Family with sequence similarity 227 member B

Overview
NameFamily with sequence similarity 227 member B
Smed IDSMED30031880
Length (bp)1592
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Family with sequence similarity 227 member B (SMED30031880) t-SNE clustered cells

Violin plots show distribution of expression levels for Family with sequence similarity 227 member B (SMED30031880) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Family with sequence similarity 227 member B (SMED30031880) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Family with sequence similarity 227 member B (SMED30031880) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031880

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30031880SMESG000052176.1 SMESG000046302.1 SmedASXL_016775SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30031880SMESG000052176.1 SMESG000046302.1 dd_Smed_v4_15102_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30031880SMESG000052176.1 SMESG000046302.1 dd_Smed_v4_15102_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30031880SMESG000052176.1 SMESG000046302.1 dd_Smed_v4_15102_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parapharyngeal cellSMED30031880SMESG000052176.1 SMESG000046302.1 dd_Smed_v4_15102_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30031880SMESG000052176.1 SMESG000046302.1 dd_Smed_v4_15102_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30031880SMESG000052176.1 SMESG000046302.1 dd_Smed_v6_15102_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Family with sequence similarity 227 member B vs. Ensembl Human
Match: FAM227B (family with sequence similarity 227 member B [Source:HGNC Symbol;Acc:HGNC:26543])

HSP 1 Score: 112.079 bits (279), Expect = 1.154e-25
Identity = 90/277 (32.49%), Postives = 129/277 (46.57%), Query Frame = 2
Query:  461 DNKALPKLIELCQHPGFNWIKITELPFSVQPE----FILKRVHESQPLTFIKIYKEFFDKWFYCQKIQDLLKDMFWYIFISKYGSDVDKKDLSNYFSRASESYVGFLFKITMEKPYYQEKFKKVLPNLLSQALYVALSECFPDSWIQFNNDFVENIMQLVFFWLSGIRPTKGSWSCWNMEELKPT---------EQKLKEKAIEEQLRIGFS-DLQIEK--KTPEKDQLKNS--------VSTKSTLLGALNHSNNVLFNVSGHSPLIQWYFKKNNI 1219
            D     K IE C   GF   ++T+LP  +  E    FILK  H      F KI+K  F      +    LL D FW+ F+ K+  D + +D    F R SESYV     I + +   ++ F ++ P+ L+QA+Y    E FP+S   FN++F E++   +F W SG++P KG W  W ++EL  T          + +KE+  + Q  I  S D  I K    P    L  S        ++TKS         N VLFN  G SPLI +Y K + +
Sbjct:  138 DEMETEKNIEGCSFTGFKANELTQLPRHLDAEQIYLFILK-AHNFDERVF-KIWKTHF----LSEASIALLHDSFWWWFLHKFRPDRENQDC--LFDRISESYVTLFMSIPLSR---KDAFFQIYPDCLAQAIYATFHEAFPESSYLFNDEFKEDLGNNIFLWCSGLKPQKGFWIHWKLKELSTTTIHGSKKAPAKSVKERIADSQEHISTSIDFNIIKILNNPRAYTLPISKEESRLSRLATKSHYSSTGPEFNRVLFNFGGQSPLILYYLKMHEL 403          
BLAST of Family with sequence similarity 227 member B vs. Ensembl Human
Match: FAM227A (family with sequence similarity 227 member A [Source:HGNC Symbol;Acc:HGNC:44197])

HSP 1 Score: 78.9518 bits (193), Expect = 6.889e-15
Identity = 79/336 (23.51%), Postives = 150/336 (44.64%), Query Frame = 2
Query:   32 YFKMNTLNRFCSPMHPMDENLDDTDIIREKKIEFIKLRELTKSPYS--IGSVIDIENKISKLEEQIKGFETKISWEDIDSDEVVDNGGNDNQIQVNLNIKKEKKEVEKFAGIFSVISTVDFNKPERIKKIVXXXXXXXXXXXXHFDNKALPKLIELCQHPGFNWIKITELPFSVQPEFILKRVHESQPLTFIKIYKEFFDKWFYC--QKIQDLLK---------DMFWYIFISKYGSDVDKKDLSNYFSRASESYVGFLFKITMEKPYYQEKFKKVLPNLLSQALYVALSECFPDSWIQFNNDFVENIMQLVFFWLSGIRPTKGSWSCWNMEELKP 1000
            + KM  +N    PM P+DE+L  + + R   ++ ++ +EL  +P S  IGS+  +  KI+ +  + +     ++ E  + ++        +  +  +  +++ +   K + +    S+V       IK+                 +K L  L EL Q+  FN  K  +LP  V    ++  V        ++  ++      +C  ++++  L          D FW+IF  +Y    +K+  +N F R ++ Y   LF++   K + +E   K LP+LLS+A+Y +   CFP SW    ++F  +I   +  W+SG  P+  S+  W+  EL P
Sbjct:    4 FRKMEVINLTTLPMIPVDEHLAVSLVARNTMVKTVR-KELENNPPSCLIGSMHQVNQKIADINLRTEPSANSLAIERFELEKKALREKTRSSPEDKVKRQRKSQYSCKGSELRHARSSV-------IKRKTA--------------DKNL--LAELYQYSNFNSSKPNKLPNGVDFCDMVGNV--------VRAERDCLSGKHFCSGRELEKFLSSSSPRAIWLDSFWWIFHERY--QPNKELQNNLFDRIAQHYALLLFRVP--KSHSEEALLKRLPSLLSKAVYTSFCCCFPQSWFD-THEFKSDICNTMSLWISGTYPSPQSYDSWDYSELDP 302          
BLAST of Family with sequence similarity 227 member B vs. Ensembl Human
Match: FAM227A (family with sequence similarity 227 member A [Source:HGNC Symbol;Acc:HGNC:44197])

HSP 1 Score: 78.9518 bits (193), Expect = 7.370e-15
Identity = 79/336 (23.51%), Postives = 150/336 (44.64%), Query Frame = 2
Query:   32 YFKMNTLNRFCSPMHPMDENLDDTDIIREKKIEFIKLRELTKSPYS--IGSVIDIENKISKLEEQIKGFETKISWEDIDSDEVVDNGGNDNQIQVNLNIKKEKKEVEKFAGIFSVISTVDFNKPERIKKIVXXXXXXXXXXXXHFDNKALPKLIELCQHPGFNWIKITELPFSVQPEFILKRVHESQPLTFIKIYKEFFDKWFYC--QKIQDLLK---------DMFWYIFISKYGSDVDKKDLSNYFSRASESYVGFLFKITMEKPYYQEKFKKVLPNLLSQALYVALSECFPDSWIQFNNDFVENIMQLVFFWLSGIRPTKGSWSCWNMEELKP 1000
            + KM  +N    PM P+DE+L  + + R   ++ ++ +EL  +P S  IGS+  +  KI+ +  + +     ++ E  + ++        +  +  +  +++ +   K + +    S+V       IK+                 +K L  L EL Q+  FN  K  +LP  V    ++  V        ++  ++      +C  ++++  L          D FW+IF  +Y    +K+  +N F R ++ Y   LF++   K + +E   K LP+LLS+A+Y +   CFP SW    ++F  +I   +  W+SG  P+  S+  W+  EL P
Sbjct:    4 FRKMEVINLTTLPMIPVDEHLAVSLVARNTMVKTVR-KELENNPPSCLIGSMHQVNQKIADINLRTEPSANSLAIERFELEKKALREKTRSSPEDKVKRQRKSQYSCKGSELRHARSSV-------IKRKTA--------------DKNL--LAELYQYSNFNSSKPNKLPNGVDFCDMVGNV--------VRAERDCLSGKHFCSGRELEKFLSSSSPRAIWLDSFWWIFHERY--QPNKELQNNLFDRIAQHYALLLFRVP--KSHSEEALLKRLPSLLSKAVYTSFCCCFPQSWFD-THEFKSDICNTMSLWISGTYPSPQSYDSWDYSELDP 302          
BLAST of Family with sequence similarity 227 member B vs. Ensembl Human
Match: FAM227A (family with sequence similarity 227 member A [Source:HGNC Symbol;Acc:HGNC:44197])

