +GW P+H AACWGQ++ +E L++HG +++A +   ET  D+C D E+  K+ ++K +    ++   + K +LQ R                              +  +  R   +RRSS+ E+S + R E +KEA +
Sbjct:   11 MASIGRLSATERLKQAQKRRAQQLKGWAQ----MEKDSARGHKADHKGDGVKKSRRVTFNSNVMLLEAAARNDIEEVRQLLNNGVSPDLFNEDGLTALHQSCIDDFLEVARCLLDAGANVNACDSELWTPLHAAATCGHTDLVQMLIEAGADLLAVNADGNMPYDLCEDEATLELIEMIMAEQGITQEKIDECRGAKERVMLTDLREMVTNGADLNVKDEQGATMLHVAAANGYMSVGELLLEHRLSPDERDADGWTPLHAAACWGQIQMVELLVAHGASLNAKSELDETPLDVCTDEEVRAKMMELKHKHDAIMKGQDKHKNTLQRR------------------------------VSSTGSRGKVVRRSSVNERSSLYRREHQKEAKV 367          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Zebrafish
Match: ppp1r16b (protein phosphatase 1, regulatory subunit 16B [Source:ZFIN;Acc:ZDB-GENE-131127-294])

HSP 1 Score: 197.208 bits (500), Expect = 4.339e-56
Identity = 118/304 (38.82%), Postives = 177/304 (58.22%), Query Frame = 1
Query:  394 DGLTALHQCCID--NSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCEDPEINRKLHQIKQELERNYELKKSLQVRPNLSVLGXXXXXXXXXXXXPEDNTVPPGHLIVGSLRRTAS-------IRRSSMREKSLMSRNEARKEAMI 1278
            D  ++LH+C +D  N+     +LL  GA VNA D+E+WTPLHAAA C H  +   LI +GA+LLA+N++GNMPYD+CE++ TLD+IE AMA RGI+Q+ I+E R   E  ML D+Q++     ++   DSQGA+ LHIA++ GY +    L++ G   D+ D +GW P+H AACWGQ++  E L+SHG +++A TY  ET  DLCED E    L ++K   + +  +K  L+ + +L                                RRT+S       +RR+S+ ++  + R E + EA++
Sbjct:    5 DRCSSLHRCILDIKNTSGKFHILLTHGATVNAQDNELWTPLHAAATCGHTGLVKILIQHGADLLAVNSDGNMPYDLCEDDPTLDIIETAMANRGITQEMINETRAAVERSMLGDIQKILQEGADVNHHDSQGATLLHIASANGYTQAAELLLDAGARSDMRDSDGWTPLHAAACWGQVQVAELLVSHGASLNAKTYMEETPIDLCEDEEFRNHLLELKH--KHDIIMKSQLKHKTSL-------------------------------CRRTSSAGSRGKVVRRASLSDRHNLCRKEYQTEAIV 275          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Zebrafish
Match: ppp1r16b (protein phosphatase 1, regulatory subunit 16B [Source:ZFIN;Acc:ZDB-GENE-131127-294])

HSP 1 Score: 168.703 bits (426), Expect = 3.655e-46
Identity = 91/245 (37.14%), Postives = 140/245 (57.14%), Query Frame = 1
Query:  565 GANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCEDPEINRKLHQIKQELERNYELKKSLQVRPNLSVLGXXXXXXXXXXXXPEDNTVPPGHLIVGSLRRTAS-------IRRSSMREKSLMSRNEARKEAMI 1278
            GA+LLA+N++GNMPYD+CE++ TLD+IE AMA RGI+Q+ I+E R   E  ML D+Q++     ++   DSQGA+ LHIA++ GY +    L++ G   D+ D +GW P+H AACWGQ++  E L+SHG +++A TY  ET  DLCED E    L ++K   + +  +K  L+ + +L                                RRT+S       +RR+S+ ++  + R E + EA++
Sbjct:    2 GADLLAVNSDGNMPYDLCEDDPTLDIIETAMANRGITQEMINETRAAVERSMLGDIQKILQEGADVNHHDSQGATLLHIASANGYTQAAELLLDAGARSDMRDSDGWTPLHAAACWGQVQVAELLVSHGASLNAKTYMEETPIDLCEDEEFRNHLLELKH--KHDIIMKSQLKHKTSL-------------------------------CRRTSSAGSRGKVVRRASLSDRHNLCRKEYQTEAIV 213          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Xenopus
Match: nop14 (NOP14 nucleolar protein [Source:Xenbase;Acc:XB-GENE-992782])

HSP 1 Score: 253.447 bits (646), Expect = 1.074e-75
Identity = 137/283 (48.41%), Postives = 197/283 (69.61%), Query Frame = 1
Query:  139 SRASDLERIKQARKKRITQLKNWYQYDKIMEKQKIRVGKPQKSNFLVKRVHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGET 987
            SR +  ER+K A+K+R  QLK W Q++K  + +K +  + ++ +   +RV FPQ++ LLEAA R DI+EV+ LL  G SP++ NEDGLTALHQCCID+   I ++L+  GA+VNA DSE+WTPLHAAA C H+ +   LI +GANLLA+N++GNMPYD+CE++ TLD IE AMA +GI+Q++I+E R   E  ML D+Q L    G +   +  G S LHIAA+ GYL     L+EH   ++  D++GW+P+H AACWGQ+  +E L++HG ++++ +   ET
Sbjct:   15 SRMTTQERLKHAQKRRAQQLKKWAQFEKDGQGKKAKGRQKKQGSKEERRVMFPQNVTLLEAAARNDIEEVRHLLQNGFSPNLYNEDGLTALHQCCIDDYEEIVRMLIGAGADVNACDSELWTPLHAAATCGHLHLVELLIKHGANLLAVNSDGNMPYDLCEDDVTLDHIETAMAEQGITQEKIEECRGATEQHMLEDIQHLVETGGEVNAHNPHGTSLLHIAAANGYLAAAELLLEHKAQVNARDQDGWEPLHAAACWGQIHVVELLVAHGADLNSKSQLDET 297          

HSP 2 Score: 68.9366 bits (167), Expect = 1.255e-11
Identity = 41/99 (41.41%), Postives = 53/99 (53.54%), Query Frame = 1
Query:  727 DLQELK--LRNG---NLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCED 1008
            D++E++  L+NG   NL   D  G + LH      Y E+ R LI  G  ++  D E W P+H AA  G L  +E LI HG N+ AV   G   YDLCED
Sbjct:   80 DIEEVRHLLQNGFSPNLYNED--GLTALHQCCIDDYEEIVRMLIGAGADVNACDSELWTPLHAAATCGHLHLVELLIKHGANLLAVNSDGNMPYDLCED 176          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Xenopus
Match: ppp1r16b (protein phosphatase 1 regulatory subunit 16B [Source:NCBI gene;Acc:100170500])

HSP 1 Score: 244.588 bits (623), Expect = 2.118e-72
Identity = 140/289 (48.44%), Postives = 190/289 (65.74%), Query Frame = 1
Query:  142 RASDLERIKQARKKRITQLKNWYQYDKIMEKQKIRVGKPQKSNFLV--KRVHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLC 1002
            +AS LER++ A+K+R  QLK W Q +K  E ++ R  K  +    +  KRV FP  + L EA  R D +EV  LL     PD+ NEDGLTALHQCCIDN   + +LLL   ANVN  D+E+WTPLHAAA C H  +   LI +GA+LLA+NA+GNM YD+CE+E TLD+IE+ +  RGI+Q+ I+E R+ PE  ML D++ L     +L + D+QGA+ LHIAAS G+ EV   L+E+G  +++ D + W+P+H AA WGQ+   E L+SHG ++ A T   ET  DLC
Sbjct:   12 KASTLERLRAAKKRREQQLKRWTQREKEEENRRRRQQKVNRKTPTIRSKRVSFPPRVTLHEACLRNDPEEVLSLLKNNVDPDLSNEDGLTALHQCCIDNYEDLLKLLLSHCANVNVTDNELWTPLHAAATCGHTNLVRILIQHGADLLAVNADGNMAYDLCEDEATLDVIESCLTYRGITQEMINEARQAPERHMLNDIRALVAIGHDLNRTDNQGATLLHIAASRGFAEVAEMLLENGGRVEVKDPDVWEPLHAAAFWGQIYVAEVLVSHGASLSAKTALDETPLDLC 300          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Xenopus
Match: PPP1R12A (protein phosphatase 1 regulatory subunit 12A [Source:NCBI gene;Acc:100493563])

HSP 1 Score: 157.532 bits (397), Expect = 1.269e-39
Identity = 106/285 (37.19%), Postives = 164/285 (57.54%), Query Frame = 1
Query:  160 RIKQARKKRITQLKNWYQYDKIMEKQKIRVGKPQKSNFLVKRVHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKI--DSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCED 1008
            ++  A++KR  QLK W   +  +E   I+  K         +V F    V L A    D DEV +LL  GA  +  N DGLTALHQ CID+++ + + L++ GA +N  D+E W PLHAA++C +++I   LI  GA++  +N+EG+ P DI EEE   DL++N +    +   E +  RKE E  MLRD ++  L +G +  I     G + LH+AA+ GY EV + L++ G  +++ D +GW P+H AA WG+ E  + L+ +  NI+AV   G+T  D+ ++
Sbjct:    2 KMADAKQKRNEQLKRWIGSETDLEPHVIKRKKT--------KVKFDDGAVFLAACSSGDTDEVLKLLDRGADINYANVDGLTALHQACIDDNIDMVKFLVEHGAGINQPDNEGWIPLHAASSCGYLDIAEYLISKGASVGVVNSEGDTPLDIAEEEAMEDLLQNEVDT-PLDIAEEEAARKEEERIMLRDARQW-LNSGQINDIRHSKSGGTALHVAAAKGYTEVLKLLLQAGYDVNVKDFDGWTPLHAAAHWGKEEACKILVENFCNIEAVNKVGQTALDVADE 276          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Xenopus
Match: PPP1R12A (protein phosphatase 1 regulatory subunit 12A [Source:NCBI gene;Acc:100493563])

HSP 1 Score: 157.147 bits (396), Expect = 1.574e-39
Identity = 106/285 (37.19%), Postives = 164/285 (57.54%), Query Frame = 1
Query:  160 RIKQARKKRITQLKNWYQYDKIMEKQKIRVGKPQKSNFLVKRVHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKI--DSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCED 1008
            ++  A++KR  QLK W   +  +E   I+  K         +V F    V L A    D DEV +LL  GA  +  N DGLTALHQ CID+++ + + L++ GA +N  D+E W PLHAA++C +++I   LI  GA++  +N+EG+ P DI EEE   DL++N +    +   E +  RKE E  MLRD ++  L +G +  I     G + LH+AA+ GY EV + L++ G  +++ D +GW P+H AA WG+ E  + L+ +  NI+AV   G+T  D+ ++
Sbjct:    2 KMADAKQKRNEQLKRWIGSETDLEPHVIKRKKT--------KVKFDDGAVFLAACSSGDTDEVLKLLDRGADINYANVDGLTALHQACIDDNIDMVKFLVEHGAGINQPDNEGWIPLHAASSCGYLDIAEYLISKGASVGVVNSEGDTPLDIAEEEAMEDLLQNEVDT-PLDIAEEEAARKEEERIMLRDARQW-LNSGQINDIRHSKSGGTALHVAAAKGYTEVLKLLLQAGYDVNVKDFDGWTPLHAAAHWGKEEACKILVENFCNIEAVNKVGQTALDVADE 276          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Xenopus
Match: lcp1 (lymphocyte cytosolic protein 1 (L-plastin) [Source:Xenbase;Acc:XB-GENE-962206])

HSP 1 Score: 149.828 bits (377), Expect = 2.906e-37
Identity = 97/269 (36.06%), Postives = 155/269 (57.62%), Query Frame = 1
Query:  286 VHFPQSMVLLEAAGREDIDEVKRLLTEGASPDV---CNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKI--DSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCED------PEINRKLHQIKQELERN 1059
            V F +S   L A    D+ E + +LT  +  +V    N DG++ALHQ CID +L + + L+  GANVN AD+E WTPLH AA+C ++EI   L+ + AN+ A+N++G++P DI E++   +L+   +A  G+   +I+  ++E E  MLRD ++  L  G +  I     GAS LH+AA+ GY+EV R L++     +  DK+GW P+H AA WG  E    L+ H  +++A+   G+   D+ ++       E+ +K   ++ E E N
Sbjct:   69 VRFERSAEFLAACAAGDLLEAEDMLTRDSGKEVIDSTNTDGISALHQACIDENLEVVEFLVNHGANVNQADNEGWTPLHVAASCGYMEIAEYLLKHSANIAAVNSDGDVPLDIAEDDCMENLLRAEIAKGGV---DIEAAKREEEEVMLRDSRQW-LNAGKIEDIRHSKTGASALHVAAAKGYIEVMRLLLQANFDPNARDKDGWTPLHAAAHWGVEEACRLLVEHFCDMNALNSVGQRPCDVADEDVLSLLEELRKKQEDLRNEKEAN 333          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Mouse
Match: Ppp1r16b (protein phosphatase 1, regulatory subunit 16B [Source:MGI Symbol;Acc:MGI:2151841])

HSP 1 Score: 279.641 bits (714), Expect = 1.846e-85
Identity = 160/382 (41.88%), Postives = 232/382 (60.73%), Query Frame = 1
Query:  154 LERIKQARKKRITQLKNWYQYDKIMEKQKIRVGKPQKSNFLVKRVHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCEDPEINRKLHQIKQELERNYELKKSLQVRPNLSVLGXXXXXXXXXXXXPEDNTVPPGHLIVGSLRRTAS-------IRRSSMREKSLMSRNEARKEAMI 1278
            LER++ A+K+R  QLK W QY++ +  +K +  + + +    K+V F  S+ LLEA+ R D +EV+  L    SPD+CNEDGLTALHQCCIDN   I +LLL  GANVNA D+E+WTPLHAAA C HI +   L+ YGA+LLA+N++GNMPYD+CE+E TLD+IE  MA +GI+Q++I+E R  PE +M+ D+  +     +L  ID QGA+ LHIA + GYL     L++HGV +D+ D +GW+P+H AA WGQ+   E L+SHG ++ A T   E   DLCE+ E    L ++K   + +  +K  L+ + +LS                               RRT+S       +RR+S+ +++ + R E   EA++
Sbjct:   20 LERLRAAQKRRAQQLKKWAQYEQDLLHRKRKHERKRSTGGRRKKVSFEASVALLEASLRNDAEEVRYFLKNKVSPDLCNEDGLTALHQCCIDNFEEIVKLLLSHGANVNAKDNELWTPLHAAATCGHINLVKILVQYGADLLAVNSDGNMPYDLCEDEPTLDVIETCMAYQGITQEKINEMRAAPEQKMISDIHCMIAAGQDLDWIDGQGATLLHIAGANGYLRAAELLLDHGVRVDVKDWDGWEPLHAAAFWGQMPMAELLVSHGASLSARTSMDEMPIDLCEEEEFKVLLLELKH--KHDVIMKSQLRHKSSLS-------------------------------RRTSSAGSRGKVVRRASLSDRTNLYRKEYEGEAIL 368          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Mouse
Match: Ppp1r16b (protein phosphatase 1, regulatory subunit 16B [Source:MGI Symbol;Acc:MGI:2151841])

HSP 1 Score: 279.641 bits (714), Expect = 1.846e-85
Identity = 160/382 (41.88%), Postives = 232/382 (60.73%), Query Frame = 1
Query:  154 LERIKQARKKRITQLKNWYQYDKIMEKQKIRVGKPQKSNFLVKRVHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCEDPEINRKLHQIKQELERNYELKKSLQVRPNLSVLGXXXXXXXXXXXXPEDNTVPPGHLIVGSLRRTAS-------IRRSSMREKSLMSRNEARKEAMI 1278
            LER++ A+K+R  QLK W QY++ +  +K +  + + +    K+V F  S+ LLEA+ R D +EV+  L    SPD+CNEDGLTALHQCCIDN   I +LLL  GANVNA D+E+WTPLHAAA C HI +   L+ YGA+LLA+N++GNMPYD+CE+E TLD+IE  MA +GI+Q++I+E R  PE +M+ D+  +     +L  ID QGA+ LHIA + GYL     L++HGV +D+ D +GW+P+H AA WGQ+   E L+SHG ++ A T   E   DLCE+ E    L ++K   + +  +K  L+ + +LS                               RRT+S       +RR+S+ +++ + R E   EA++
Sbjct:   20 LERLRAAQKRRAQQLKKWAQYEQDLLHRKRKHERKRSTGGRRKKVSFEASVALLEASLRNDAEEVRYFLKNKVSPDLCNEDGLTALHQCCIDNFEEIVKLLLSHGANVNAKDNELWTPLHAAATCGHINLVKILVQYGADLLAVNSDGNMPYDLCEDEPTLDVIETCMAYQGITQEKINEMRAAPEQKMISDIHCMIAAGQDLDWIDGQGATLLHIAGANGYLRAAELLLDHGVRVDVKDWDGWEPLHAAAFWGQMPMAELLVSHGASLSARTSMDEMPIDLCEEEEFKVLLLELKH--KHDVIMKSQLRHKSSLS-------------------------------RRTSSAGSRGKVVRRASLSDRTNLYRKEYEGEAIL 368          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Mouse
Match: Ppp1r16b (protein phosphatase 1, regulatory subunit 16B [Source:MGI Symbol;Acc:MGI:2151841])

HSP 1 Score: 279.641 bits (714), Expect = 1.846e-85
Identity = 160/382 (41.88%), Postives = 232/382 (60.73%), Query Frame = 1
Query:  154 LERIKQARKKRITQLKNWYQYDKIMEKQKIRVGKPQKSNFLVKRVHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCEDPEINRKLHQIKQELERNYELKKSLQVRPNLSVLGXXXXXXXXXXXXPEDNTVPPGHLIVGSLRRTAS-------IRRSSMREKSLMSRNEARKEAMI 1278
            LER++ A+K+R  QLK W QY++ +  +K +  + + +    K+V F  S+ LLEA+ R D +EV+  L    SPD+CNEDGLTALHQCCIDN   I +LLL  GANVNA D+E+WTPLHAAA C HI +   L+ YGA+LLA+N++GNMPYD+CE+E TLD+IE  MA +GI+Q++I+E R  PE +M+ D+  +     +L  ID QGA+ LHIA + GYL     L++HGV +D+ D +GW+P+H AA WGQ+   E L+SHG ++ A T   E   DLCE+ E    L ++K   + +  +K  L+ + +LS                               RRT+S       +RR+S+ +++ + R E   EA++
Sbjct:   20 LERLRAAQKRRAQQLKKWAQYEQDLLHRKRKHERKRSTGGRRKKVSFEASVALLEASLRNDAEEVRYFLKNKVSPDLCNEDGLTALHQCCIDNFEEIVKLLLSHGANVNAKDNELWTPLHAAATCGHINLVKILVQYGADLLAVNSDGNMPYDLCEDEPTLDVIETCMAYQGITQEKINEMRAAPEQKMISDIHCMIAAGQDLDWIDGQGATLLHIAGANGYLRAAELLLDHGVRVDVKDWDGWEPLHAAAFWGQMPMAELLVSHGASLSARTSMDEMPIDLCEEEEFKVLLLELKH--KHDVIMKSQLRHKSSLS-------------------------------RRTSSAGSRGKVVRRASLSDRTNLYRKEYEGEAIL 368          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Mouse
Match: Ppp1r16a (protein phosphatase 1, regulatory subunit 16A [Source:MGI Symbol;Acc:MGI:1920312])

HSP 1 Score: 265.774 bits (678), Expect = 8.885e-81
Identity = 145/306 (47.39%), Postives = 198/306 (64.71%), Query Frame = 1
Query:  139 SRASDLERIKQARKKRITQLKNWYQYDKIMEKQKIRVGKPQKSNFLV---KRVHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCEDPEINRKLHQIKQE 1047
             R S  ER+K A+K+R  Q+K W Q +K    +K    +P K    +   K V FP S+ LLEAA R D++EV++ LT G SP++ NEDGLTALHQCCID+   + Q LL  GA+VNA DSE WTPLHAAA C H+ +   LI  GA+LLA+N++GNMPYD+CE+  TLD +E AMA +GI+Q+ I+E R  PEL ML DLQ       NL+     GA+ LHIAA+ G+ EV   L+E G  +   D +GW+P+H AA WGQ+  +E L++HG +++  +   ET  D+C D E+  KL ++K +
Sbjct:   15 GRMSTQERLKHAQKRRAQQVKMWAQAEKEAHSKKGHGERPWKEVAGLRPRKHVLFPPSVALLEAAARNDLEEVRQFLTSGVSPNLANEDGLTALHQCCIDDFQEMAQQLLDAGADVNARDSECWTPLHAAATCGHLHLVELLISRGADLLAVNSDGNMPYDLCEDAQTLDCLETAMANQGITQEGIEEARAVPELCMLNDLQNRLQAGANLSDPLDHGATLLHIAAANGFSEVATLLLEQGASLSAKDHDGWEPLHAAAYWGQVHLVELLVAHGADLNGKSLVDETPLDVCGDEEVRAKLLELKHK 320          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Mouse
Match: Ppp1r16a (protein phosphatase 1, regulatory subunit 16A [Source:MGI Symbol;Acc:MGI:1920312])

HSP 1 Score: 265.774 bits (678), Expect = 8.885e-81
Identity = 145/306 (47.39%), Postives = 198/306 (64.71%), Query Frame = 1
Query:  139 SRASDLERIKQARKKRITQLKNWYQYDKIMEKQKIRVGKPQKSNFLV---KRVHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCEDPEINRKLHQIKQE 1047
             R S  ER+K A+K+R  Q+K W Q +K    +K    +P K    +   K V FP S+ LLEAA R D++EV++ LT G SP++ NEDGLTALHQCCID+   + Q LL  GA+VNA DSE WTPLHAAA C H+ +   LI  GA+LLA+N++GNMPYD+CE+  TLD +E AMA +GI+Q+ I+E R  PEL ML DLQ       NL+     GA+ LHIAA+ G+ EV   L+E G  +   D +GW+P+H AA WGQ+  +E L++HG +++  +   ET  D+C D E+  KL ++K +
Sbjct:   15 GRMSTQERLKHAQKRRAQQVKMWAQAEKEAHSKKGHGERPWKEVAGLRPRKHVLFPPSVALLEAAARNDLEEVRQFLTSGVSPNLANEDGLTALHQCCIDDFQEMAQQLLDAGADVNARDSECWTPLHAAATCGHLHLVELLISRGADLLAVNSDGNMPYDLCEDAQTLDCLETAMANQGITQEGIEEARAVPELCMLNDLQNRLQAGANLSDPLDHGATLLHIAAANGFSEVATLLLEQGASLSAKDHDGWEPLHAAAYWGQVHLVELLVAHGADLNGKSLVDETPLDVCGDEEVRAKLLELKHK 320          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. UniProt/SwissProt
Match: sp|Q95N27|PP16B_BOVIN (Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Bos taurus OX=9913 GN=PPP1R16B PE=1 SV=1)

HSP 1 Score: 283.878 bits (725), Expect = 3.072e-86
Identity = 165/414 (39.86%), Postives = 250/414 (60.39%), Query Frame = 1
Query:  154 LERIKQARKKRITQLKNWYQYDKIMEKQKIRVGKPQKSNFLVKRVHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCEDPEINRKLHQIKQELERNYELKKSLQVRPNLSVLGXXXXXXXXXXXXPEDNTVPPGHLIVGSLRRTAS-------IRRSSMREKSLMSRNEARKEAMIREVVEKKISEPKYESSIDTKNSGSNTNEINLD 1374
            LER++ A+K+R  QLK W QY++ ++ +K +  + + +    K+V F  S+ LLEA+ R D +EV+  L    SPD+CNEDGLTALHQCCIDN   I +LLL  GANVNA D+E+WTPLHAAA C HI +   L+ YGA+LLA+N++GNMPYD+CE+E TLD+IE  MA +GI+Q++I+E R  PE +M+ D+  +     +L  +D+QGA+ LHIA + GYL     L++HGV +D+ D +GW+P+H AA WGQ++  E L+SHG ++ A T   E   DLCE+ E    L ++K   + +  +K  L+ + +LS                               RRT+S       +RR+S+ +++ + R E   EA++ +  ++  SE +  S+ +     + T++ N D
Sbjct:   20 LERLRAAQKRRAQQLKKWAQYEQDLQHRKRKHERKRSTGGRRKKVSFEASVALLEASLRNDAEEVRYFLKNKVSPDLCNEDGLTALHQCCIDNFEEIVKLLLSHGANVNAKDNELWTPLHAAATCGHINLVKILVQYGADLLAVNSDGNMPYDLCEDEPTLDVIETCMAYQGITQEKINEMRAAPEQQMISDIHCMIAAGQDLDWVDAQGATLLHIAGANGYLRAAELLLDHGVRVDVKDWDGWEPLHAAAFWGQMQMAELLVSHGASLSARTSMDEMPIDLCEEEEFKVLLLELKH--KHDVIMKSQLRHKSSLS-------------------------------RRTSSAGSRGKVVRRASLSDRTNLYRKEYEGEAILWQ--QRSASEDQRNSTYNGDIRETRTDQENKD 398          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. UniProt/SwissProt
Match: sp|Q96T49|PP16B_HUMAN (Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Homo sapiens OX=9606 GN=PPP1R16B PE=1 SV=1)

HSP 1 Score: 282.722 bits (722), Expect = 8.063e-86
Identity = 160/382 (41.88%), Postives = 235/382 (61.52%), Query Frame = 1
Query:  154 LERIKQARKKRITQLKNWYQYDKIMEKQKIRVGKPQKSNFLVKRVHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCEDPEINRKLHQIKQELERNYELKKSLQVRPNLSVLGXXXXXXXXXXXXPEDNTVPPGHLIVGSLRRTAS-------IRRSSMREKSLMSRNEARKEAMI 1278
            LER++ A+K+R  QLK W QY++ ++ +K +  + + +    K+V F  S+ LLEA+ R D +EV+  L    SPD+CNEDGLTALHQCCIDN   I +LLL  GANVNA D+E+WTPLHAAA C HI +   L+ YGA+LLA+N++GNMPYD+CE+E TLD+IE  MA +GI+Q++I+E R  PE +M+ D+  +     +L  ID+QGA+ LHIA + GYL     L++HGV +D+ D +GW+P+H AA WGQ++  E L+SHG ++ A T   E   DLCE+ E    L ++K   + +  +K  L+ + +LS                               RRT+S       +RR+S+ +++ + R E   EA++
Sbjct:   20 LERLRAAQKRRAQQLKKWAQYEQDLQHRKRKHERKRSTGGRRKKVSFEASVALLEASLRNDAEEVRYFLKNKVSPDLCNEDGLTALHQCCIDNFEEIVKLLLSHGANVNAKDNELWTPLHAAATCGHINLVKILVQYGADLLAVNSDGNMPYDLCEDEPTLDVIETCMAYQGITQEKINEMRVAPEQQMIADIHCMIAAGQDLDWIDAQGATLLHIAGANGYLRAAELLLDHGVRVDVKDWDGWEPLHAAAFWGQMQMAELLVSHGASLSARTSMDEMPIDLCEEEEFKVLLLELKH--KHDVIMKSQLRHKSSLS-------------------------------RRTSSAGSRGKVVRRASLSDRTNLYRKEYEGEAIL 368          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. UniProt/SwissProt
Match: sp|Q8VHQ3|PP16B_MOUSE (Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Mus musculus OX=10090 GN=Ppp1r16b PE=1 SV=1)