HSP 1 Score: 78.5666 bits (192), Expect = 9.033e-15
Identity = 79/336 (23.51%), Postives = 150/336 (44.64%), Query Frame = 2
Query:   32 YFKMNTLNRFCSPMHPMDENLDDTDIIREKKIEFIKLRELTKSPYS--IGSVIDIENKISKLEEQIKGFETKISWEDIDSDEVVDNGGNDNQIQVNLNIKKEKKEVEKFAGIFSVISTVDFNKPERIKKIVXXXXXXXXXXXXHFDNKALPKLIELCQHPGFNWIKITELPFSVQPEFILKRVHESQPLTFIKIYKEFFDKWFYC--QKIQDLLK---------DMFWYIFISKYGSDVDKKDLSNYFSRASESYVGFLFKITMEKPYYQEKFKKVLPNLLSQALYVALSECFPDSWIQFNNDFVENIMQLVFFWLSGIRPTKGSWSCWNMEELKP 1000
            + KM  +N    PM P+DE+L  + + R   ++ ++ +EL  +P S  IGS+  +  KI+ +  + +     ++ E  + ++        +  +  +  +++ +   K + +    S+V       IK+                 +K L  L EL Q+  FN  K  +LP  V    ++  V        ++  ++      +C  ++++  L          D FW+IF  +Y    +K+  +N F R ++ Y   LF++   K + +E   K LP+LLS+A+Y +   CFP SW    ++F  +I   +  W+SG  P+  S+  W+  EL P
Sbjct:    4 FRKMEVINLTTLPMIPVDEHLAVSLVARNTMVKTVR-KELENNPPSCLIGSMHQVNQKIADINLRTEPSANSLAIERFELEKKALREKTRSSPEDKVKRQRKSQYSCKGSELRHARSSV-------IKRKTA--------------DKNL--LAELYQYSNFNSSKPNKLPNGVDFCDMVGNV--------VRAERDCLSGKHFCSGRELEKFLSSSSPRAIWLDSFWWIFHERY--QPNKELQNNLFDRIAQHYALLLFRVP--KSHSEEALLKRLPSLLSKAVYTSFCCCFPQSWFD-THEFKSDICNTMSLWISGTYPSPQSYDSWDYSELDP 302          
BLAST of Family with sequence similarity 227 member B vs. Ensembl Human
Match: FAM227B (family with sequence similarity 227 member B [Source:HGNC Symbol;Acc:HGNC:26543])

HSP 1 Score: 69.707 bits (169), Expect = 1.838e-12
Identity = 57/206 (27.67%), Postives = 86/206 (41.75%), Query Frame = 2
Query:  461 DNKALPKLIELCQHPGFNWIKITELPFSVQPE----FILKRVHESQPLTFIKIYKEFFDKWFYCQKIQDLLKDMFWYIFISKYGSDVDKKDLSNYFSRASESYVGFLFKITMEKPYYQEKFKKVLPNLLSQALYVALSECFPDSWIQFNNDFVENIMQLVFFWLSGIRPTKGSWSCWNMEELKPTEQKLKEKAIEEQLRIGFSDLQ 1066
            D     K IE C   GF   ++T+LP  +  E    FILK  H      F KI+K  F      +    LL D FW+ F+ K+                                       ++ P+ L+QA+Y    E FP+S   FN++F E++   +F W SG++P KG W  W ++EL  T     +KA  + ++   +D Q
Sbjct:  138 DEMETEKNIEGCSFTGFKANELTQLPRHLDAEQIYLFILK-AHNFDERVF-KIWKTHF----LSEASIALLHDSFWWWFLHKF---------------------------------------RIYPDCLAQAIYATFHEAFPESSYLFNDEFKEDLGNNIFLWCSGLKPQKGFWIHWKLKELSTTTIHGSKKAPAKSVKERIADSQ 298          
BLAST of Family with sequence similarity 227 member B vs. Ensembl Xenopus
Match: ENSXETT00000000957.1 (family with sequence similarity 227 member A [Source:NCBI gene;Acc:100495201])

HSP 1 Score: 127.872 bits (320), Expect = 3.241e-31
Identity = 135/509 (26.52%), Postives = 243/509 (47.74%), Query Frame = 2
Query:   41 MNTLNRFCSPMHPMDENLDDT--DIIREKKIEFIKLRELTKSP--YSIGSVIDIENKISKLEEQIKGFETKISWEDIDSDE----VVDNGGNDNQIQVNLN-IKKEKKEVEKFAGIFSVISTVDFNKPERIKKIVXXXXXXXXXXXXHFDNKALPKLIELCQHPGFNWIKITELPFSVQPEFILKRVHESQPLTFIKIYK-EFFDKWFYCQKIQDLLKDMFWYIFISKYGSDVDKKDLSNYFSRASESYVGFLFKITMEKPYYQEKFKKVLPNLLSQALYVALSECFPDSWIQF-NNDFVENIMQLVFFWLSGIRPTKGSWSCWNMEELKPTEQKL--KEKAI------EEQLRIGF---SDLQIEKKTPEKDQLKNSVSTKSTLLGALNHSNNVLFNVSGHSPLIQWYFKKNNININVGTSNLVKHKEILPRLNEDNSETLADVVSKSVKSLQSRKM-IYKKFLER--NSLETKRFQKLQKISNFSNEKRQEKLLLNKSKIHKLSNLI 1492
            M+ +NR    M P +E L     DI + K+      +E+T+SP  + IGS+  +  +I+ L+ +      K + ED+ S      V D  G   + +   N I+ E+K +EKF   +  +      + + I K +                K+ P+++EL Q  G +    T LP+ +  + I+ RV  +   T  KI   +   +       ++++ D FW+I++ KY  D + +     F R +E+Y+  L  +T ++ ++ E F KV P++LSQA+Y +    FP S  +F  +DF   +  L++ W+ GI P+ G +  W+   L+P    +  K+K +      E + + GF   +  +I + T E        S  +    A  H    LF++SGHSPL+Q+Y ++NN     G + LV   EI  ++   +S T A+++ +  + L  +++ +  KF +R   SLE  R  +  K     NEK   ++L +K+++ ++S  I
Sbjct:    1 MDWINRLSCSMAPYEEELTKGYLDIYQSKES---ARKEITESPACFLIGSIESVNQRIAHLDMKT----NKCNSEDLGSRGFSSLVYDAQGKPLKAEQKQNKIESEQKVLEKFTHRYEHLFLEHHQETQDIGKKML---------------KSTPRMVELYQFSGRSDAGPTPLPYGIALDTIIDRVVSAHENTGGKICSPKEVRRNLSSLVTKEMILDCFWWIYLHKYKPDTECQ--KQLFDRVAENYIKLL-GVTFDQ-HHGEAFLKVFPSVLSQAIYSSFCFSFPQSLYRFQTDDFRTQLCNLLWQWIGGISPSPGCYKTWDFHILEPEVDMVHGKQKQVSDIINGEGKTQGGFVTSTQTRIHRVTKE--------SHPACCGPAFTHK---LFSLSGHSPLVQYYLQENNSKPRTGINILVHRTEIKKQV--ISSMTYAELIKQGFQRLHKQEIEVNTKFRKRWKESLEFDRSLQNAKREFLKNEK---QILSHKAEVKRISQQI 467          
BLAST of Family with sequence similarity 227 member B vs. Ensembl Xenopus
Match: ENSXETT00000055522.1 (family with sequence similarity 227 member B [Source:NCBI gene;Acc:101733874])

HSP 1 Score: 97.0561 bits (240), Expect = 4.346e-21
Identity = 80/283 (28.27%), Postives = 133/283 (47.00%), Query Frame = 2
Query:  485 IELCQHPGFNWIKITELPFSVQPEFILKRVHESQPLTF--IKIYKEFFDKWFYCQKIQDLLKDMFWYIFISKYGSDVDKKDLSNYFSRASESYVGFLFKITMEKPYYQEKFKKVLPNLLSQALYVALSECFPDSWIQFNNDFVENIMQLVFFWLSGIRPTKGSWSCWNMEELKPTE----------------QKLKEKAIEEQLRIGFSDL-QIEKKTPEKD--QLKNSVSTKSTLLGALNHSNNVLFNVSGHSPLIQWYFKKNNINI--NVGTSNLVKHKEI 1264
            +E C    F   +  +LP  V+   IL  V ++Q +    +K  K+FF      +    +L+D FW+    ++  D    D +  F R S S+    + +       ++ F K+ P+ LSQA++    E FP+S + FN+ F   +M L+F W+SG++P   SW+ W++  L+ T                  K  +K  E QL     DL Q  ++T      ++K+  +T+S  +G     ++VLF + GHSPLI  Y K + +      G ++ VKH EI
Sbjct:  128 VENCVLTIFKSNECIKLPGCVEAAQILNLVTKAQNIKGDNLKAMKKFF----LSEASVAVLQDSFWWFLCQQFKPD--HADQNYLFDRISASFTNLFWSVPHN---VKDFFFKIYPDCLSQAIFAVFYEAFPESRVLFNDKFKSEVMDLIFQWVSGVKPAPCSWAHWDLSLLERTNLNVDKIHNNLTKNDETHKSLQKNGEWQLNFNLDDLIQKARETYHSSVHEVKDVHATESHCIGPGPEFHHVLFKLGGHSPLISNYLKMHKLPGCEEEGQNHKVKHVEI 401          
BLAST of Family with sequence similarity 227 member B vs. Ensembl Mouse
Match: Fam227b (family with sequence similarity 227, member B [Source:MGI Symbol;Acc:MGI:1923073])

HSP 1 Score: 111.694 bits (278), Expect = 1.180e-25
Identity = 78/260 (30.00%), Postives = 128/260 (49.23%), Query Frame = 2
Query:  656 LLKDMFWYIFISKYGSDVDKKDLSNYFSRASESYVGFLFKITMEKPYYQEKFKKVLPNLLSQALYVALSECFPDSWIQFNNDFVENIMQLVFFWLSGIRPTKGSWSCWNMEELKPT--------EQKLKEKAIEEQLRI-GFSDLQIEK--KTPE--------KDQLKNSVSTKSTLLGALNHS-NNVLFNVSGHSPLIQWYFKKNNININVGTSNLVKHKEILPRLNEDN-SETLADVVSKSVKSLQSRKMIYKKFLER 1372
            LL D FW+ F+ K+  D  K+D    F R +ESYV    KI + +   ++ F K+ P+ L+QA+Y    E FP+S   FN+ F E++   +F WLSG++P  G W+ W +++L  T          KL+   I  Q  I G  DL+IE   K P         K+ + +  +TK +   +L    + VLF+  G SPLI +Y K + +   +  ++  K  +    L E + + T  D++  + +     K  +K+  +R
Sbjct:  190 LLHDSFWWWFLHKFKPD--KRDEDFLFDRIAESYVTLFIKIPLRR---KDAFFKMYPDCLTQAVYTTFQESFPESCSLFNDKFKEDLGNTIFLWLSGLKPETGFWTHWKLQDLCTTTIHGSRRVPVKLRRSVIPSQEHIPGIRDLKIEDILKNPRAYAMPKLMKESVASKAATKPSHYRSLGPEFHKVLFDFGGQSPLILYYLKMHELG-GISVTHNPKGTKFTKILREPSPAPTYCDIIRDAKRKFADNKKDFKRVKQR 443          
BLAST of Family with sequence similarity 227 member B vs. Ensembl Mouse
Match: Fam227b (family with sequence similarity 227, member B [Source:MGI Symbol;Acc:MGI:1923073])

HSP 1 Score: 111.694 bits (278), Expect = 1.180e-25
Identity = 78/260 (30.00%), Postives = 128/260 (49.23%), Query Frame = 2
Query:  656 LLKDMFWYIFISKYGSDVDKKDLSNYFSRASESYVGFLFKITMEKPYYQEKFKKVLPNLLSQALYVALSECFPDSWIQFNNDFVENIMQLVFFWLSGIRPTKGSWSCWNMEELKPT--------EQKLKEKAIEEQLRI-GFSDLQIEK--KTPE--------KDQLKNSVSTKSTLLGALNHS-NNVLFNVSGHSPLIQWYFKKNNININVGTSNLVKHKEILPRLNEDN-SETLADVVSKSVKSLQSRKMIYKKFLER 1372
            LL D FW+ F+ K+  D  K+D    F R +ESYV    KI + +   ++ F K+ P+ L+QA+Y    E FP+S   FN+ F E++   +F WLSG++P  G W+ W +++L  T          KL+   I  Q  I G  DL+IE   K P         K+ + +  +TK +   +L    + VLF+  G SPLI +Y K + +   +  ++  K  +    L E + + T  D++  + +     K  +K+  +R
Sbjct:  190 LLHDSFWWWFLHKFKPD--KRDEDFLFDRIAESYVTLFIKIPLRR---KDAFFKMYPDCLTQAVYTTFQESFPESCSLFNDKFKEDLGNTIFLWLSGLKPETGFWTHWKLQDLCTTTIHGSRRVPVKLRRSVIPSQEHIPGIRDLKIEDILKNPRAYAMPKLMKESVASKAATKPSHYRSLGPEFHKVLFDFGGQSPLILYYLKMHELG-GISVTHNPKGTKFTKILREPSPAPTYCDIIRDAKRKFADNKKDFKRVKQR 443          
BLAST of Family with sequence similarity 227 member B vs. Ensembl Mouse
Match: Fam227b (family with sequence similarity 227, member B [Source:MGI Symbol;Acc:MGI:1923073])

HSP 1 Score: 110.153 bits (274), Expect = 3.861e-25
Identity = 78/260 (30.00%), Postives = 126/260 (48.46%), Query Frame = 2
Query:  656 LLKDMFWYIFISKYGSDVDKKDLSNYFSRASESYVGFLFKITMEKPYYQEKFKKVLPNLLSQALYVALSECFPDSWIQFNNDFVENIMQLVFFWLSGIRPTKGSWSCWNMEELKPT--------EQKLKEKAIEEQLRI-GFSDLQIEK--KTPE--------KDQLKNSVSTKSTLLGALNHS-NNVLFNVSGHSPLIQWYFKKNNININVGTSNLVKHKEILPRLNEDNS-ETLADVVSKSVKSLQSRKMIYKKFLER 1372
            LL D FW+ F+ K+  D  K+D    F R +ESYV    KI + +   ++ F K+ P+ L+QA+Y    E FP+S   FN+ F E++   +F WLSG++P  G W+ W +++L  T          KL+   I  Q  I G  DL+IE   K P         K+ + +  +TK +   +L    + VLF+  G SPLI +Y K + +   +  ++  K  +    L E     T  D++  + +     K  +K+  +R
Sbjct:  190 LLHDSFWWWFLHKFKPD--KRDEDFLFDRIAESYVTLFIKIPLRR---KDAFFKMYPDCLTQAVYTTFQESFPESCSLFNDKFKEDLGNTIFLWLSGLKPETGFWTHWKLQDLCTTTIHGSRRVPVKLRRSVIPSQEHIPGIRDLKIEDILKNPRAYAMPKLMKESVASKAATKPSHYRSLGPEFHKVLFDFGGQSPLILYYLKMHELG-GISVTHNPKGTKFTKILREPYPFPTYCDIIRDAKRKFADNKKDFKRVKQR 443          
BLAST of Family with sequence similarity 227 member B vs. Ensembl Mouse
Match: Fam227a (family with sequence similarity 227, member A [Source:MGI Symbol;Acc:MGI:1922979])

HSP 1 Score: 71.2478 bits (173), Expect = 1.684e-12
Identity = 55/176 (31.25%), Postives = 87/176 (49.43%), Query Frame = 2
Query:  482 LIELCQHPGFNWIKITELPFSVQPEFILKRV--HESQPLTFIKIYKEFFDKWFYCQK-IQDLLKDMFWYIFISKYGSDVDKKDLSNYFSRASESYVGFLFKITMEKPYYQEKFKKVLPNLLSQALYVALSECFPDSWIQFNNDFVENIMQLVFFWLSGIRPTKGSWSCWNMEELKP 1000
            L EL +HP F+ +K  +LP  V    ++  V   E  PL+      +   + F C   +  +  D FW++F  +Y    DK+     F R + +Y   LFK  M + +Y+E   K L +LLS+A+Y +   CFP SW    ++F   I   +  W+SG+ P   S++ W+  EL P
Sbjct:  127 LAELHEHPPFDEMKPNKLPNGVDFCDMVGNVIRSEKNPLSGKSYCSDRELEKFLCSPFLAAMWLDSFWWLFHERY--QPDKEIQKKLFDRIARNYASLLFK--MCRSHYEEALLKRLSSLLSKAMYTSFCCCFPQSWFN-THEFKSEICNTMNLWVSGMYPCLQSYNNWDYSELDP 297          
BLAST of Family with sequence similarity 227 member B vs. Ensembl Mouse
Match: Fam227a (family with sequence similarity 227, member A [Source:MGI Symbol;Acc:MGI:1922979])