HSP 1 Score: 279.641 bits (714), Expect = 1.291e-84
Identity = 160/382 (41.88%), Postives = 232/382 (60.73%), Query Frame = 1
Query:  154 LERIKQARKKRITQLKNWYQYDKIMEKQKIRVGKPQKSNFLVKRVHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCEDPEINRKLHQIKQELERNYELKKSLQVRPNLSVLGXXXXXXXXXXXXPEDNTVPPGHLIVGSLRRTAS-------IRRSSMREKSLMSRNEARKEAMI 1278
            LER++ A+K+R  QLK W QY++ +  +K +  + + +    K+V F  S+ LLEA+ R D +EV+  L    SPD+CNEDGLTALHQCCIDN   I +LLL  GANVNA D+E+WTPLHAAA C HI +   L+ YGA+LLA+N++GNMPYD+CE+E TLD+IE  MA +GI+Q++I+E R  PE +M+ D+  +     +L  ID QGA+ LHIA + GYL     L++HGV +D+ D +GW+P+H AA WGQ+   E L+SHG ++ A T   E   DLCE+ E    L ++K   + +  +K  L+ + +LS                               RRT+S       +RR+S+ +++ + R E   EA++
Sbjct:   20 LERLRAAQKRRAQQLKKWAQYEQDLLHRKRKHERKRSTGGRRKKVSFEASVALLEASLRNDAEEVRYFLKNKVSPDLCNEDGLTALHQCCIDNFEEIVKLLLSHGANVNAKDNELWTPLHAAATCGHINLVKILVQYGADLLAVNSDGNMPYDLCEDEPTLDVIETCMAYQGITQEKINEMRAAPEQKMISDIHCMIAAGQDLDWIDGQGATLLHIAGANGYLRAAELLLDHGVRVDVKDWDGWEPLHAAAFWGQMPMAELLVSHGASLSARTSMDEMPIDLCEEEEFKVLLLELKH--KHDVIMKSQLRHKSSLS-------------------------------RRTSSAGSRGKVVRRASLSDRTNLYRKEYEGEAIL 368          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. UniProt/SwissProt
Match: sp|Q96I34|PP16A_HUMAN (Protein phosphatase 1 regulatory subunit 16A OS=Homo sapiens OX=9606 GN=PPP1R16A PE=1 SV=1)

HSP 1 Score: 274.248 bits (700), Expect = 4.093e-83
Identity = 146/306 (47.71%), Postives = 203/306 (66.34%), Query Frame = 1
Query:  139 SRASDLERIKQARKKRITQLKNWYQYDKIMEKQKIRVGKPQK---SNFLVKRVHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCEDPEINRKLHQIKQE 1047
             R S  ER+K A+K+R  Q+K W Q +K  + +K    +P+K   S  L+K+V FP S+VLLEAA R D++EV++ L  G SPD+ NEDGLTALHQCCID+   + Q LL+ GAN+NA DSE WTPLHAAA C H+ +   LI  GANLLA+N +GNMPYD+C++E TLD +E AMA RGI+QD I+  R  PEL ML D++       +L      GA+ LH+AA+ G+ E    L+EH   +   D++GW+P+H AA WGQ+  +E L++HG +++A +   ET  D+C D E+  KL ++K +
Sbjct:   15 GRMSTQERLKHAQKRRAQQVKMWAQAEKEAQGKKGPGERPRKEAASQGLLKQVLFPPSVVLLEAAARNDLEEVRQFLGSGVSPDLANEDGLTALHQCCIDDFREMVQQLLEAGANINACDSECWTPLHAAATCGHLHLVELLIASGANLLAVNTDGNMPYDLCDDEQTLDCLETAMADRGITQDSIEAARAVPELRMLDDIRSRLQAGADLHAPLDHGATLLHVAAANGFSEAAALLLEHRASLSAKDQDGWEPLHAAAYWGQVPLVELLVAHGADLNAKSLMDETPLDVCGDEEVRAKLLELKHK 320          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. UniProt/SwissProt
Match: sp|Q923M0|PP16A_MOUSE (Protein phosphatase 1 regulatory subunit 16A OS=Mus musculus OX=10090 GN=Ppp1r16a PE=1 SV=1)

HSP 1 Score: 265.774 bits (678), Expect = 6.215e-80
Identity = 145/306 (47.39%), Postives = 198/306 (64.71%), Query Frame = 1
Query:  139 SRASDLERIKQARKKRITQLKNWYQYDKIMEKQKIRVGKPQKSNFLV---KRVHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCEDPEINRKLHQIKQE 1047
             R S  ER+K A+K+R  Q+K W Q +K    +K    +P K    +   K V FP S+ LLEAA R D++EV++ LT G SP++ NEDGLTALHQCCID+   + Q LL  GA+VNA DSE WTPLHAAA C H+ +   LI  GA+LLA+N++GNMPYD+CE+  TLD +E AMA +GI+Q+ I+E R  PEL ML DLQ       NL+     GA+ LHIAA+ G+ EV   L+E G  +   D +GW+P+H AA WGQ+  +E L++HG +++  +   ET  D+C D E+  KL ++K +
Sbjct:   15 GRMSTQERLKHAQKRRAQQVKMWAQAEKEAHSKKGHGERPWKEVAGLRPRKHVLFPPSVALLEAAARNDLEEVRQFLTSGVSPNLANEDGLTALHQCCIDDFQEMAQQLLDAGADVNARDSECWTPLHAAATCGHLHLVELLISRGADLLAVNSDGNMPYDLCEDAQTLDCLETAMANQGITQEGIEEARAVPELCMLNDLQNRLQAGANLSDPLDHGATLLHIAAANGFSEVATLLLEQGASLSAKDHDGWEPLHAAAYWGQVHLVELLVAHGADLNGKSLVDETPLDVCGDEEVRAKLLELKHK 320          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. TrEMBL
Match: W6UP99 (Protein phosphatase 1 regulatory inhibitor subunit OS=Echinococcus granulosus OX=6210 GN=EGR_02387 PE=4 SV=1)

HSP 1 Score: 349.747 bits (896), Expect = 4.810e-108
Identity = 205/436 (47.02%), Postives = 291/436 (66.74%), Query Frame = 1
Query:  142 RASDLERIKQARKKRITQLKNWYQYDKIMEKQKIRV------------GKPQKSNFLVKRVHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYS-GETVYDLCEDPEINRKLHQIKQELER--NYELKKSLQVRP----------NLSVLGXXXXXXXXXXXXPEDNTVPPGHLIVGSLRRTASIRRSSMREKSLMSRNEARKEAMI---------REVVEKKISEPKYESSIDTKNSG 1347
            R  D+ERI+ AR+KR  QLK W QYDK MEK++ R             G  Q   F V+ V F Q+++LLEAA R+D++EV++LL +G  P+V N DGLTALHQCCIDN+  +C+LL++FGA+VNA D+E+WTPLHAAA C H ++C  LID GA+LLA+NA+GNMPYDICE++ TLDLIE+ MA+RGI+Q++IDEKR+ PE EML  ++ L   +G+L ++DSQGA+ LHIAA+CGYL+V  FL++HG  ID+ D++GW  IH+AACWGQ E IE L + G  +D  T + GETV+D+CED +++ +L  +++EL+R  ++ L ++ Q+            N   L RR +S+ RR    E +  P        L   +SIRR+SMR+K+ +S  EAR+EA            + VE+ +  P + +++D  N G
Sbjct:   13 RVPDMERIRAARRKRQQQLKRWVQYDKTMEKKEKRTRTSTSPPPGSTPGGRQHPGF-VRSVQFSQAVILLEAAARDDLNEVRKLLNQGVCPNVTNMDGLTALHQCCIDNNQEMCRLLIRFGADVNARDTELWTPLHAAATCCHADLCKLLIDNGADLLAVNADGNMPYDICEDDATLDLIESEMASRGITQEDIDEKRRVPEREMLAAMEHLVKTSGDLNQLDSQGAAPLHIAAACGYLDVVGFLLQHGANIDLPDRDGWMAIHVAACWGQYEVIEMLTNFGAKLDTPTVNGGETVFDICEDEKLHERLVLLREELKRWQSFHLVQN-QINASNGNSDVNNRNRGGLSRRRSSNPRRQEFLEYDQFP------RELAEASSIRRTSMRDKAKLSWKEARQEAETCSLVVPTADGDSVEEVVKTPVWMTAVDDSNGG 440          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. TrEMBL
Match: A0A3Q0KGC6 (Protein phosphatase 1 regulatory inhibitor subunit 16a, putative OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 352.829 bits (904), Expect = 6.246e-108
Identity = 204/457 (44.64%), Postives = 283/457 (61.93%), Query Frame = 1
Query:  142 RASDLERIKQARKKRITQLKNWYQYDKIMEKQKIRVGKPQKSNFLVKR-------VHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCEDPEINRKLHQIKQELERNYELKKSLQVRPNLSVLGXXXXXXXXXXXXPEDNTVPPGHLI---VGSLRRTASIRRSSMREKSLMSRNEARKEAMIREVVEKKISEPKYESSIDTKNSGSNTNEI---NLDQVMLDVQAFSQKEPFVRRGSSRNSFTHSHPYHS 1473
            R  D++RIK ARK+R  QLK W  YDK M+K+  ++ K   S    +R       V FPQS++ LEAA R D+DEV+ LL+ G  PDV NEDGLTALHQCCIDN+L +C+LLL++GAN N+ D+E+WTPLHA+A C H E+C  LID+GA+LLA+N +GNMPY+ C    TL+L+E  M  RGI+Q+EID+  + PE EML D++ L     +L ++D+QGAS LHIAA+ G+ EV  FL++ G  ID+LDK+GWQ IHIAACW QLE +E L++ G +I A T +GETV+D+CED E++ +L +IKQE+ER    ++ L  +P                         P  L+     +  R+ASIRR+SMREK ++S  EA++EA +R V           +S D KN+    + I   + D ++     + +          R+S   SHP HS
Sbjct:   26 RVPDMKRIKNARKERANQLKEWQIYDKKMQKESEKLQKKGLSPLNDRRHYNSSRAVKFPQSLIFLEAAARGDLDEVRELLSSGVCPDVANEDGLTALHQCCIDNNLEMCRLLLRYGANPNSRDTELWTPLHASATCHHTEMCKILIDHGADLLAMNVDGNMPYECCMPGPTLNLVETEMDKRGITQEEIDDWHRVPECEMLADMEALYKAGADLDRLDAQGASMLHIAAASGFEEVVLFLLKRGAKIDLLDKDGWQAIHIAACWCQLEIVELLVNFGADILAETRNGETVFDICEDIEMHTRLIEIKQEVERKKSQQQDLLNKPG-----------------------KPRELVRRRSSTNPRSASIRRTSMREKKMISWKEAKQEAEMRGVA---------TTSSDEKNTSKPLSPILNGSTDHILEKSTTYPESHGLTSPKPIRDSTRSSHPGHS 450          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. TrEMBL
Match: A0A4Z2DB46 (Protein phosphatase 1 regulatory subunit 16A isoform 5 OS=Schistosoma japonicum OX=6182 GN=EWB00_002669 PE=4 SV=1)

HSP 1 Score: 346.28 bits (887), Expect = 9.145e-108
Identity = 198/430 (46.05%), Postives = 274/430 (63.72%), Query Frame = 1
Query:   85 FNGKMSA--EQNEEELFANRSRASDLERIKQARKKRITQLKNWYQYDKIMEKQKIRVGKPQKSNFLVKR-------VHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCEDPEINRKLHQIKQELERNYELKKSLQVRPNLSVLGXXXXXXXXXXXXPEDNTVPPGHLI---VGSLRRTASIRRSSMREKSLMSRNEARKEAMIREVVEKKISEPKYESSIDTK 1338
             NG M +    N +++     R  D++RIK ARK+R  QLK W  YDK M+K+  ++ K   S    +R       V FPQS++ LEAA R D+DEV+ LL+ G  PDV NEDGLTALHQCCIDN+L +C+LLL++GAN N+ D+E+WTPLHA+A C H E+C  LID+GA+LLA+N +GNMPY+ C    TL+LIE  M  RGI+Q+EID+  + PE EML D++ L     +L ++DSQGAS LHIA++ G+ EV  FL++ G  ID+ DK+GWQ IHIAACW QLE +E L++ G +I A T +GETV+D+CED E++ +L +IKQE+ER    ++ +  RP                         P  L+     +  R+ASIRR+SMREK ++S  EA++EA +R V     + P  E  + +K
Sbjct:    4 LNGSMESMPTNNVDDIDLPGIRVPDMKRIKNARKERANQLKEWQIYDKKMQKESDKLQKKGLSPLNDRRHYNSSRAVKFPQSLIFLEAAARGDLDEVRELLSSGVCPDVANEDGLTALHQCCIDNNLEMCRLLLRYGANPNSRDTELWTPLHASATCHHTEMCKILIDHGADLLAMNVDGNMPYECCMPGPTLNLIETEMDKRGITQEEIDDWHRVPECEMLADMEALYKAGADLDRLDSQGASMLHIASASGFEEVVLFLLKRGAKIDLPDKDGWQAIHIAACWCQLEIVELLVNFGADIMAETRNGETVFDICEDIEMHSRLIEIKQEMERKKSQQQDVLDRPG-----------------------KPRELVRRRSSTNPRSASIRRTSMREKKMISWKEAKQEAEMRGVA----TTPADEKDVSSK 406          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. TrEMBL
Match: G4LX82 (Protein phosphatase 1 regulatory inhibitor subunit 16a, putative OS=Schistosoma mansoni OX=6183 GN=Smp_058450 PE=4 SV=1)