HSP 1 Score: 70.8626 bits (172), Expect = 2.015e-12
Identity = 55/176 (31.25%), Postives = 87/176 (49.43%), Query Frame = 2
Query:  482 LIELCQHPGFNWIKITELPFSVQPEFILKRV--HESQPLTFIKIYKEFFDKWFYCQK-IQDLLKDMFWYIFISKYGSDVDKKDLSNYFSRASESYVGFLFKITMEKPYYQEKFKKVLPNLLSQALYVALSECFPDSWIQFNNDFVENIMQLVFFWLSGIRPTKGSWSCWNMEELKP 1000
            L EL +HP F+ +K  +LP  V    ++  V   E  PL+      +   + F C   +  +  D FW++F  +Y    DK+     F R + +Y   LFK  M + +Y+E   K L +LLS+A+Y +   CFP SW    ++F   I   +  W+SG+ P   S++ W+  EL P
Sbjct:  131 LAELHEHPPFDEMKPNKLPNGVDFCDMVGNVIRSEKNPLSGKSYCSDRELEKFLCSPFLAAMWLDSFWWLFHERY--QPDKEIQKKLFDRIARNYASLLFK--MCRSHYEEALLKRLSSLLSKAMYTSFCCCFPQSWFN-THEFKSEICNTMNLWVSGMYPCLQSYNNWDYSELDP 301          
BLAST of Family with sequence similarity 227 member B vs. UniProt/SwissProt
Match: sp|Q96M60|F227B_HUMAN (Protein FAM227B OS=Homo sapiens OX=9606 GN=FAM227B PE=2 SV=2)

HSP 1 Score: 112.079 bits (279), Expect = 5.540e-25
Identity = 90/277 (32.49%), Postives = 129/277 (46.57%), Query Frame = 2
Query:  461 DNKALPKLIELCQHPGFNWIKITELPFSVQPE----FILKRVHESQPLTFIKIYKEFFDKWFYCQKIQDLLKDMFWYIFISKYGSDVDKKDLSNYFSRASESYVGFLFKITMEKPYYQEKFKKVLPNLLSQALYVALSECFPDSWIQFNNDFVENIMQLVFFWLSGIRPTKGSWSCWNMEELKPT---------EQKLKEKAIEEQLRIGFS-DLQIEK--KTPEKDQLKNS--------VSTKSTLLGALNHSNNVLFNVSGHSPLIQWYFKKNNI 1219
            D     K IE C   GF   ++T+LP  +  E    FILK  H      F KI+K  F      +    LL D FW+ F+ K+  D + +D    F R SESYV     I + +   ++ F ++ P+ L+QA+Y    E FP+S   FN++F E++   +F W SG++P KG W  W ++EL  T          + +KE+  + Q  I  S D  I K    P    L  S        ++TKS         N VLFN  G SPLI +Y K + +
Sbjct:  138 DEMETEKNIEGCSFTGFKANELTQLPRHLDAEQIYLFILK-AHNFDERVF-KIWKTHF----LSEASIALLHDSFWWWFLHKFRPDRENQDC--LFDRISESYVTLFMSIPLSR---KDAFFQIYPDCLAQAIYATFHEAFPESSYLFNDEFKEDLGNNIFLWCSGLKPQKGFWIHWKLKELSTTTIHGSKKAPAKSVKERIADSQEHISTSIDFNIIKILNNPRAYTLPISKEESRLSRLATKSHYSSTGPEFNRVLFNFGGQSPLILYYLKMHEL 403          
BLAST of Family with sequence similarity 227 member B vs. UniProt/SwissProt
Match: sp|Q9D518|F227B_MOUSE (Protein FAM227B OS=Mus musculus OX=10090 GN=Fam227b PE=2 SV=3)

HSP 1 Score: 111.694 bits (278), Expect = 8.254e-25
Identity = 78/260 (30.00%), Postives = 128/260 (49.23%), Query Frame = 2
Query:  656 LLKDMFWYIFISKYGSDVDKKDLSNYFSRASESYVGFLFKITMEKPYYQEKFKKVLPNLLSQALYVALSECFPDSWIQFNNDFVENIMQLVFFWLSGIRPTKGSWSCWNMEELKPT--------EQKLKEKAIEEQLRI-GFSDLQIEK--KTPE--------KDQLKNSVSTKSTLLGALNHS-NNVLFNVSGHSPLIQWYFKKNNININVGTSNLVKHKEILPRLNEDN-SETLADVVSKSVKSLQSRKMIYKKFLER 1372
            LL D FW+ F+ K+  D  K+D    F R +ESYV    KI + +   ++ F K+ P+ L+QA+Y    E FP+S   FN+ F E++   +F WLSG++P  G W+ W +++L  T          KL+   I  Q  I G  DL+IE   K P         K+ + +  +TK +   +L    + VLF+  G SPLI +Y K + +   +  ++  K  +    L E + + T  D++  + +     K  +K+  +R
Sbjct:  190 LLHDSFWWWFLHKFKPD--KRDEDFLFDRIAESYVTLFIKIPLRR---KDAFFKMYPDCLTQAVYTTFQESFPESCSLFNDKFKEDLGNTIFLWLSGLKPETGFWTHWKLQDLCTTTIHGSRRVPVKLRRSVIPSQEHIPGIRDLKIEDILKNPRAYAMPKLMKESVASKAATKPSHYRSLGPEFHKVLFDFGGQSPLILYYLKMHELG-GISVTHNPKGTKFTKILREPSPAPTYCDIIRDAKRKFADNKKDFKRVKQR 443          
BLAST of Family with sequence similarity 227 member B vs. UniProt/SwissProt
Match: sp|Q4R7D5|F227B_MACFA (Protein FAM227B OS=Macaca fascicularis OX=9541 GN=FAM227B PE=2 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 1.731e-21
Identity = 68/206 (33.01%), Postives = 104/206 (50.49%), Query Frame = 2
Query:  461 DNKALPKLIELCQHPGFNWIKITELPFSVQPE----FILKRVHESQPLTFIKIYKEFFDKWFYCQKIQDLLKDMFWYIFISKYGSDVDKKDLSNYFSRASESYVGFLFKITMEKPYYQEKFKKVLPNLLSQALYVALSECFPDSWIQFNNDFVENIMQLVFFWLSGIRPTKGSWSCWNMEELKPTEQKLKEKAIEEQLRIGFSDLQ 1066
            D     K IE C   GF   ++T+LP  +  E    FILK  H      F KI+K  F      +    LL D FW+ F+ K+  D + +D    F R SESYV     I + +   ++ F ++ P+ L+QA+Y    E FP+S   FN++F E++   +F W SG++P KG W+ W ++EL  T     +KA  + ++   +D Q
Sbjct:  138 DEMETEKNIEGCSFTGFKANELTKLPRHLDAERIYLFILK-AHNFDERVF-KIWKTHF----LSEASIALLHDSFWWWFLHKFRPDRENQDC--LFDRISESYVTLFMSIPLSR---KDAFFQIYPDCLAQAIYATFHEAFPESSYLFNDEFKEDLGNTIFLWCSGLKPQKGFWTHWKLKELSTTTIHGSKKAPAKSVKERIADSQ 332          
BLAST of Family with sequence similarity 227 member B vs. UniProt/SwissProt
Match: sp|Q6AXP3|F227B_RAT (Protein FAM227B OS=Rattus norvegicus OX=10116 GN=Fam227b PE=2 SV=2)

HSP 1 Score: 98.5969 bits (244), Expect = 1.787e-20
Identity = 64/206 (31.07%), Postives = 104/206 (50.49%), Query Frame = 2
Query:  656 LLKDMFWYIFISKYGSDVDKKDLSNYFSRASESYVGFLFKITMEKPYYQEKFKKVLPNLLSQALYVALSECFPDSWIQFNNDFVENIMQLVFFWLSGIRPTKGSWSCWNMEELKPTE--------QKLKEKAIEEQLRIGFS-DLQIEK--KTP------EKDQLKNSVSTKSTLLGALNHSNNVLFNVSGHSPLIQWYFKKNNIN 1222
            LL D FW+ F+ K+  D  K+D    F R +ESYV    +I + +   ++ F ++ P+ L+QA+Y    E FP+S   FN++F E++   +F WLSG++P  G W+ W +++L  T          KL+   +  Q     +  L+IE   K P      +++   + V+TKS           VLF+  G SPLI +Y K + + 
Sbjct:  190 LLHDCFWWWFLHKFKPD--KRDQDWLFDRIAESYVTLFMRIPLRR---KDIFFQMYPDWLAQAVYTTFQESFPESCSLFNDNFKEDLGNTIFLWLSGLKPAPGFWTHWKLQDLCTTTIHGCRRVPVKLRRGIMSSQEHTSATVGLKIEDILKNPRALPVLKEESAASKVTTKSHYRSLGPEFYKVLFDFGGQSPLILYYLKMHELG 390          
BLAST of Family with sequence similarity 227 member B vs. UniProt/SwissProt
Match: sp|F5H4B4|F227A_HUMAN (Protein FAM227A OS=Homo sapiens OX=9606 GN=FAM227A PE=1 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 4.338e-14
Identity = 79/336 (23.51%), Postives = 150/336 (44.64%), Query Frame = 2
Query:   32 YFKMNTLNRFCSPMHPMDENLDDTDIIREKKIEFIKLRELTKSPYS--IGSVIDIENKISKLEEQIKGFETKISWEDIDSDEVVDNGGNDNQIQVNLNIKKEKKEVEKFAGIFSVISTVDFNKPERIKKIVXXXXXXXXXXXXHFDNKALPKLIELCQHPGFNWIKITELPFSVQPEFILKRVHESQPLTFIKIYKEFFDKWFYC--QKIQDLLK---------DMFWYIFISKYGSDVDKKDLSNYFSRASESYVGFLFKITMEKPYYQEKFKKVLPNLLSQALYVALSECFPDSWIQFNNDFVENIMQLVFFWLSGIRPTKGSWSCWNMEELKP 1000
            + KM  +N    PM P+DE+L  + + R   ++ ++ +EL  +P S  IGS+  +  KI+ +  + +     ++ E  + ++        +  +  +  +++ +   K + +    S+V       IK+                 +K L  L EL Q+  FN  K  +LP  V    ++  V        ++  ++      +C  ++++  L          D FW+IF  +Y    +K+  +N F R ++ Y   LF++   K + +E   K LP+LLS+A+Y +   CFP SW    ++F  +I   +  W+SG  P+  S+  W+  EL P
Sbjct:    4 FRKMEVINLTTLPMIPVDEHLAVSLVARNTMVKTVR-KELENNPPSCLIGSMHQVNQKIADINLRTEPSANSLAIERFELEKKALREKTRSSPEDKVKRQRKSQYSCKGSELRHARSSV-------IKRKTA--------------DKNL--LAELYQYSNFNSSKPNKLPNGVDFCDMVGNV--------VRAERDCLSGKHFCSGRELEKFLSSSSPRAIWLDSFWWIFHERY--QPNKELQNNLFDRIAQHYALLLFRVP--KSHSEEALLKRLPSLLSKAVYTSFCCCFPQSWFD-THEFKSDICNTMSLWISGTYPSPQSYDSWDYSELDP 302          
BLAST of Family with sequence similarity 227 member B vs. TrEMBL
Match: A0A267E6Z4 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig006086g5 PE=4 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 1.489e-45
Identity = 115/342 (33.63%), Postives = 189/342 (55.26%), Query Frame = 2
Query:   44 NTLNRFCSPMHPMDENLD-DTDIIREKKIEFIKLRELTKSPYSIGSVIDIENKISKLEEQIKGFETKISWEDIDSDEV-VDNGGNDNQIQVNLNIK-----KEKKEVEKFAGIFSVISTVDFNKPERIKKIVXXXXXXXXXXXXHFDNKA---LPKLIELCQHPGFNWIKITELPFSVQPEFILKRVHESQPLTFIKIYKEFFDKWFYCQKIQDLLKDMFWYIFISKYGSDVDKKDLSNYFSRASESYVGFLFKITMEKPYYQEKFKKVLPNLLSQALYVALSECFPDSWIQFNNDFVENIMQLVFFWLSGIRPTKGSWSCWNMEELKPTEQKLKEKAIEEQ 1039
            N LNR  SPM   D  +  D D  ++   E+ K  + T+SP+ IGSV  I  +I KL+ ++K F    + +D+  + + VD    D  ++ N+++K     ++  E  KFAG++S  +       ER+KKI K S++  + +       A    P+ +ELCQ PG+N  ++T LP  VQP  IL RV  +QP  F   YK   D+ F  +  + +L+D FW+ F+  YG D DK ++  +++R + +Y   LF I +E  ++++ F K  P+LLSQA+Y A    FP S+ +F  +F E I+ LV  WL+G++P    W  WN + L+P+  + +E+ ++ +
Sbjct:    1 NYLNRNGSPMLHFDTEVPLDQDTHKKIVAEYEKQSQ-TRSPFQIGSVELISQRIGKLDRKLKEF----TPDDVSKESLFVD----DIDVRANMSVKDIVTDQQMLEKTKFAGVYSFGTNFGLPNSERVKKIEKISMQKKTSNFYSSPKGAQNDRPQFVELCQFPGYNQRELTPLPCGVQPVDILIRVMAAQPGRFSSQYKAQLDRCFLSEASKAVLQDAFWHHFLDHYGQDYDKPEMPRFYNRIAHNYSQMLFMIKVE--HFRDAFLKSYPSLLSQAVYSAYCNAFPHSFSKFQAEFKEGIVCLVHRWLTGLQPRCRLWLDWNKDALEPSVIRHREELLKAE 331          
BLAST of Family with sequence similarity 227 member B vs. TrEMBL
Match: A0A1I8J8H9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 165.622 bits (418), Expect = 5.993e-43
Identity = 109/338 (32.25%), Postives = 180/338 (53.25%), Query Frame = 2
Query:   41 MNTLNRFCSPMHPMDENLD-DTDIIREKKIEFIKLRELTKSPYSIGSVIDIENKISKLEEQIKGFETK-ISWEDIDSDEVVDNGGNDNQIQVNLNIKKEKKEVEKFAGIFSVISTVDFNKPERIKKIVXXXXXXXXXXXXHFDNKA---LPKLIELCQHPGFNWIKITELPFSVQPEFILKRVHESQPLTFIKIYKEFFDKWFYCQKIQDLLKDMFWYIFISKYGSDVDKKDLSNYFSRASESYVGFLFKITMEKPYYQEKFKKVLPNLLSQALYVALSECFPDSWIQFNNDFVENIMQLVFFWLSGIRPTKGSWSCWNMEELKPTEQKLKEKAIEEQ 1039
            MN LNR  SPM   D  +  D D  ++   E+ K  + T+SP+ IGSV  I  +I KL+ ++K F    +S E +  D++         ++ N+++K              +++       ER+KKI K S++  + +       A    P+ +ELCQ PG+N  ++T LP  VQP  IL RV  +QP  F   YK   D+ F  +  + +L+D FW+ F+  YG D DK ++  +++R + +Y   LF I +E  ++++ F K  P+LLSQA+Y A    FP S+ +F  +F E I+ LV  WL+G++P    W  WN + L+P+  + +E+ ++ +
Sbjct:    1 MNYLNRNGSPMLHFDTEVPLDQDTHKKIVAEYEKQSQ-TRSPFQIGSVELISQRIGKLDRKLKEFTPDDVSKESLFVDDI--------DVRANMSVK-------------DIVTDFGLPNSERVKKIEKISMQKKTSNFYSSPKGAQNDRPQFVELCQFPGYNQRELTPLPCGVQPVDILIRVMAAQPGRFSSQYKAQLDRCFLSEASKAVLQDAFWHHFLDHYGQDYDKPEMPRFYNRIAHNYSQMLFMIKVE--HFRDAFLKSYPSLLSQAVYSAYCNAFPHSFSKFQAEFKEGIVCLVHRWLTGLQPRCRLWLDWNKDALEPSVIRHREELLKAE 314          
BLAST of Family with sequence similarity 227 member B vs. TrEMBL
Match: A0A1S3JEK6 (protein FAM227B OS=Lingula unguis OX=7574 GN=LOC106172421 PE=4 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 9.236e-43
Identity = 115/343 (33.53%), Postives = 184/343 (53.64%), Query Frame = 2
Query:   41 MNTLNRFCSPMHPMDENLDDTDIIREKKIEFIKLRELTKSPYSIGSVIDIENKISKLEEQIKGFETKISWEDIDSDEVVDN------------GGNDNQIQVNLNIKKEKKEVEKFAGIFSVISTVDFNKPERIKKIVXXXXXXXXXXXXHFDNKALPKLIELCQHPGFNWIKITELPFSVQPEFILKRVHESQ-PLTFIKIYKEFFDKWFYCQKIQDLLKDMFWYIFISKYGSDVDKKDLSNYFSRASESYVGFLFKITMEKPYYQEKFKKVLPNLLSQALYVALSECFPDSWIQFNNDFVENIMQLVFFWLSGIRPTKGSWSCWNMEELKPTEQKLKEKAI 1030
            M  +NR  SPMH  +E++++T  + EK+   I+ R+ TKSP+ IGS+  +  KISKL+ ++  +   +   +  S E  D+            G    + +V     K+ KE+  FAG +++ ST+     ER++ I K +L+         +    PK IEL Q PG++  ++T+LP  +    IL +V  +Q  L     Y+  F+K FY    Q +L D+FW+ F+ KY    +K   +  F+R S +YV  +  I  + P Y+E F K  P+L+SQA+Y A  E FPDS+ QF+ DF E ++ LV+ W++G+RP   SW  WN   L+P   K +E+ +
Sbjct:    1 MADINRTASPMHLFEEDINETRDVTEKRRRLIQDRQHTKSPFLIGSIDLVNKKISKLDRKLSHYSELVC--ESQSTETEDDYIAQFLHPSSAKGREKYEKKV-----KDAKELNAFAGFYALQSTIGHEVSERVRNISKVTLQPNKIPVKKVET-GKPKFIELHQFPGYDPTELTQLPHDISATQILNKVTFAQMDLKRKPNYRPEFEKLFYSPMSQAMLLDIFWFYFLEKY--QPNKVVQAKLFNRVSHNYVKLM--IYAKHPQYKEVFLKSYPDLMSQAVYAAYCEAFPDSYRQFSEDFKEMMVFLVWEWMAGMRPAPRSWLKWNFPMLEPPGIKNREEMM 331          
BLAST of Family with sequence similarity 227 member B vs. TrEMBL
Match: A0A1I8GZ37 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 2.199e-42
Identity = 107/337 (31.75%), Postives = 181/337 (53.71%), Query Frame = 2
Query:   41 MNTLNRFCSPMHPMDENLD-DTDIIREKKIEFIKLRELTKSPYSIGSVIDIENKISKLEEQIKGFETKISWEDIDSDEVVDNGGNDNQIQVNLNIKKEKKEVEKFAGIFSVISTVDFNKPERIKKIVXXXXXXXXXXXXHFDNKA---LPKLIELCQHPGFNWIKITELPFSVQPEFILKRVHESQPLTFIKIYKEFFDKWFYCQKIQDLLKDMFWYIFISKYGSDVDKKDLSNYFSRASESYVGFLFKITMEKPYYQEKFKKVLPNLLSQALYVALSECFPDSWIQFNNDFVENIMQLVFFWLSGIRPTKGSWSCWNMEELKPTEQKLKEKAIEEQ 1039
            MN LNR  SPM   D  +  D D  ++   E+ K  + T+SP+ IGSV  I  +I KL+ ++K F    + +D+  + +     +D  ++ N++++              +++       ER+KKI K S++  + +       A    P+ +ELCQ PG+N  ++T LP  VQP  IL RV  +QP  F   YK   D+ F  +  + +L+D FW+ F+  YG D DK ++  +++R + +Y   LF I +E  ++++ F K  P+LLSQA+Y A    FP S+ +F  +F E I+ LV  WL+G++P    W  WN + L+P+  + +E+ ++ +
Sbjct:    1 MNYLNRNGSPMLHFDTEVPLDQDTHKKIVAEYEKQSQ-TRSPFQIGSVELISQRIGKLDRKLKEF----TPDDVSKESLF---VDDIDVRANMSVE-------------DIVTDFGLPNSERVKKIEKISMQKKTSNFYSSPKGAQNDRPQFVELCQFPGYNQRELTPLPCGVQPVDILIRVMAAQPGRFSSQYKAQLDRCFLSEASKAVLQDAFWHHFLDHYGQDYDKPEMPRFYNRIAHNYSQMLFMIKVE--HFRDAFLKSYPSLLSQAVYSAYCNAFPHSYSKFQAEFKEGIVCLVHRWLTGLQPRCRLWLDWNKDALEPSVIRHREELLKAE 314          
BLAST of Family with sequence similarity 227 member B vs. TrEMBL
Match: A0A267F119 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001047g3 PE=4 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 5.874e-42
Identity = 112/343 (32.65%), Postives = 182/343 (53.06%), Query Frame = 2
Query:   41 MNTLNRFCSPMHPMDENLD-DTDIIREKKIEFIKLRELTKSPYSIGSVIDIENKISKLEEQIKGFETKISWEDIDSDEV-VDNGGNDNQIQVNLNIK-----KEKKEVEKFAGIFSVISTVDFNKPERIKKIVXXXXXXXXXXXXHFDNKA---LPKLIELCQHPGFNWIKITELPFSVQPEFILKRVHESQPLTFIKIYKEFFDKWFYCQKIQDLLKDMFWYIFISKYGSDVDKKDLSNYFSRASESYVGFLFKITMEKPYYQEKFKKVLPNLLSQALYVALSECFPDSWIQFNNDFVENIMQLVFFWLSGIRPTKGSWSCWNMEELKPTEQKLKEKAIEEQ 1039
            MN LNR  SPM   D  +  D D  ++   E+ K  + T+SP+ IGSV  I  +I KL+ ++K F    + +D+  + + VD    D  ++ N++++     ++  E  KFAG++S  +       ER+KKI K S++  + +       A    P+ +ELCQ PG+N  ++T LP  VQP  IL RV  +QP  F   YK   D+ F  +  + +L+D FW+ F+  YG D DK ++  +++R + +Y   LF I            K  P+LLSQA+Y      FP S+ +F  +F E I+ LV  WL+G++P    W  WN + L+P+  + +E+ ++ +
Sbjct:    3 MNYLNRNGSPMLHFDTEVPLDQDTHKKIVAEYEKQSQ-TRSPFQIGSVELISQRIGKLDRKLKEF----TPDDVSKESLFVD----DIDVRANMSVEDIVTDQQMLEKTKFAGVYSFGTNFGLPNSERVKKIEKISMQKKTSNFYSSPKGAQNDRPQFVELCQFPGYNQRELTPLPCGVQPVDILIRVMAAQPGRFSSQYKAQLDRCFLSEASKAVLQDAFWHHFLDHYGQDYDKPEMPRFYNRIAHNYSQMLFMI------------KSYPSLLSQAVYSVYCNAFPHSYSKFQAEFKEGIVCLVHRWLTGLQPRCRLWLDWNKDALEPSVIRHREELLKAE 324          
BLAST of Family with sequence similarity 227 member B vs. Ensembl Nematostella
Match: EDO47949 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKR0])