HSP 1 Score: 352.058 bits (902), Expect = 1.472e-107
Identity = 204/457 (44.64%), Postives = 283/457 (61.93%), Query Frame = 1
Query:  142 RASDLERIKQARKKRITQLKNWYQYDKIMEKQKIRVGKPQKSNFLVKR-------VHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCEDPEINRKLHQIKQELERNYELKKSLQVRPNLSVLGXXXXXXXXXXXXPEDNTVPPGHLI---VGSLRRTASIRRSSMREKSLMSRNEARKEAMIREVVEKKISEPKYESSIDTKNSGSNTNEI---NLDQVMLDVQAFSQKEPFVRRGSSRNSFTHSHPYHS 1473
            R  D++RIK ARK+R  QLK W  YDK M+K+  ++ K   S    +R       V FPQS++ LEAA R D+DEV+ LL+ G  PDV NEDGLTALHQCCIDN+L +C+LLL++GAN N+ D+E+WTPLHA+A C H E+C  LID+GA+LLA+N +GNMPY+ C    TL+L+E  M  RGI+Q+EID+  + PE EML D++ L     +L ++D+QGAS LHIAA+ G+ EV  FL++ G  ID+LDK+GWQ IHIAACW QLE +E L++ G +I A T +GETV+D+CED E++ +L +IKQE+ER    ++ L  +P                         P  L+     +  R+ASIRR+SMREK ++S  EA++EA +R V           +S D KN+    + I   + D ++     + +          R+S   SHP HS
Sbjct:   26 RVPDMKRIKNARKERANQLKEWQIYDKKMQKESEKLQKKGLSPLNDRRHYNSSRAVKFPQSLIFLEAAARGDLDEVRELLSSGVCPDVANEDGLTALHQCCIDNNLEMCRLLLRYGANPNSRDTELWTPLHASATCHHTEMCKILIDHGADLLAMNVDGNMPYECCMPGPTLNLVETEMDKRGITQEEIDDWHRVPECEMLADMEALYKAGADLDRLDAQGASMLHIAAASGFEEVVLFLLKRGAKIDLLDKDGWQAIHIAACWCQLEIVELLVNFGADILAETRNGETVFDICEDIEMHTRLIEIKQEVERKKSQQQDLLNKPG-----------------------KPRELVRRRSSTNPRSASIRRTSMREKKMISWKEAKQEAEMRGVA---------TTSSDEKNTSKPLSPILNGSTDHILEKSITYPESHGLTSPKPIRDSTRSSHPGHS 450          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. TrEMBL
Match: A0A068WG80 (Protein phosphatase 1 regulatory inhibitor OS=Echinococcus granulosus OX=6210 GN=EgrG_000440300 PE=4 SV=1)

HSP 1 Score: 347.821 bits (891), Expect = 4.152e-107
Identity = 202/441 (45.80%), Postives = 289/441 (65.53%), Query Frame = 1
Query:  142 RASDLERIKQARKKRITQLKNWYQYDKIMEKQKIRV------------GKPQKSNFLVKRVHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYS-GETVYDLCEDPEINRKLHQIKQELERNYELKKSLQVRPNLSVLGXXXXXXXXXXXXPEDNTVPPGHLIVGSLRRT-----------------ASIRRSSMREKSLMSRNEARKEAMI---------REVVEKKISEPKYESSIDTKNSG 1347
            R  D+ERI+ AR+KR  QLK W QYDK MEK++ R             G  Q   F V+ V F Q+++LLEAA R+D++EV++LL +G  P+V N DGLTALHQCCIDN+  +C+LL++FGA+VNA D+E+WTPLHAAA C H ++C  LID GA+LLA+NA+GNMPYDICE++ TLDLIE+ MA+RGI+Q++IDEKR+ PE EML  ++ L   +G+L ++DSQGA+ LHIAA+CGYL+V  FL++HG  ID+ D++GW  IH+AACWGQ E IE L + G  +D  T + GETV+D+CED +++ +L  +++EL+R ++    +Q + N S      N+  R   S   ++ P   +     +RT                 +SIRR+SMR+K+ +S  EAR+EA            + VE+ +  P + +++D  N G
Sbjct:   13 RVPDMERIRAARRKRQQQLKRWVQYDKTMEKKEKRTRTSTSPPPGSTPGGRQHPGF-VRSVQFSQAVILLEAAARDDLNEVRKLLNQGVCPNVTNMDGLTALHQCCIDNNQEMCRLLIRFGADVNARDTELWTPLHAAATCCHADLCKLLIDNGADLLAVNADGNMPYDICEDDATLDLIESEMASRGITQEDIDEKRRVPEREMLAAMEHLVKTSGDLNQLDSQGAAPLHIAAACGYLDVVGFLLQHGANIDLPDRDGWMAIHVAACWGQYEVIEMLTNFGAKLDTPTVNGGETVFDICEDEKLHERLVLLREELKR-WQSFHLVQNQINASNGNSDVNNRNRGGLSRRRSSNPRRQVQTSDRQRTRFFFYTNIQRLNARLRTSSIRRTSMRDKAKLSWKEARQEAETCSLVVPTADGDSVEEVVKTPVWMTAVDDSNGG 451          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Cavefish
Match: si:ch211-217a12.1 (si:ch211-217a12.1 [Source:ZFIN;Acc:ZDB-GENE-121214-95])

HSP 1 Score: 290.426 bits (742), Expect = 1.197e-89
Identity = 171/392 (43.62%), Postives = 233/392 (59.44%), Query Frame = 1
Query:  139 SRASDLERIKQARKKRITQLKNWYQYDKIMEKQKIRVGKP-QKSNFLVK-------RVHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCEDPEINRKLHQIKQE----LERNYELKKSLQVRPNLSVLGXXXXXXXXXXXXPEDNTVPPGHLIVGSLRRTASIRRSSMREKSLMSRNEARKEAMI 1278
             R S  ER+K A+K+R  QLK W Q    MEK+  R GK  QK++   K       +V FP ++ LLEAA R D+DEV+ LL  G SPD+ NEDGLTALHQCCID+ + + + LL  GA+VNA DSE+WTPLHAAA C H  +   L+  GA+LLA+NA+GNMPYD+CE+E TL+LIE  MA +GI+Q+ IDE R   E  ML D+Q +     +L   D QGA+ LH+AA+ GYL VG  L+E  V ++  D +GW P+H AACWGQL  +E L++HG N++A +   ET  D+C D E+  K+ ++K +    ++     K +LQ R +                               +  R   +RR+S+ E+S M R E  KEAM+
Sbjct:   15 GRLSATERLKHAQKRRAQQLKGWAQ----MEKENARSGKAVQKTDREKKSKKEGGRKVAFPNNITLLEAAARNDVDEVRELLNSGVSPDLFNEDGLTALHQCCIDDFVDVVRCLLDAGASVNACDSELWTPLHAAATCGHTGLVQLLVQAGADLLAVNADGNMPYDLCEDEATLELIEVVMAEQGITQERIDECRGVKERAMLADIQGMIENRADLNAADEQGATLLHVAAANGYLSVGELLLEQRVRVEEKDSDGWTPLHAAACWGQLHMVELLVAHGANLNAKSALEETPLDVCADEEVRAKMLELKHKHDAIMKSQDRHKGTLQRRAS------------------------------SASSRGKVVRRTSVNERSNMYRREHHKEAMV 372          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Cavefish
Match: ppp1r16b (protein phosphatase 1 regulatory subunit 16B [Source:NCBI gene;Acc:103031385])

HSP 1 Score: 286.96 bits (733), Expect = 1.322e-88
Identity = 153/309 (49.51%), Postives = 211/309 (68.28%), Query Frame = 1
Query:  142 RASDLERIKQARKKRITQLKNWYQYDKIMEKQKIRV----GKPQKSNFLVKRVHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNG-NLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCEDPEINRKLHQIKQELE 1053
            +A  LER++ A+K+R  QLK W  Y+K ++ +K +     G  ++ N L +RV F  ++ LLEA+ R D+DEVK LL    +PD+CNEDGLTA+HQCCIDN   + QLLL  GA+VNA D+E+WTPLHAAA C H  +   LI +GA+LLA+N++GNMPYD+CE++ TLD+IE AMA RGI+Q+ I+E R   E  ML D++ + L NG ++ + DSQGA+ LHI A+ GY++    L+E G  +D+ D +GWQP+H AACWGQ    E L+SHG +++A T   ET  DLCED E    L  +K + E
Sbjct:   16 KAPSLERLRAAQKRRAQQLKRWAVYEKELQNKKWKTDKKRGNIKQRNSLHRRVSFAANVALLEASARNDLDEVKYLLKNSVNPDLCNEDGLTAMHQCCIDNYEDMVQLLLNRGASVNAQDNELWTPLHAAATCGHTGLVKILIQHGADLLAVNSDGNMPYDLCEDDPTLDIIETAMANRGITQEMINETRAAVERRMLGDIRNI-LHNGEDVNQHDSQGATLLHITAANGYMQAAELLLEGGAKMDLRDSDGWQPLHAAACWGQRTIAELLVSHGASLNAKTSLEETPIDLCEDEEFRNHLLDLKHKHE 323          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Cavefish
Match: si:ch211-217a12.1 (si:ch211-217a12.1 [Source:ZFIN;Acc:ZDB-GENE-121214-95])

HSP 1 Score: 288.115 bits (736), Expect = 6.888e-85
Identity = 171/392 (43.62%), Postives = 233/392 (59.44%), Query Frame = 1
Query:  139 SRASDLERIKQARKKRITQLKNWYQYDKIMEKQKIRVGKP-QKSNFLVK-------RVHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCEDPEINRKLHQIKQE----LERNYELKKSLQVRPNLSVLGXXXXXXXXXXXXPEDNTVPPGHLIVGSLRRTASIRRSSMREKSLMSRNEARKEAMI 1278
             R S  ER+K A+K+R  QLK W Q    MEK+  R GK  QK++   K       +V FP ++ LLEAA R D+DEV+ LL  G SPD+ NEDGLTALHQCCID+ + + + LL  GA+VNA DSE+WTPLHAAA C H  +   L+  GA+LLA+NA+GNMPYD+CE+E TL+LIE  MA +GI+Q+ IDE R   E  ML D+Q +     +L   D QGA+ LH+AA+ GYL VG  L+E  V ++  D +GW P+H AACWGQL  +E L++HG N++A +   ET  D+C D E+  K+ ++K +    ++     K +LQ R +                               +  R   +RR+S+ E+S M R E  KEAM+
Sbjct:   15 GRLSATERLKHAQKRRAQQLKGWAQ----MEKENARSGKAVQKTDREKKSKKEGGRKVAFPNNITLLEAAARNDVDEVRELLNSGVSPDLFNEDGLTALHQCCIDDFVDVVRCLLDAGASVNACDSELWTPLHAAATCGHTGLVQLLVQAGADLLAVNADGNMPYDLCEDEATLELIEVVMAEQGITQERIDECRGVKERAMLADIQGMIENRADLNAADEQGATLLHVAAANGYLSVGELLLEQRVRVEEKDSDGWTPLHAAACWGQLHMVELLVAHGANLNAKSALEETPLDVCADEEVRAKMLELKHKHDAIMKSQDRHKGTLQRRAS------------------------------SASSRGKVVRRTSVNERSNMYRREHHKEAMV 372          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Cavefish
Match: ppp1r12a (protein phosphatase 1 regulatory subunit 12A [Source:NCBI gene;Acc:103046804])

HSP 1 Score: 152.91 bits (385), Expect = 2.708e-38
Identity = 104/285 (36.49%), Postives = 163/285 (57.19%), Query Frame = 1
Query:  160 RIKQARKKRITQLKNWYQYDKIMEKQKIRVGKPQKSNFLVKRVHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKI--DSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCED 1008
            ++  A++KR  QLK W   +  +E        P        +V F    V L A    D +EV RLL  GA  +  N DGLTALHQ CID+++ +   L++ GA +N  D+E W PLHAAA+C +++I   LI  GA++  +N+EG  P DI EEE   +L++N +  +G+   +I+  RKE E  MLRD ++  L +G ++ +     G + LH+AA+ GY EV + LI+ G  ++I D +GW P+H AA WG+ E    L+ +  ++D +   G+T +D+ ++
Sbjct:    2 KMADAKQKRNEQLKRWLGSETDLE--------PPVLKKKKTKVKFDDGAVFLAACSSGDTEEVLRLLDRGADINYANVDGLTALHQACIDDNVDMVTFLVEHGACINQPDNEGWIPLHAAASCGYMDIAEYLISQGASVGVVNSEGETPLDIAEEEAMEELLQNEINRQGV---DIEAARKEEERIMLRDARQW-LNSGQISDVRHAKSGGTALHVAAAKGYAEVLKLLIQAGYDVNIKDYDGWTPLHAAAHWGKEEACRILVENLCDMDLINKVGQTAFDVADE 274          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Cavefish
Match: ppp1r12a (protein phosphatase 1 regulatory subunit 12A [Source:NCBI gene;Acc:103046804])

HSP 1 Score: 152.91 bits (385), Expect = 2.728e-38
Identity = 104/285 (36.49%), Postives = 163/285 (57.19%), Query Frame = 1
Query:  160 RIKQARKKRITQLKNWYQYDKIMEKQKIRVGKPQKSNFLVKRVHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKI--DSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCED 1008
            ++  A++KR  QLK W   +  +E        P        +V F    V L A    D +EV RLL  GA  +  N DGLTALHQ CID+++ +   L++ GA +N  D+E W PLHAAA+C +++I   LI  GA++  +N+EG  P DI EEE   +L++N +  +G+   +I+  RKE E  MLRD ++  L +G ++ +     G + LH+AA+ GY EV + LI+ G  ++I D +GW P+H AA WG+ E    L+ +  ++D +   G+T +D+ ++
Sbjct:    2 KMADAKQKRNEQLKRWLGSETDLE--------PPVLKKKKTKVKFDDGAVFLAACSSGDTEEVLRLLDRGADINYANVDGLTALHQACIDDNVDMVTFLVEHGACINQPDNEGWIPLHAAASCGYMDIAEYLISQGASVGVVNSEGETPLDIAEEEAMEELLQNEINRQGV---DIEAARKEEERIMLRDARQW-LNSGQISDVRHAKSGGTALHVAAAKGYAEVLKLLIQAGYDVNIKDYDGWTPLHAAAHWGKEEACRILVENLCDMDLINKVGQTAFDVADE 274          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003334.1 (pep scaffold:Pmarinus_7.0:GL479399:737:27806:-1 gene:ENSPMAG00000003049.1 transcript:ENSPMAT00000003334.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 184.496 bits (467), Expect = 4.163e-54
Identity = 107/255 (41.96%), Postives = 153/255 (60.00%), Query Frame = 1
Query:  157 ERIKQARKKRITQLKNWYQYDKIMEKQKIRVGKPQKSNFLVKRVHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQL 921
            ER+++ARKKR  QLK W ++D+   K+     K  +S    + V+FP S+ LLEA  R D+DEV  LL++G SPD CNE+GLTALHQ C+     +  LLL  GA+VNA DS +WTPLHAA A    E+   L+  GA+LLAL+ +G  P+D+C++  T+  +E  M  RG+++  +++ RK  E      + E+     +L   D  G   LH+A + GY    R L+E G   D+ D +GW P+H AA WGQ+
Sbjct:    5 ERLQRARKKRAEQLKRWAEFDRQHGKKGRAKKKRLRSK--SRAVNFPPSLRLLEAVSRNDVDEVTTLLSDGVSPDSCNEEGLTALHQACLWGWEDLAGLLLSRGASVNARDSGLWTPLHAACAQGFTEVVRLLVPRGADLLALSEDGETPFDVCDDHETIAYLEGEMRHRGLTEKVVEDARKATEDSF---ISEMTQSVADLNAPDDHGVVVLHMAVAHGYERAVRVLLEVGARSDLPDADGWTPLHAAAYWGQV 254          

HSP 2 Score: 53.1434 bits (126), Expect = 5.107e-8
Identity = 24/79 (30.38%), Postives = 42/79 (53.16%), Query Frame = 1
Query:  778 QGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCEDPE 1014
            +G + LH A   G+ ++   L+  G  ++  D   W P+H A   G  E +  L+  G ++ A++  GET +D+C+D E
Sbjct:   82 EGLTALHQACLWGWEDLAGLLLSRGASVNARDSGLWTPLHAACAQGFTEVVRLLVPRGADLLALSEDGETPFDVCDDHE 160          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Sea Lamprey
Match: ppp1r12a (protein phosphatase 1, regulatory subunit 12A [Source:NCBI gene;Acc:445393])

HSP 1 Score: 130.954 bits (328), Expect = 7.459e-32
Identity = 73/199 (36.68%), Postives = 126/199 (63.32%), Query Frame = 1
Query:  418 CCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKI--DSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCED 1008
             CID +  + + L++  AN+N AD+E WTPLHAAA+C +I+I   LI +GAN+ A+N+E  +P DI E+E   D+++  ++  G+ QD     RKE E  M+RD ++  L +G + ++     G + LH+AA+ GY++V + L++ G  +++ D +GW P+H AA WG+ E    L+ +  N++A+   G+T +D+ ++
Sbjct:    1 ACIDENFDMVKFLVERDANINQADNEGWTPLHAAASCGYIDIAKYLIAHGANVAAVNSESELPLDITEDEALEDMLQEELSKHGVDQDAA---RKEEEQVMMRDARQW-LNSGRIDEVRHPKSGGTALHVAAAKGYIDVIKLLLQAGFDVNVRDNDGWTPLHAAAHWGKDEACRVLVENFCNMEALNKVGQTAFDVSDE 195          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009188.1 (pep scaffold:Pmarinus_7.0:GL490211:2:5317:1 gene:ENSPMAG00000008307.1 transcript:ENSPMAT00000009188.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 110.923 bits (276), Expect = 1.607e-28
Identity = 79/207 (38.16%), Postives = 111/207 (53.62%), Query Frame = 1
Query:  481 AADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAAR-GISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCEDPEINRKLHQIKQELERNYELKKSLQVRPNL 1098
            A DSE+WTPLHAAA C H+ +   L++  A+LLA+NA+GNMPYDICE+E TLD IE AMA++ GI+Q+ I+ KR   EL M+ D+QE+     NL   D  GA+ L +A                                          E L+SHG + DA TY  ET  DLCED ++ ++L  +K  ++R+  ++     R +L
Sbjct:    1 AVDSELWTPLHAAATCGHLHLAQQLVEQRADLLAVNADGNMPYDICEDEVTLDYIETAMASKAGITQETINSKRCATELSMIHDIQEVSRSGENLDGRDEHGATLLEMA------------------------------------------EVLVSHGASFDAKTYQDETPVDLCEDDDMRQRLVDLK--MKRDAIMRTQGHARSSL 163          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004518.1 (pep scaffold:Pmarinus_7.0:GL479228:2601:8668:1 gene:ENSPMAG00000004120.1 transcript:ENSPMAT00000004518.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 76.6406 bits (187), Expect = 1.102e-17
Identity = 36/77 (46.75%), Postives = 54/77 (70.13%), Query Frame = 1
Query:  565 GANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKIDSQGASYL 795
            GA+LLA+N +G+MPYDICEE +TL+ IE AMAA+GI+Q+ ID+ R   E  ++ D++       +L   D+QGA+ +
Sbjct:    1 GADLLAVNVDGDMPYDICEEPDTLEHIEGAMAAKGITQETIDDTRSAVERHLMEDVRRAIANGDSLEHRDTQGATLV 77          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009608.1 (pep scaffold:Pmarinus_7.0:GL477242:23155:61557:-1 gene:ENSPMAG00000008655.1 transcript:ENSPMAT00000009608.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.5001 bits (210), Expect = 1.749e-17
Identity = 78/228 (34.21%), Postives = 114/228 (50.00%), Query Frame = 1
Query:  298 QSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENT--LDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKIDSQG--ASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAV 969
             S  L  AAG   +  V+ LL  GA     ++ GL  LH  C      + +LL++ GA VN AD   +TPLH AAA    EIC  L+ +GA+    N +GN P D+ +E +T   DL+    A        +D  +K      L  +Q+L     N+   DSQG  ++ LH+AA    LEV  +L+EHG  ++  DK G  P+H AA +G ++    LI +   ++A 
Sbjct:  650 HSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKRGAVVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPLDLVKEGDTDIQDLLRGDAAL-------LDAAKKG----CLARVQKL-CSGENVNCRDSQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYSACVNAT 865          

HSP 2 Score: 80.1073 bits (196), Expect = 8.116e-16
Identity = 70/224 (31.25%), Postives = 108/224 (48.21%), Query Frame = 1
Query:  298 QSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAV 969
            +S  L  AAG    D V+ LL  GA+    ++ GL  LH  C      +  LLL+ GA+ NA D+  +TPLH AA    I++C  L+ +GA+    N +G    D+ E          A+      +DE+ E  +    E L  L  L   N N    D + ++ LH+AA    + + + L++HG  +   DK G  P+H A  +G  E  E L+ HG +++A+
Sbjct:  181 KSTPLHFAAGFGRKDVVEHLLQNGANVHARDDGGLIPLHNACSFGHAEVVNLLLRQGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGADPGIRNTDGKTALDLAEP------TAKAVLTGEYKKDELLEAARSGNEEKLMAL--LTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLVKHGASVNAM 396          

HSP 3 Score: 64.3142 bits (155), Expect = 6.782e-11
Identity = 76/274 (27.74%), Postives = 122/274 (44.53%), Query Frame = 1
Query:  298 QSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICE----------EENTLDLIENAMAA------RGISQDEIDEKRKEPELEML-----------RDLQELKLRNG-NLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCEDPEINRKLHQ 1035
            +S  L  AAG   +  V+ LL  GA     ++ GL  LH  C      + +LL++ GA+VNA D   +TPLH AA+   +E+C+ L+ YGA+   LN       D+            E     L++ A  A      + +  D I+ K  +     L           + + EL LR G N+ +      + LH+A+   + +V   L++HG  I++ D  G   +H AA  G L     L+SHG + +  +  G T   L  +  + + LH+
Sbjct:  334 KSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLVKHGASVNAMDLWQFTPLHEAASKNRVEVCSLLLSYGADPTLLNCHSKSAIDLAPTSELKERLVYEFRGHSLLQAAREADVTRVKKHLGLDIINFKHPQTHETALHCAVASPYPKRKQVSELLLRKGANVNEKTKDLLTPLHVASDKAHNDVIDVLLKHGAKINVTDSLGQTSLHRAAHAGHLTTCRLLLSHGCDPNLPSLQGFTAAQLGNE-SVQQILHE 606          

HSP 4 Score: 53.9138 bits (128), Expect = 1.017e-7
Identity = 49/228 (21.49%), Postives = 94/228 (41.23%), Query Frame = 1
Query:  340 DEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEP-----ELEMLRDLQELKLRNGNLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCED 1008
            D +  LL  GA  +V +  G T+LH+      L+ C+LLL  G + N    + +T            +      + ++L   N++         +   LD ++     + ++  +++ +   P         +  ++ L     ++   D  G   LH A S G+ EV   L++ G  +++ D   + P+H AA  G+ E  + L+ HG +       G T  DL ++
Sbjct:  537 DVIDVLLKHGAKINVTDSLGQTSLHRAAHAGHLTTCRLLLSHGCDPNLPSLQGFTAAQLGNESVQQIL------HESSLPVRNSDVEHQLLEAAKAGDLDTVKQLCTTQTVNCRDMEGRHSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKRGAVVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPLDLVKE 758          

HSP 5 Score: 51.6026 bits (122), Expect = 4.928e-7
Identity = 56/213 (26.29%), Postives = 100/213 (46.95%), Query Frame = 1
Query:  328 REDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGIS-QDEIDEKRKEPELEMLRDLQELKLRNGNLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNID 963
            R+ + E+  LL +GA+ +   +D LT LH         +  +LL+ GA +N  DS   T LH AA   H+  C  L+ +G +    + +G     +  E     L E+++  R    + ++ E  K  +L+ ++ L     +  N   ++ + ++ LH AA    + V  +L++HG  +   DK G  P+H A  +G  E  E L+  G  ++
Sbjct:  502 RKQVSEL--LLRKGANVNEKTKDLLTPLHVASDKAHNDVIDVLLKHGAKINVTDSLGQTSLHRAAHAGHLTTCRLLLSHGCDPNLPSLQGFTAAQLGNESVQQILHESSLPVRNSDVEHQLLEAAKAGDLDTVKQL--CTTQTVNCRDMEGRHSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKRGAVVN 710          

HSP 6 Score: 48.9062 bits (115), Expect = 4.154e-6
Identity = 38/113 (33.63%), Postives = 60/113 (53.10%), Query Frame = 1
Query:  319 AAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAM 657
            AAG  +++  + LL  GA  +  ++ GL  LH       + I  LL+++ A VNA D   +TPLH AA     ++CA L+ +GA+    N EG  P D+   ++   L+ +AM
Sbjct:  810 AAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYSACVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPSMKNQEGQTPLDLATADDVRALLIDAM 922          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Yeast
Match: NAS6 (Evolutionarily conserved 19S regulatory particle assembly-chaperone; proteasome-interacting protein involved in the assembly of the base subcomplex of the 19S proteasomal regulatory particle (RP); ortholog of human oncoprotein gankyrin, also known as p28, which interacts with the Rb tumor suppressor and CDK4/6 [Source:SGD;Acc:S000003464])

HSP 1 Score: 52.373 bits (124), Expect = 4.394e-8
Identity = 32/80 (40.00%), Postives = 47/80 (58.75%), Query Frame = 1
Query:  712 LEMLRDLQELKLRNGNLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHG 951
            LE+++ L +  L+  +L KI +QG + LH+A    + EV +FLIE+G  + I DK    P+H AA  G L+ IE L   G
Sbjct:   85 LEVVKSLYDRPLK-PDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLG 163          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Nematostella
Match: EDO43690 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXV8])

HSP 1 Score: 149.058 bits (375), Expect = 1.594e-40
Identity = 103/269 (38.29%), Postives = 153/269 (56.88%), Query Frame = 1
Query:  160 RIKQARKKRITQLKNWYQYDKIMEKQKIRVGKPQKSNFLVKRVHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDA 966
            R   A +KR   L+ W    K  E  +  V + +K      ++ F   +V L A    D+DEVK+LL +GA  +  N DGLTALHQ CID +  + ++L+  GA+++  D+E WT LHAAA+C  +EI   LI+ GA++ A+N EG +P D+ EEE+  DL+ + +  +GI   ++D+ R   E  ML D Q    +N      D   AS LH+A+S GYL+V   L++ GV I+  D + W P+H AA WGQ +  E L  +G + +A
Sbjct:   11 RASNALQKRQDSLRRW----KGSETDRQPVDRSRKK----PKIQFNSGIVFLSAVSSGDVDEVKKLLAKGADINYQNVDGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDLAEEEDMEDLLTDEIENQGI---DVDDARAVEEKIMLNDAQSWLNKNCINESKDKTEASALHVASSKGYLKVIGLLLQLGVEINAKDADNWTPLHAAAHWGQKDACELLSENGADFNA 268          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Nematostella
Match: EDO36720 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHV7])