HSP 1 Score: 102.449 bits (254), Expect = 2.175e-23
Identity = 47/139 (33.81%), Postives = 81/139 (58.27%), Query Frame = 2
Query:  608 YKEFFDKWFYCQKIQDLLKDMFWYIFISKYGSDVDKKDLSNYFSRASESYVGFLFKITMEKPYYQEKFKKVLPNLLSQALYVALSECFPDSWIQFNNDFVENIMQLVFFWLSGIRPTKGSWSCWNMEELKPTEQKLKEK 1024
            YK++          Q +L+D+FW+ F+ +Y SD   ++L   F+R + +YV  LF   + +  Y++ F K  P+L++QA+Y      FP S+ QF+  F E ++QLV+ W+ G++P   SW  W ++ L+PT+ +  EK
Sbjct:   41 YKKYLHSLLLSHMSQAVLQDVFWWYFLERYQSDRSTQEL--LFNRIAHNYVKLLFNAPITE--YRDAFFKRYPDLVNQAVYCTFCTAFPTSYKQFDGKFKEGLVQLVYMWMVGVKPVPRSWERWKLDALEPTDMRKDEK 175          

HSP 2 Score: 60.4622 bits (145), Expect = 8.689e-10
Identity = 42/141 (29.79%), Postives = 73/141 (51.77%), Query Frame = 2
Query: 1118 KSTLLGALNHSNNVLFNVSGHSPLIQWYFKKNNININVGTSNLVKHKEI--LPRLNEDNSETLADVVSKSVKSLQSRKMIYKKFLERNSLETKRFQKLQKISNFSNEKRQEKLLLNKSKIHKLSNLIMHEYLKDKDSISFG 1534
            +S  +G     +  LF+V GHSPL++ + +   +  N GT  LV+  EI  LP ++   +ET  +++ KS K  +     ++K  E +  +  +F K  K       +RQ +LL  +  + K+S+L++ E +KD D  S G
Sbjct:  317 ESCPVGRGAQFSRSLFDVHGHSPLVEQFLQMQRLAKNAGTGVLVQRTEIESLPPID---AETYNELIRKSFKLTRQLGAEFRKLDEEDRRKRSQFVKKGKQGYHDYVRRQNELLARQKDVKKISDLLVLELMKDGDEQSSG 454          
BLAST of Family with sequence similarity 227 member B vs. Ensembl Nematostella
Match: EDO46128 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR91])