HSP 1 Score: 81.2629 bits (199), Expect = 4.023e-17
Identity = 71/245 (28.98%), Postives = 122/245 (49.80%), Query Frame = 1
Query:  301 SMVLLEAAGREDIDEVKRLLTEG---ASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELE-MLRD--LQELKLRNGNLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCEDPEI 1017
            S +  +A  R+DI  +  L+       + D+ +EDGLTAL + C   +L + QLL+ +GAN++  D E W+ LHAAA   ++ I   L+  GA++   N  G +P D+  + + + ++   M   G+ +       K P+L+ +++D  +Q L     N+  ++  G S LH  A  G  E  +FL+EHG  ++     G  P+H A   G ++    L+  G ++ A T  G    D+  +  I
Sbjct:   11 SSIFHDAVARKDIVRLAFLMESNRRQFNVDLLDEDGLTALQRACFTGNLKLVQLLVSYGANLDIQDKEGWSVLHAAAVAGNLSILRYLVAVGADVSVRNDLGELPIDVATDVHCVIVLAEGMKRAGLRKLTDKFFAKRPQLKTLIKDSLIQGLD----NVNDLNDSGISLLHEMAGRGDSESVQFLLEHGAEVNRQSLNGSSPLHEAVQSGNIDCTLLLLRSGADLYAETDGGFLPIDIARENTI 251          

HSP 2 Score: 55.4546 bits (132), Expect = 1.662e-8
Identity = 34/118 (28.81%), Postives = 53/118 (44.92%), Query Frame = 1
Query:  655 MAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCED 1008
             A R  S     +     ++  L  L E   R  N+  +D  G + L  A   G L++ + L+ +G  +DI DKEGW  +H AA  G L  +  L++ G ++      GE   D+  D
Sbjct:    4 FAVRKTSSSIFHDAVARKDIVRLAFLMESNRRQFNVDLLDEDGLTALQRACFTGNLKLVQLLVSYGANLDIQDKEGWSVLHAAAVAGNLSILRYLVAVGADVSVRNDLGELPIDVATD 121          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Nematostella
Match: EDO49564 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGN2])

HSP 1 Score: 67.781 bits (164), Expect = 6.686e-13
Identity = 51/140 (36.43%), Postives = 73/140 (52.14%), Query Frame = 1
Query:  217 DKIMEKQKIRVGKPQKSNFLVKRVHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLA-LNAEGNMPYDICEEENT 633
            DK +EK+K R            RV      VLL+AA   +++ VK+++     P   N DG+TALH     N LSI Q L+Q+G +VN  DS  WTPLH AA   ++++   L+++GA + A  N E   P   C+   T
Sbjct:    6 DKDIEKKKSR------------RVILDPHAVLLDAALEGELEHVKQVIKNVEDPSTANSDGITALHNSVCGNHLSIVQFLVQYGCDVNLPDSHGWTPLHCAAVNNNLKVVQFLVEHGACIFATTNLERKTPAQCCDTTAT 133          

HSP 2 Score: 51.2174 bits (121), Expect = 3.107e-7
Identity = 22/67 (32.84%), Postives = 39/67 (58.21%), Query Frame = 1
Query:  772 DSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVT 972
            +S G + LH +    +L + +FL+++G  +++ D  GW P+H AA    L+ ++ L+ HG  I A T
Sbjct:   51 NSDGITALHNSVCGNHLSIVQFLVQYGCDVNLPDSHGWTPLHCAAVNNNLKVVQFLVEHGACIFATT 117          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Nematostella
Match: EDO42946 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S030])

HSP 1 Score: 64.3142 bits (155), Expect = 2.702e-11
Identity = 50/136 (36.76%), Postives = 72/136 (52.94%), Query Frame = 1
Query:  280 KRVHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNED--GLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQD 681
            K V F     LL+A  R+D+DEV  +L +    D+  E+  G+T LH+  I+ S     LLL    +VN  D + WTPLH A    H+   A LI  GA++ A   +   P ++ EE++ L L+  AMAA G+  D
Sbjct:  157 KTVEFDVKFSLLDAIARDDVDEVCEMLRKNPCMDLTVENHLGITPLHRAAIEGSYRCLNLLLSQNVDVNVKDIQGWTPLHDAVYHGHVRCAAALITAGAHVEAETCQYTKPIEMAEEDSMLLLVGRAMAAPGLFFD 292          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Nematostella
Match: EDO38725 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC11])

HSP 1 Score: 62.003 bits (149), Expect = 5.872e-11
Identity = 30/83 (36.14%), Postives = 49/83 (59.04%), Query Frame = 1
Query:  745 LRNGNLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVY 993
            +RNG++  + +     LH+A   G +EVGR L+E G  +D  + +G  P+H+AAC G  + ++ L+S GV ID   +S  T +
Sbjct:   28 IRNGSIEDLSTP----LHVACKKGSMEVGRLLVEKGAALDKKNDKGETPLHMAACIGSFDALKFLLSKGVAIDERDFSHRTPF 106          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Medaka
Match: ppp1r16b (protein phosphatase 1 regulatory subunit 16B [Source:NCBI gene;Acc:101163733])

HSP 1 Score: 283.493 bits (724), Expect = 2.910e-87
Identity = 148/308 (48.05%), Postives = 206/308 (66.88%), Query Frame = 1
Query:  142 RASDLERIKQARKKRITQLKNWYQYDKIMEKQKIRVGKPQKSNFLV------KRVHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCEDPEINRKLHQIKQE 1047
            +   LER++ A+K+R  QLK W  Y+K M+ +K +  K  ++ + +      + V F  S+ LLEA+ R D DEV+ LL    SPD+CNEDGLTALHQCCIDN   + ++LL  GA VNA D+E+WTPLHAAA C H  +   LI +GA+LLA+N++GNMPYD+CE++ TLD+IE AMA RGI+Q+ I+E R   E  ML D+QEL  +   + K D+QGA+ LH+AA+ GY++    L+E G  +D+ D +GWQP+H AACWGQ+   E L+SHG +++  T+  ET  DLCED E    L  +K +
Sbjct:   16 KVPSLERLRAAQKRRAQQLKRWAMYEKEMQNKKRKADKKTRNVYNLGQSEPKRHVSFAASVALLEASARNDPDEVRYLLRSNVSPDLCNEDGLTALHQCCIDNYEDMVKILLDRGACVNAQDNELWTPLHAAATCGHAGLVKILIAHGADLLAVNSDGNMPYDLCEDDPTLDIIETAMANRGITQEMINETRAATERRMLGDIQELLRQGEEVNKKDAQGATLLHVAAANGYVQAAELLLEGGARVDLRDSDGWQPLHAAACWGQMPLAELLVSHGASLNGKTFLEETPIDLCEDEEFRAILLDLKHK 323          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Medaka
Match: ppp1r16a (protein phosphatase 1 regulatory subunit 16A [Source:NCBI gene;Acc:101169245])

HSP 1 Score: 277.715 bits (709), Expect = 9.817e-85
Identity = 163/390 (41.79%), Postives = 227/390 (58.21%), Query Frame = 1
Query:  127 FANRSRASDLERIKQARKKRITQLKNWYQYDKIMEKQKIRV--GKPQKSNFLVKRVHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCEDPEINRKLHQIKQE----LERNYELKKSLQVRPNLSVLGXXXXXXXXXXXXPEDNTVPPGHLIVGSLRRTASIRRSSMREKSLMSRNEARKEAMI 1278
             A   R S  ER+K A+K+R  QLK W Q    MEK  +R    K  K      +V FP S+ LL+AA R D++EV++LL  G SPD+ NEDGLTALHQCCIDN + I Q L+  GA VNA DSE+WTPLHAAA C H  +   LI  GA+LLA+NA+GNMPYD+CE+  TL+L+E AM+ +GI+Q  IDE R   E  ML D+Q L     +L   D  G + LHIA++ GY+ V   L+ +   +++ D +GW P+H A+CWGQ++ +E L++HG +++A +   ET  D+C D E+  KL  +K +    ++     K +LQ R + +                            GS  R   +RR S+ E+S + R E +KEAM+
Sbjct:   12 MATVGRLSATERLKHAQKRRAQQLKAWTQ----MEKDAVRGSRAKADKKKPRTSKVTFPDSVTLLDAAARNDVEEVRQLLNSGVSPDLVNEDGLTALHQCCIDNFVEIVQCLIDAGACVNACDSELWTPLHAAATCGHTGLVQLLIQAGADLLAVNADGNMPYDLCEDVATLELLEVAMSEQGITQSRIDECRGAKEATMLADIQALVQNGADLNAHDDNGTTLLHIASANGYMSVAELLLTNRAELEVKDSDGWTPLHAASCWGQIQIVELLVAHGASLNAKSVLEETPLDVCMDEEVRAKLMDLKHKHDAIMKSQDRQKGTLQKRASST----------------------------GS--RGKVVRRVSVNERSSLYRREHQKEAMV 367          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Medaka
Match: ENSORLT00000007862.2 (protein phosphatase 1 regulatory subunit 12A [Source:NCBI gene;Acc:101168365])

HSP 1 Score: 171.014 bits (432), Expect = 2.282e-44
Identity = 111/329 (33.74%), Postives = 182/329 (55.32%), Query Frame = 1
Query:  145 ASDLERIKQARKKRITQLKNWYQYDKIMEKQKIRVGKPQKSNFLVKR--VHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCED------PEINRKLHQIKQELERNYELKKSLQVRPNLSVL 1107
            A+D  R + A+++R  QL+ W   +     Q +  G+        +R  V F Q  V + A    D +EV  LL +GA  +  N DGLTALHQ CID +  + Q L++ G+++N  D+E WTPLHAA++C  I+I   LI+ GAN+ A+N+EG +P D+  E+    L++  +  +GI   ++D+ RKE E  ML+D   +    G L    +  A+ LH+AA+ GY+EV + L++ GV +D  D +GW P+H AA WGQ E    L     ++ A+   G+T  D+ ++       E+ +K + ++ E E+   +   ++  P +S++
Sbjct:    3 ATDHSRSEAAKQRRQDQLQRWLGSET---DQTVSEGREMSGGSGTRRAKVQFAQGAVFMAACSAGDREEVAALLRQGADINHANVDGLTALHQACIDENAEMVQFLVESGSDINRGDNEGWTPLHAASSCGFIQIARYLIEQGANVGAINSEGELPLDVATEDAMERLLKAEIKKQGI---DVDKARKEEERVMLQDAMAVLEGGGTLTPHPNTKATALHVAAAKGYIEVIKVLLQCGVDVDSRDTDGWTPLHAAAHWGQEEVCSLLADSMCDMGALNNVGQTPLDVADENLVDTLEELQKKQNALRSEKEKQAPV---IETSPQISMV 322          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Medaka
Match: ENSORLT00000036684.1 (protein phosphatase 1 regulatory subunit 12A [Source:NCBI gene;Acc:101168365])

HSP 1 Score: 171.014 bits (432), Expect = 2.453e-44
Identity = 111/329 (33.74%), Postives = 182/329 (55.32%), Query Frame = 1
Query:  145 ASDLERIKQARKKRITQLKNWYQYDKIMEKQKIRVGKPQKSNFLVKR--VHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCED------PEINRKLHQIKQELERNYELKKSLQVRPNLSVL 1107
            A+D  R + A+++R  QL+ W   +     Q +  G+        +R  V F Q  V + A    D +EV  LL +GA  +  N DGLTALHQ CID +  + Q L++ G+++N  D+E WTPLHAA++C  I+I   LI+ GAN+ A+N+EG +P D+  E+    L++  +  +GI   ++D+ RKE E  ML+D   +    G L    +  A+ LH+AA+ GY+EV + L++ GV +D  D +GW P+H AA WGQ E    L     ++ A+   G+T  D+ ++       E+ +K + ++ E E+   +   ++  P +S++
Sbjct:    3 ATDHSRSEAAKQRRQDQLQRWLGSET---DQTVSEGREMSGGSGTRRAKVQFAQGAVFMAACSAGDREEVAALLRQGADINHANVDGLTALHQACIDENAEMVQFLVESGSDINRGDNEGWTPLHAASSCGFIQIARYLIEQGANVGAINSEGELPLDVATEDAMERLLKAEIKKQGI---DVDKARKEEERVMLQDAMAVLEGGGTLTPHPNTKATALHVAAAKGYIEVIKVLLQCGVDVDSRDTDGWTPLHAAAHWGQEEVCSLLADSMCDMGALNNVGQTPLDVADENLVDTLEELQKKQNALRSEKEKQAPV---IETSPQISMV 322          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Medaka
Match: ppp1r12a (protein phosphatase 1 regulatory subunit 12A [Source:NCBI gene;Acc:101161524])

HSP 1 Score: 162.54 bits (410), Expect = 1.989e-41
Identity = 105/285 (36.84%), Postives = 163/285 (57.19%), Query Frame = 1
Query:  160 RIKQARKKRITQLKNWYQYDKIMEKQKIRVGKPQKSNFLVKRVHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKI--DSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCED 1008
            ++  A++KR  QLK W   +   E        P        +V F    V L A    D +EV R+L  GA  +  N DGLTALHQ CID+++ +   L++ GA+VN  D+E W PLHAAA+C +++I   LI  GA++  +N+EG  P DI EEE   +L++N +  +G+   +I+  RKE E  MLRD ++  L +G +  +     G + LH+AA+ GY+EV + LI+ G  ++I D +GW P+H AA WG+ E    L+ +  ++D V   G+T +D+ ++
Sbjct:    2 KMADAKQKRNEQLKRWMGSETDQE--------PPVFKKKKTKVKFDDGAVFLAACSSGDTEEVLRMLDRGADINYANVDGLTALHQACIDDNVDMVTFLVEHGASVNQPDNEGWIPLHAAASCGYLDIAEYLISQGASVGVVNSEGETPLDIAEEEAMGELLKNEINRQGV---DIEAARKEEERIMLRDARQW-LNSGQIQDVRHAKSGGTALHVAAAKGYVEVLKLLIQAGYDVNIKDYDGWTPLHAAAHWGKDEACRILVENLCDMDVVNKMGQTAFDVADE 274          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Planmine SMEST
Match: SMESG000063189.1 (SMESG000063189.1)

HSP 1 Score: 1064.68 bits (2752), Expect = 0.000e+0
Identity = 542/568 (95.42%), Postives = 544/568 (95.77%), Query Frame = 1
Query:   97 MSAEQNEEELFANRSRASDLERIKQARKKRITQLKNWYQYDKIMEKQKIRVGKPQKSNFLVKRVHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCEDPEINRKLHQIKQELERNYELKKSLQVRPNLSVLGXXXXXXXXXXXXPEDNTVPPGHLIVGSLRRTASIRRSSMREKSLMSRNEARKEAMIREVVEKKISEPKYESSIDTKNSGSNTNEINLDQVMLDVQAFSQKEPFVRRGSSRNSFTHSHPYHSPSRDLSLSGECVSEETAVDDSTENTVPLIQTAIRNSHRKITPPKSENFPMGNMTANKANQSYPDSPFVRGLDSNRSGTNNSKRHEKPRHEIENVPLAKPQKTQGCCILM 1800
            MSAEQNEEELFANRSRASDLERIKQARKKRITQLKNWYQYDKIMEKQKIRVGKPQKSNFLVKRVHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPLHAAAACAHIEICACLIDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCEDPEINRKLHQIKQELERNYELKKSLQVRPNLSVLGRRS                       S +R+ASIRRSSMREKSLMSRNEARKEAMIREVVEKKISEPKYESSIDTKNSGSNTNEINLDQVMLDVQAFSQKEPFVRRGSSRNSFTHSHPYHSPSRDLSLSGECVSEETAVDDSTENTVPLIQTAIRNSHRKITPPKSENFPMGNMTANKANQSYPDSPFVRGLDSNRSGTNNSKRHEKPRHEIENVPLAKPQKTQGCCILM
Sbjct:    1 MSAEQNEEELFANRSRASDLERIKQARKKRITQLKNWYQYDKIMEKQKIRVGKPQKSNFLVKRVHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPLHAAAACAHIEICACLIDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCEDPEINRKLHQIKQELERNYELKKSLQVRPNLSVLGRRS----------------------NSSKRSASIRRSSMREKSLMSRNEARKEAMIREVVEKKISEPKYESSIDTKNSGSNTNEINLDQVMLDVQAFSQKEPFVRRGSSRNSFTHSHPYHSPSRDLSLSGECVSEETAVDDSTENTVPLIQTAIRNSHRKITPPKSENFPMGNMTANKANQSYPDSPFVRGLDSNRSGTNNSKRHEKPRHEIENVPLAKPQKTQGCCILM 546          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Planmine SMEST
Match: SMESG000063189.1 (SMESG000063189.1)

HSP 1 Score: 699.123 bits (1803), Expect = 0.000e+0
Identity = 369/369 (100.00%), Postives = 369/369 (100.00%), Query Frame = 1
Query:   97 MSAEQNEEELFANRSRASDLERIKQARKKRITQLKNWYQYDKIMEKQKIRVGKPQKSNFLVKRVHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCEDPEINRKLHQIKQELERNYELKKSLQVRPNLSVLGXXXXXXXXXXXXPEDNTVPPGHLIVGSLRRT 1203
            MSAEQNEEELFANRSRASDLERIKQARKKRITQLKNWYQYDKIMEKQKIRVGKPQKSNFLVKRVHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPLHAAAACAHIEICACLIDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCEDPEINRKLHQIKQELERNYELKKSLQVRPNLSVLGRRSNSSKRRSSSPEDNTVPPGHLIVGSLRRT
Sbjct:    1 MSAEQNEEELFANRSRASDLERIKQARKKRITQLKNWYQYDKIMEKQKIRVGKPQKSNFLVKRVHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPLHAAAACAHIEICACLIDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGNLAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCEDPEINRKLHQIKQELERNYELKKSLQVRPNLSVLGRRSNSSKRRSSSPEDNTVPPGHLIVGSLRRT 369          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Planmine SMEST
Match: SMESG000072178.1 (SMESG000072178.1)

HSP 1 Score: 342.813 bits (878), Expect = 6.476e-109
Identity = 214/513 (41.72%), Postives = 300/513 (58.48%), Query Frame = 1
Query:   82 FFNGKMSAEQNEEELFANRSRASDLERIKQARKKRITQLKNWYQYDKIMEKQKIRVGKPQKSNFLVKR-----VHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGN------LAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCEDPEINRKLHQIKQELERNYELKKSLQVRPNLSVLGXXXXXXXXXXXXPEDNTVPPGHLIVGSLRRTASIRRSSMREKSLMSRNEARKEAMIREVVEKK--------ISEPKYESSIDTKNSGSNTNE------------------------INLDQVMLDVQAFSQKE--PFVRRGSSRNSFTHSHPYHSPSRD 1485
              NG++  +   EE+  NR    D ERI+ A+K+RI QLK W  YDK  EK+++     QK  + + R     V F Q+++LLEA    D DEV+RLL+EG   DV N DGLTALHQC I+ ++ +C++L+ + ANVNA D E+WTPLHAAA C H EIC  LI +GA+LLALN +GNMPYDICE+E TLD+IEN MA++GI+QD+I+  R +PE  ML DL+    R G         ++D QGA+ +HIAA+CGY+ V RFL+  G+PID LDK+GWQ IH+A+    LE IE L+SHG N+D  T  GETVY+L  D +I  KL  +KQ++++  +  ++L      S +G               +T P          R+ASIRR+SM++KS +S  EAR+EA IR  +E+K         S P  + + D  N  S  N                         ++ +Q+  +V+  S     P +   + +++FTH HPY+SP+RD
Sbjct:    5 VVNGRLDPD---EEILQNR--GVDFERIRNAKKRRIIQLKRWAHYDKSKEKEELNR---QKKGYPISRKGPKSVRFCQNLILLEAGNSGDADEVRRLLSEGVCADVANSDGLTALHQCAINKNIDMCRILIHYKANVNAKDKELWTPLHAAAICGHSEICHLLIKHGADLLALNTDGNMPYDICEDEVTLDIIENEMASKGITQDQINVARNQPEQNMLNDLKSSVGRLGQSSALQLFCQLDKQGANQMHIAAACGYVNVTRFLLSLGMPIDALDKDGWQAIHVASLHSHLEVIEVLVSHGANLDCQTKQGETVYELVYDADIYEKLLLLKQQVDKLRDQNQNL-----TSSVGLVRR---------RSSTNP----------RSASIRRTSMKDKSFLSWKEARQEAEIRLSIERKNPTDTNPTASVPHIQENDDPNNRDSFVNNSLRGKHFIVNESIAETDYAENEPILDPNQIDANVKQVSNAWALPGLANKNDKSNFTHCHPYNSPTRD 485          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Planmine SMEST
Match: SMESG000072174.1 (SMESG000072174.1)

HSP 1 Score: 300.056 bits (767), Expect = 1.873e-92
Identity = 204/519 (39.31%), Postives = 291/519 (56.07%), Query Frame = 1
Query:   82 FFNGKMSAEQNEEELFANRSRASDLERIKQARKKRITQLKNWYQYDKIMEKQKIRVGKPQKSNFLVKR-----VHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGN------LAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFI----EKLISHGVNIDAVTYSGETVY--DLCEDPEINRKLHQIKQELERNYELKKSLQVRPNLSVLGXXXXXXXXXXXXPEDNTVPPGHLIVGSLRRTASIRRSSMREKSLMSRNEARKEAMIREVVEKK--------ISEPKYESSIDTKNSGSNTNE------------------------INLDQVMLDVQAFSQKE--PFVRRGSSRNSFTHSHPYHSPSRD 1485
              NG++  +   EE+  NR    D ERI+ A+K+RI QLK W  YDK  EK+++     QK  + + R     V F Q+++LLEA    D DEV+RLL+EG   DV N DGLTALHQC I+ ++ +C++L+ + ANVNA D E+WTPLHAAA C H EIC  LI +GA+LLALN +GNMPYDICE+E TLD+IEN MA++GI+QD+I+  R +PE  ML DL+    R G         ++D QGA+ +HIAA+CGY+ V RFL+  G+PID LDK+GWQ IH+A+    + F         S G+    V  S E  +  +L  D +I  KL  +KQ++++  +  ++L      S +G               +T P          R+ASIRR+SM++KS +S  EAR+EA IR  +E+K         S P  + + D  N  S  N                         ++ +Q+  +V+  S     P +   + +++FTH HPY+SP+RD
Sbjct:    5 VVNGRLDPD---EEILQNR--GVDFERIRNAKKRRIIQLKRWAHYDKSKEKEELNR---QKKGYPISRKGPKSVRFCQNLILLEAGNSGDADEVRRLLSEGVCADVANSDGLTALHQCAINKNIDMCRILIHYKANVNAKDKELWTPLHAAAICGHSEICHLLIKHGADLLALNTDGNMPYDICEDEVTLDIIENEMASKGITQDQINVARNQPEQNMLNDLKSSVGRLGQSSALQLFCQLDKQGANQMHIAAACGYVNVTRFLLSLGMPIDALDKDGWQAIHVASLHSHVSFSGGDRGARQSWGLTW-TVRQSKEKQFTVELVYDADIYEKLLLLKQQVDKLRDQNQNL-----TSSVGLVRR---------RSSTNP----------RSASIRRTSMKDKSFLSWKEARQEAEIRLSIERKNPTDTNPTASVPHIQENDDPNNRDSFVNNSLRGKHFIVNESIAETDYAENEPILDPNQIDANVKQVSNAWALPGLANKNDKSNFTHCHPYNSPTRD 490          
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Planmine SMEST
Match: SMESG000072174.1 (SMESG000072174.1)

HSP 1 Score: 267.7 bits (683), Expect = 8.959e-81
Identity = 148/296 (50.00%), Postives = 198/296 (66.89%), Query Frame = 1
Query:   88 NGKMSAEQNEEELFANRSRASDLERIKQARKKRITQLKNWYQYDKIMEKQKIRVGKPQKSNFLVKR-----VHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNEDGLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPXXXXXXXXXXXXXXXXXDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEKRKEPELEMLRDLQELKLRNGN------LAKIDSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLI 942
            NG++  +   EE+  NR    D ERI+ A+K+RI QLK W  YDK  EK+++     QK  + + R     V F Q+++LLEA    D DEV+RLL+EG   DV N DGLTALHQC I+ ++ +C++L+ + ANVNA D E+WTPLHAAA C H EIC  LI +GA+LLALN +GNMPYDICE+E TLD+IEN MA++GI+QD+I+  R +PE  ML DL+    R G         ++D QGA+ +HIAA+CGY+ V RFL+  G+PID LDK+GWQ IH+A+      + E L 
Sbjct:    7 NGRLDPD---EEILQNR--GVDFERIRNAKKRRIIQLKRWAHYDKSKEKEELNR---QKKGYPISRKGPKSVRFCQNLILLEAGNSGDADEVRRLLSEGVCADVANSDGLTALHQCAINKNIDMCRILIHYKANVNAKDKELWTPLHAAAICGHSEICHLLIKHGADLLALNTDGNMPYDICEDEVTLDIIENEMASKGITQDQINVARNQPEQNMLNDLKSSVGRLGQSSALQLFCQLDKQGANQMHIAAACGYVNVTRFLLSLGMPIDALDKDGWQAIHVASLHSHNFYFEFLF 294          

HSP 2 Score: 61.2326 bits (147), Expect = 1.557e-9
Identity = 29/79 (36.71%), Postives = 42/79 (53.16%), Query Frame = 1
Query:  772 DSQGASYLHIAASCGYLEVGRFLIEHGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYDLCED 1008
            +S G + LH  A    +++ R LI +   ++  DKE W P+H AA  G  E    LI HG ++ A+   G   YD+CED
Sbjct:  104 NSDGLTALHQCAINKNIDMCRILIHYKANVNAKDKELWTPLHAAAICGHSEICHLLIKHGADLLALNTDGNMPYDICED 182          