HSP 1 Score: 70.8626 bits (172), Expect = 3.252e-15
Identity = 32/89 (35.96%), Postives = 54/89 (60.67%), Query Frame = 2
Query:  734 FSRASESYVGFLFKITMEKPYYQEKFKKVLPNLLSQALYVALSECFPDSWIQFNNDFVENIMQLVFFWLSGIRPTKGSWSCWNMEELKP 1000
            FSR ++S+V   F +  +   Y++ F K  P+ L+QALY +  + FP S+  F++DF  ++M  V+ W++G RP   SW  W+ + L+P
Sbjct:    2 FSRIADSFVALFFSVPGD---YKDNFFKYYPDCLAQALYASYCDVFPRSYNLFDDDFKTDLMNGVYEWITGTRPPPRSWQKWHFKMLEP 87          
BLAST of Family with sequence similarity 227 member B vs. Planmine SMEST
Match: SMESG000052176.1 (SMESG000052176.1)

HSP 1 Score: 807.749 bits (2085), Expect = 0.000e+0
Identity = 410/412 (99.51%), Postives = 411/412 (99.76%), Query Frame = 2
Query:   41 MNTLNRFCSPMHPMDENLDDTDIIREKKIEFIKLRELTKSPYSIGSVIDIENKISKLEEQIKGFETKISWEDIDSDEVVDNGGNDNQIQVNLNIKKEKKEVEKFAGIFSVISTVDFNKPERIKKIVXXXXXXXXXXXXHFDNKALPKLIELCQHPGFNWIKITELPFSVQPEFILKRVHESQPLTFIKIYKEFFDKWFYCQKIQDLLKDMFWYIFISKYGSDVDKKDLSNYFSRASESYVGFLFKITMEKPYYQEKFKKVLPNLLSQALYVALSECFPDSWIQFNNDFVENIMQLVFFWLSGIRPTKGSWSCWNMEELKPTEQKLKEKAIEEQLRIGFSDLQIEKKTPEKDQLKNSVSTKSTLLGALNHSNNVLFNVSGHSPLIQWYFKKNNININVGTSNLVKHKEILPRL 1276
            MNTLNRFCSPMHPMDENLDDTDIIREKKIEFIKLRELTKSPYSIGSVIDIENKISKLEEQIKGFETKISWEDIDSDEVVDNGGNDNQIQVNLNIKKEKKEVEKFAGIFSVISTVDFNKPERIKKIVKKSLKNPSKSKLHFDNKALPKLIELCQHPGFNW KITELPFSVQPEFILKRVHESQPLTFIKIYKEFFDKWFYCQKIQDLLKDMFWYIFISKYGSDVDKKDLSNYFSRASESYVGFLFKITMEKPYYQEKFKKVLPNLLSQALYVALSECFPDSWIQFNNDFVENI+QLVFFWLSGIRPTKGSWSCWNMEELKPTEQKLKEKAIEEQLRIGFSDLQIEKKTPEKDQLKNSVSTKSTLLGALNHSNNVLFNVSGHSPLIQWYFKKNNININVGTSNLVKHKEILPRL
Sbjct:    1 MNTLNRFCSPMHPMDENLDDTDIIREKKIEFIKLRELTKSPYSIGSVIDIENKISKLEEQIKGFETKISWEDIDSDEVVDNGGNDNQIQVNLNIKKEKKEVEKFAGIFSVISTVDFNKPERIKKIVKKSLKNPSKSKLHFDNKALPKLIELCQHPGFNWQKITELPFSVQPEFILKRVHESQPLTFIKIYKEFFDKWFYCQKIQDLLKDMFWYIFISKYGSDVDKKDLSNYFSRASESYVGFLFKITMEKPYYQEKFKKVLPNLLSQALYVALSECFPDSWIQFNNDFVENIIQLVFFWLSGIRPTKGSWSCWNMEELKPTEQKLKEKAIEEQLRIGFSDLQIEKKTPEKDQLKNSVSTKSTLLGALNHSNNVLFNVSGHSPLIQWYFKKNNININVGTSNLVKHKEILPRL 412          
BLAST of Family with sequence similarity 227 member B vs. Planmine SMEST
Match: SMESG000052176.1 (SMESG000052176.1)

HSP 1 Score: 786.949 bits (2031), Expect = 0.000e+0
Identity = 397/399 (99.50%), Postives = 398/399 (99.75%), Query Frame = 2
Query:   41 MNTLNRFCSPMHPMDENLDDTDIIREKKIEFIKLRELTKSPYSIGSVIDIENKISKLEEQIKGFETKISWEDIDSDEVVDNGGNDNQIQVNLNIKKEKKEVEKFAGIFSVISTVDFNKPERIKKIVXXXXXXXXXXXXHFDNKALPKLIELCQHPGFNWIKITELPFSVQPEFILKRVHESQPLTFIKIYKEFFDKWFYCQKIQDLLKDMFWYIFISKYGSDVDKKDLSNYFSRASESYVGFLFKITMEKPYYQEKFKKVLPNLLSQALYVALSECFPDSWIQFNNDFVENIMQLVFFWLSGIRPTKGSWSCWNMEELKPTEQKLKEKAIEEQLRIGFSDLQIEKKTPEKDQLKNSVSTKSTLLGALNHSNNVLFNVSGHSPLIQWYFKKNNININVGT 1237
            MNTLNRFCSPMHPMDENLDDTDIIREKKIEFIKLRELTKSPYSIGSVIDIENKISKLEEQIKGFETKISWEDIDSDEVVDNGGNDNQIQVNLNIKKEKKEVEKFAGIFSVISTVDFNKPERIKKIVKKSLKNPSKSKLHFDNKALPKLIELCQHPGFNW KITELPFSVQPEFILKRVHESQPLTFIKIYKEFFDKWFYCQKIQDLLKDMFWYIFISKYGSDVDKKDLSNYFSRASESYVGFLFKITMEKPYYQEKFKKVLPNLLSQALYVALSECFPDSWIQFNNDFVENI+QLVFFWLSGIRPTKGSWSCWNMEELKPTEQKLKEKAIEEQLRIGFSDLQIEKKTPEKDQLKNSVSTKSTLLGALNHSNNVLFNVSGHSPLIQWYFKKNNININVGT
Sbjct:    1 MNTLNRFCSPMHPMDENLDDTDIIREKKIEFIKLRELTKSPYSIGSVIDIENKISKLEEQIKGFETKISWEDIDSDEVVDNGGNDNQIQVNLNIKKEKKEVEKFAGIFSVISTVDFNKPERIKKIVKKSLKNPSKSKLHFDNKALPKLIELCQHPGFNWQKITELPFSVQPEFILKRVHESQPLTFIKIYKEFFDKWFYCQKIQDLLKDMFWYIFISKYGSDVDKKDLSNYFSRASESYVGFLFKITMEKPYYQEKFKKVLPNLLSQALYVALSECFPDSWIQFNNDFVENIIQLVFFWLSGIRPTKGSWSCWNMEELKPTEQKLKEKAIEEQLRIGFSDLQIEKKTPEKDQLKNSVSTKSTLLGALNHSNNVLFNVSGHSPLIQWYFKKNNININVGT 399          
BLAST of Family with sequence similarity 227 member B vs. Planmine SMEST
Match: SMESG000046302.1 (SMESG000046302.1)

HSP 1 Score: 785.023 bits (2026), Expect = 0.000e+0
Identity = 407/412 (98.79%), Postives = 409/412 (99.27%), Query Frame = 2
Query:   41 MNTLNRFCSPMHPMDENLDDTDIIREKKIEFIKLRELTKSPYSIGSVIDIENKISKLEEQIKGFETKISWEDIDSDEVVDNGGNDNQIQVNLNIKKEKKEVEKFAGIFSVISTVDFNKPERIKKIVXXXXXXXXXXXXHFDNKALPKLIELCQHPGFNWIKITELPFSVQPEFILKRVHESQPLTFIKIYKEFFDKWFYCQKIQDLLKDMFWYIFISKYGSDVDKKDLSNYFSRASESYVGFLFKITMEKPYYQEKFKKVLPNLLSQALYVALSECFPDSWIQFNNDFVENIMQLVFFWLSGIRPTKGSWSCWNMEELKPTEQKLKEKAIEEQLRIGFSDLQIEKKTPEKDQLKNSVSTKSTLLGALNHSNNVLFNVSGHSPLIQWYFKKNNININVGTSNLVKHKEILPRL 1276
            MNTLNRFCSPMHPMDENLDDTDIIREKKI+FIKLRELTKSPYSIGSVIDIENKISKLEEQIKGFETKISWEDIDSDEVVDNGGNDNQIQVNLNIKKEKKEVEKFAGIFSVISTVDFNKPERIKKIVKKSLKNPSKSKLHFDNKALPKLIELCQHPGFNW KITELPFSVQPEFILKRVHESQPLTFIKIYKEFFDKWFYCQKIQDLL DMFWYIFISKYGSDVDKKDLSNYFSRASESYVGFLFKITMEKPYYQEKFKKVLPNLLSQALYVALSECFPDSWIQFNNDFVENI+QLVFFWLSGIRPTKGSWSCWNMEELKPTEQKLKE AIEEQLRIGFSDLQIEKKTPEKDQLKNSVSTKSTLLGALNHSNNVLFNVSGHSPLIQWYFKKNNININVGTSNLVKHKEILPRL
Sbjct:    1 MNTLNRFCSPMHPMDENLDDTDIIREKKIKFIKLRELTKSPYSIGSVIDIENKISKLEEQIKGFETKISWEDIDSDEVVDNGGNDNQIQVNLNIKKEKKEVEKFAGIFSVISTVDFNKPERIKKIVKKSLKNPSKSKLHFDNKALPKLIELCQHPGFNWQKITELPFSVQPEFILKRVHESQPLTFIKIYKEFFDKWFYCQKIQDLLNDMFWYIFISKYGSDVDKKDLSNYFSRASESYVGFLFKITMEKPYYQEKFKKVLPNLLSQALYVALSECFPDSWIQFNNDFVENIIQLVFFWLSGIRPTKGSWSCWNMEELKPTEQKLKENAIEEQLRIGFSDLQIEKKTPEKDQLKNSVSTKSTLLGALNHSNNVLFNVSGHSPLIQWYFKKNNININVGTSNLVKHKEILPRL 412          
BLAST of Family with sequence similarity 227 member B vs. Planmine SMEST
Match: SMESG000052176.1 (SMESG000052176.1)