HSP 3 Score: 51.2174 bits (121), Expect = 1.856e-6
Identity = 39/129 (30.23%), Postives = 62/129 (48.06%), Query Frame = 1
Query: 1201 TASIRRSSMREKSLMSRNEARKEAMIREVVEKK--------ISEPKYESSIDTKNSGSNTNE------------------------INLDQVMLDVQAFSQKE--PFVRRGSSRNSFTHSHPYHSPSRD 1485
            +ASIRR+SM++KS +S  EAR+EA IR  +E+K         S P  + + D  N  S  N                         ++ +Q+  +V+  S     P +   + +++FTH HPY+SP+RD
Sbjct:  307 SASIRRTSMKDKSFLSWKEARQEAEIRLSIERKNPTDTNPTASVPHIQENDDPNNRDSFVNNSLRGKHFIVNESIAETDYAENEPILDPNQIDANVKQVSNAWALPGLANKNDKSNFTHCHPYNSPTRD 435          
The following BLAST results are available for this feature:
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PPP1R16B1.679e-8641.88protein phosphatase 1 regulatory subunit 16B [Sour... [more]
PPP1R16A8.524e-8447.71protein phosphatase 1 regulatory subunit 16A [Sour... [more]
PPP1R16A8.524e-8447.71protein phosphatase 1 regulatory subunit 16A [Sour... [more]
PPP1R16B4.358e-5941.61protein phosphatase 1 regulatory subunit 16B [Sour... [more]
PPP1R12B1.465e-4236.07protein phosphatase 1 regulatory subunit 12B [Sour... [more]
back to top
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gfi-26.861e-7051.72GEI-4 (Four) Interacting protein [Source:UniProtK... [more]
gfi-26.861e-7051.72GEI-4 (Four) Interacting protein [Source:UniProtK... [more]
gfi-26.861e-7051.72GEI-4 (Four) Interacting protein [Source:UniProtK... [more]
gfi-29.540e-7051.72GEI-4 (Four) Interacting protein [Source:UniProtK... [more]
gfi-29.540e-7051.72GEI-4 (Four) Interacting protein [Source:UniProtK... [more]
back to top
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MYPT-75D2.698e-8045.81gene:FBgn0036801 transcript:FBtr0331420[more]
MYPT-75D9.542e-8045.81gene:FBgn0036801 transcript:FBtr0075049[more]
MYPT-75D9.542e-8045.81gene:FBgn0036801 transcript:FBtr0331422[more]
MYPT-75D9.542e-8045.81gene:FBgn0036801 transcript:FBtr0331421[more]
Mbs1.753e-4034.17gene:FBgn0005536 transcript:FBtr0308216[more]
back to top
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp1r16a5.224e-8943.73protein phosphatase 1, regulatory subunit 16A [Sou... [more]
ppp1r16a5.224e-8943.73protein phosphatase 1, regulatory subunit 16A [Sou... [more]
ppp1r16a5.224e-8943.73protein phosphatase 1, regulatory subunit 16A [Sou... [more]
ppp1r16b4.339e-5638.82protein phosphatase 1, regulatory subunit 16B [Sou... [more]
ppp1r16b3.655e-4637.14protein phosphatase 1, regulatory subunit 16B [Sou... [more]
back to top
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nop141.074e-7548.41NOP14 nucleolar protein [Source:Xenbase;Acc:XB-GEN... [more]
ppp1r16b2.118e-7248.44protein phosphatase 1 regulatory subunit 16B [Sour... [more]
PPP1R12A1.269e-3937.19protein phosphatase 1 regulatory subunit 12A [Sour... [more]
PPP1R12A1.574e-3937.19protein phosphatase 1 regulatory subunit 12A [Sour... [more]
lcp12.906e-3736.06lymphocyte cytosolic protein 1 (L-plastin) [Source... [more]
back to top
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ppp1r16b1.846e-8541.88protein phosphatase 1, regulatory subunit 16B [Sou... [more]
Ppp1r16b1.846e-8541.88protein phosphatase 1, regulatory subunit 16B [Sou... [more]
Ppp1r16b1.846e-8541.88protein phosphatase 1, regulatory subunit 16B [Sou... [more]
Ppp1r16a8.885e-8147.39protein phosphatase 1, regulatory subunit 16A [Sou... [more]
Ppp1r16a8.885e-8147.39protein phosphatase 1, regulatory subunit 16A [Sou... [more]
back to top
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q95N27|PP16B_BOVIN3.072e-8639.86Protein phosphatase 1 regulatory inhibitor subunit... [more]
sp|Q96T49|PP16B_HUMAN8.063e-8641.88Protein phosphatase 1 regulatory inhibitor subunit... [more]
sp|Q8VHQ3|PP16B_MOUSE1.291e-8441.88Protein phosphatase 1 regulatory inhibitor subunit... [more]
sp|Q96I34|PP16A_HUMAN4.093e-8347.71Protein phosphatase 1 regulatory subunit 16A OS=Ho... [more]
sp|Q923M0|PP16A_MOUSE6.215e-8047.39Protein phosphatase 1 regulatory subunit 16A OS=Mu... [more]
back to top
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
W6UP994.810e-10847.02Protein phosphatase 1 regulatory inhibitor subunit... [more]
A0A3Q0KGC66.246e-10844.64Protein phosphatase 1 regulatory inhibitor subunit... [more]
A0A4Z2DB469.145e-10846.05Protein phosphatase 1 regulatory subunit 16A isofo... [more]
G4LX821.472e-10744.64Protein phosphatase 1 regulatory inhibitor subunit... [more]
A0A068WG804.152e-10745.80Protein phosphatase 1 regulatory inhibitor OS=Echi... [more]
back to top
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-217a12.11.197e-8943.62si:ch211-217a12.1 [Source:ZFIN;Acc:ZDB-GENE-121214... [more]
ppp1r16b1.322e-8849.51protein phosphatase 1 regulatory subunit 16B [Sour... [more]
si:ch211-217a12.16.888e-8543.62si:ch211-217a12.1 [Source:ZFIN;Acc:ZDB-GENE-121214... [more]
ppp1r12a2.708e-3836.49protein phosphatase 1 regulatory subunit 12A [Sour... [more]
ppp1r12a2.728e-3836.49protein phosphatase 1 regulatory subunit 12A [Sour... [more]
back to top
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000003334.14.163e-5441.96pep scaffold:Pmarinus_7.0:GL479399:737:27806:-1 ge... [more]
ppp1r12a7.459e-3236.68protein phosphatase 1, regulatory subunit 12A [Sou... [more]
ENSPMAT00000009188.11.607e-2838.16pep scaffold:Pmarinus_7.0:GL490211:2:5317:1 gene:E... [more]
ENSPMAT00000004518.11.102e-1746.75pep scaffold:Pmarinus_7.0:GL479228:2601:8668:1 gen... [more]
ENSPMAT00000009608.11.749e-1734.21pep scaffold:Pmarinus_7.0:GL477242:23155:61557:-1 ... [more]
back to top
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
NAS64.394e-840.00Evolutionarily conserved 19S regulatory particle a... [more]
back to top
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO436901.594e-4038.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO367204.023e-1728.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495646.686e-1336.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO429462.702e-1136.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387255.872e-1136.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp1r16b2.910e-8748.05protein phosphatase 1 regulatory subunit 16B [Sour... [more]
ppp1r16a9.817e-8541.79protein phosphatase 1 regulatory subunit 16A [Sour... [more]
ENSORLT00000007862.22.282e-4433.74protein phosphatase 1 regulatory subunit 12A [Sour... [more]
ENSORLT00000036684.12.453e-4433.74protein phosphatase 1 regulatory subunit 12A [Sour... [more]
ppp1r12a1.989e-4136.84protein phosphatase 1 regulatory subunit 12A [Sour... [more]
back to top
BLAST of Protein phosphatase 1 regulatory inhibitor subunit 16a vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000063189.10.000e+095.42SMESG000063189.1[more]
SMESG000063189.10.000e+0100.00SMESG000063189.1[more]
SMESG000072178.16.476e-10941.72SMESG000072178.1[more]
SMESG000072174.11.873e-9239.31SMESG000072174.1[more]
SMESG000072174.18.959e-8150.00SMESG000072174.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031890 ID=SMED30031890|Name=Protein phosphatase 1 regulatory inhibitor subunit 16a|organism=Schmidtea mediterranea sexual|type=transcript|length=1923bp
TTTAAATTTTATTAAATATTGTTTTTTTCAAGAAATTTATTTGTTTCCGG
TGATTATCTATAAATTATTTCATCAGAATAATTTTTCAACGGTAAAATGT
CAGCAGAACAAAACGAAGAAGAATTATTTGCTAATAGAAGTCGCGCATCT
GATTTAGAACGCATAAAACAAGCGCGTAAAAAACGCATTACTCAATTAAA
AAATTGGTATCAATATGATAAAATTATGGAAAAACAAAAAATACGAGTTG
GCAAACCACAGAAATCAAACTTTTTAGTCAAACGAGTCCATTTTCCACAA
AGCATGGTTTTACTTGAAGCTGCAGGTAGAGAAGATATCGATGAAGTTAA
ACGACTTTTAACGGAAGGTGCAAGTCCTGATGTGTGCAATGAAGATGGGT
TAACAGCACTTCACCAATGTTGTATTGACAATAGTTTGAGTATTTGTCAA
TTACTTCTGCAATTTGGTGCCAATGTCAATGCTGCTGACAGTGAAATGTG
GACACCCCTGCACGCTGCGGCCGCTTGTGCTCATATCGAAATTTGTGCTT
GTCTCATTGATTATGGTGCAAATTTACTTGCTCTTAATGCTGAAGGCAAT
ATGCCTTATGATATATGTGAGGAAGAAAATACACTGGATTTAATTGAGAA
TGCCATGGCAGCTAGGGGGATTAGTCAGGATGAAATTGATGAGAAAAGAA
AGGAACCGGAATTGGAAATGCTTCGAGATCTTCAAGAACTTAAATTGAGA
AACGGAAATCTAGCAAAGATCGATAGCCAGGGAGCTTCATATCTTCACAT
TGCTGCTTCTTGTGGATATTTGGAGGTAGGGCGATTTTTGATAGAGCATG
GAGTTCCTATAGATATTCTGGATAAAGAAGGATGGCAACCCATACACATT
GCTGCATGTTGGGGTCAACTAGAATTCATTGAAAAGTTAATTTCTCACGG
AGTGAACATTGATGCAGTGACATATTCGGGAGAAACGGTTTATGACCTAT
GTGAAGATCCAGAAATTAATCGTAAGTTACATCAAATCAAACAAGAACTT
GAGCGCAATTATGAGTTGAAAAAATCTTTACAAGTCCGACCAAACTTATC
CGTCCTCGGACGACGAAGTAATTCCAGTAAAAGAAGGTCATCTAGCCCCG
AAGATAACACAGTCCCACCTGGACATCTGATTGTAGGATCCTTACGTCGC
ACCGCTTCTATTAGAAGAAGTAGTATGAGGGAAAAATCTCTCATGTCTCG
GAATGAAGCTAGAAAAGAGGCTATGATACGAGAAGTTGTTGAAAAAAAGA
TATCAGAACCGAAATATGAATCGTCTATTGATACTAAAAATTCTGGTTCA
AATACAAATGAAATCAATTTAGATCAAGTGATGTTGGATGTACAAGCGTT
TTCACAAAAAGAGCCTTTTGTCCGCCGGGGTTCGAGTCGAAATAGTTTCA
CACATTCACACCCATATCATAGTCCGTCGCGTGATTTGTCATTGAGCGGT
GAGTGCGTCAGTGAGGAGACGGCAGTTGATGATAGTACAGAAAACACTGT
GCCTCTCATTCAAACTGCAATACGAAATAGTCATCGCAAAATTACGCCAC
CGAAATCCGAAAATTTCCCAATGGGAAATATGACTGCCAATAAAGCGAAC
CAAAGTTATCCAGACTCGCCATTTGTTCGCGGTTTGGATTCTAATAGATC
AGGAACAAATAATTCAAAAAGACATGAAAAACCTCGACATGAAATTGAAA
ATGTTCCATTAGCTAAGCCACAAAAAACCCAAGGATGTTGCATACTTATG
TGATACTTCAAACATTTCTTAAGATTTGACATCTTGCTTCTGCCACCTGC
TAAAACCGAATTTCTTGTAATTTAGTTCATCGTTTCTATTGGTCGGTTTA
TTATTTGTATTACTAAAAAGAGC
back to top

protein sequence of SMED30031890-orf-1

>SMED30031890-orf-1 ID=SMED30031890-orf-1|Name=SMED30031890-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=569bp
MSAEQNEEELFANRSRASDLERIKQARKKRITQLKNWYQYDKIMEKQKIR
VGKPQKSNFLVKRVHFPQSMVLLEAAGREDIDEVKRLLTEGASPDVCNED
GLTALHQCCIDNSLSICQLLLQFGANVNAADSEMWTPLHAAAACAHIEIC
ACLIDYGANLLALNAEGNMPYDICEEENTLDLIENAMAARGISQDEIDEK
RKEPELEMLRDLQELKLRNGNLAKIDSQGASYLHIAASCGYLEVGRFLIE
HGVPIDILDKEGWQPIHIAACWGQLEFIEKLISHGVNIDAVTYSGETVYD
LCEDPEINRKLHQIKQELERNYELKKSLQVRPNLSVLGRRSNSSKRRSSS
PEDNTVPPGHLIVGSLRRTASIRRSSMREKSLMSRNEARKEAMIREVVEK
KISEPKYESSIDTKNSGSNTNEINLDQVMLDVQAFSQKEPFVRRGSSRNS
FTHSHPYHSPSRDLSLSGECVSEETAVDDSTENTVPLIQTAIRNSHRKIT
PPKSENFPMGNMTANKANQSYPDSPFVRGLDSNRSGTNNSKRHEKPRHEI
ENVPLAKPQKTQGCCILM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0019888protein phosphatase regulator activity
Vocabulary: biological process
TermDefinition
GO:0051489regulation of filopodium assembly
GO:0061028establishment of endothelial barrier
GO:1902309negative regulation of peptidyl-serine dephosphorylation
GO:1903589positive regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis
GO:0001938positive regulation of endothelial cell proliferation
GO:0014066regulation of phosphatidylinositol 3-kinase signaling
GO:0035307positive regulation of protein dephosphorylation
GO:0035308negative regulation of protein dephosphorylation
GO:0050790regulation of catalytic activity
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005886plasma membrane
GO:0016020membrane
GO:0016607nuclear speck
GO:0042995cell projection
GO:0048471perinuclear region of cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 228..257
e-value: 0.66
score: 19.0
coord: 67..96
e-value: 3500.0
score: 0.9
coord: 100..129
e-value: 3.7E-4
score: 29.8
coord: 133..162
e-value: 0.0013
score: 28.0
coord: 261..290
e-value: 5.6E-5
score: 32.5
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 261..293
score: 11.327
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 228..260
score: 11.728
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 133..165
score: 9.858
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 100..132
score: 12.022
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 21..190
e-value: 1.3E-44
score: 153.6
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 191..327
e-value: 7.1E-28
score: 98.8
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 58..303
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 74..160
e-value: 4.7E-13
score: 49.5
coord: 219..290
e-value: 8.5E-11
score: 42.3
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 72..297
score: 41.301
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 537..554
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 527..556
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 443..465
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 335..362
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 335..355
NoneNo IPR availablePANTHERPTHR24186:SF6PROTEIN PHOSPHATASE 1 REGULATORY INHIBITOR SUBUNIT 16Bcoord: 16..347
NoneNo IPR availablePANTHERPTHR24186FAMILY NOT NAMEDcoord: 16..347