HSP 1 Score: 767.689 bits (1981), Expect = 0.000e+0
Identity = 401/409 (98.04%), Postives = 404/409 (98.78%), Query Frame = 2
Query:   41 MNTLNRFCSPMHPMDENLDDTDIIREKKIEFIKLRELTKSPYSIGSVIDIENKISKLEEQIKGFETKISWEDIDSDEVVDNGGNDNQIQVNLNIKKEKKEVEKFAGIFSVISTVDFNKPERIKKIVXXXXXXXXXXXXHFDNKALPKLIELCQHPGFNWIKITELPFSVQPEFILKRVHESQPLTFIKIYKEFFDKWFYCQKIQDLLKDMFWYIFISKYGSDVDKKDLSNYFSRASESYVGFLFKITMEKPYYQEKFKKVLPNLLSQALYVALSECFPDSWIQFNNDFVENIMQLVFFWLSGIRPTKGSWSCWNMEELKPTEQKLKEKAIEEQLRIGFSDLQIEKKTPEKDQLKNSVSTKSTLLGALNHSNNVLFNVSGHSPLIQWYFKKNNININVGTS-NLVKHKEI 1264
            MNTLNRFCSPMHPMDENLDDTDIIREKKIEFIKLRELTKSPYSIGSVIDIENKISKLEEQIKGFETKISWEDIDSDEVVDNGGNDNQIQVNLNIKKEKKEVEKFAGIFSVISTVDFNKPERIKKIVKKSLKNPSKSKLHFDNKALPKLIELCQHPGFNW KITELPFSVQPEFILKRVHESQPLTFIKIYKEFFDKWFYCQKIQDLLKDMFWYIFISKYGSDVDKKDLSNYFSRASESYVGFLFKITMEKPYYQEKFKKVLPNLLSQALYVALSECFPDSWIQFNNDFVENI+QLVFFWLSGIRPTKGSWSCWNMEELKPTEQKLKEKAIEEQLRIGFSDLQIEKKTPEKDQLKNSVSTKSTLLGALNHSNNVLFNVSGHSPLIQWYFKKNNININVGT+ NL +  EI
Sbjct:    1 MNTLNRFCSPMHPMDENLDDTDIIREKKIEFIKLRELTKSPYSIGSVIDIENKISKLEEQIKGFETKISWEDIDSDEVVDNGGNDNQIQVNLNIKKEKKEVEKFAGIFSVISTVDFNKPERIKKIVKKSLKNPSKSKLHFDNKALPKLIELCQHPGFNWQKITELPFSVQPEFILKRVHESQPLTFIKIYKEFFDKWFYCQKIQDLLKDMFWYIFISKYGSDVDKKDLSNYFSRASESYVGFLFKITMEKPYYQEKFKKVLPNLLSQALYVALSECFPDSWIQFNNDFVENIIQLVFFWLSGIRPTKGSWSCWNMEELKPTEQKLKEKAIEEQLRIGFSDLQIEKKTPEKDQLKNSVSTKSTLLGALNHSNNVLFNVSGHSPLIQWYFKKNNININVGTNVNLTRKPEI 409          
BLAST of Family with sequence similarity 227 member B vs. Planmine SMEST
Match: SMESG000046302.1 (SMESG000046302.1)

HSP 1 Score: 762.681 bits (1968), Expect = 0.000e+0
Identity = 397/402 (98.76%), Postives = 399/402 (99.25%), Query Frame = 2
Query:   71 MHPMDENLDDTDIIREKKIEFIKLRELTKSPYSIGSVIDIENKISKLEEQIKGFETKISWEDIDSDEVVDNGGNDNQIQVNLNIKKEKKEVEKFAGIFSVISTVDFNKPERIKKIVXXXXXXXXXXXXHFDNKALPKLIELCQHPGFNWIKITELPFSVQPEFILKRVHESQPLTFIKIYKEFFDKWFYCQKIQDLLKDMFWYIFISKYGSDVDKKDLSNYFSRASESYVGFLFKITMEKPYYQEKFKKVLPNLLSQALYVALSECFPDSWIQFNNDFVENIMQLVFFWLSGIRPTKGSWSCWNMEELKPTEQKLKEKAIEEQLRIGFSDLQIEKKTPEKDQLKNSVSTKSTLLGALNHSNNVLFNVSGHSPLIQWYFKKNNININVGTSNLVKHKEILPRL 1276
            MHPMDENLDDTDIIREKKI+FIKLRELTKSPYSIGSVIDIENKISKLEEQIKGFETKISWEDIDSDEVVDNGGNDNQIQVNLNIKKEKKEVEKFAGIFSVISTVDFNKPERIKKIVKKSLKNPSKSKLHFDNKALPKLIELCQHPGFNW KITELPFSVQPEFILKRVHESQPLTFIKIYKEFFDKWFYCQKIQDLL DMFWYIFISKYGSDVDKKDLSNYFSRASESYVGFLFKITMEKPYYQEKFKKVLPNLLSQALYVALSECFPDSWIQFNNDFVENI+QLVFFWLSGIRPTKGSWSCWNMEELKPTEQKLKE AIEEQLRIGFSDLQIEKKTPEKDQLKNSVSTKSTLLGALNHSNNVLFNVSGHSPLIQWYFKKNNININVGTSNLVKHKEILPRL
Sbjct:    1 MHPMDENLDDTDIIREKKIKFIKLRELTKSPYSIGSVIDIENKISKLEEQIKGFETKISWEDIDSDEVVDNGGNDNQIQVNLNIKKEKKEVEKFAGIFSVISTVDFNKPERIKKIVKKSLKNPSKSKLHFDNKALPKLIELCQHPGFNWQKITELPFSVQPEFILKRVHESQPLTFIKIYKEFFDKWFYCQKIQDLLNDMFWYIFISKYGSDVDKKDLSNYFSRASESYVGFLFKITMEKPYYQEKFKKVLPNLLSQALYVALSECFPDSWIQFNNDFVENIIQLVFFWLSGIRPTKGSWSCWNMEELKPTEQKLKENAIEEQLRIGFSDLQIEKKTPEKDQLKNSVSTKSTLLGALNHSNNVLFNVSGHSPLIQWYFKKNNININVGTSNLVKHKEILPRL 402          
The following BLAST results are available for this feature:
BLAST of Family with sequence similarity 227 member B vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FAM227B1.154e-2532.49family with sequence similarity 227 member B [Sour... [more]
FAM227A6.889e-1523.51family with sequence similarity 227 member A [Sour... [more]
FAM227A7.370e-1523.51family with sequence similarity 227 member A [Sour... [more]
FAM227A9.033e-1523.51family with sequence similarity 227 member A [Sour... [more]
FAM227B1.838e-1227.67family with sequence similarity 227 member B [Sour... [more]
back to top
BLAST of Family with sequence similarity 227 member B vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Family with sequence similarity 227 member B vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Family with sequence similarity 227 member B vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Family with sequence similarity 227 member B vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSXETT00000000957.13.241e-3126.52family with sequence similarity 227 member A [Sour... [more]
ENSXETT00000055522.14.346e-2128.27family with sequence similarity 227 member B [Sour... [more]
back to top
BLAST of Family with sequence similarity 227 member B vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fam227b1.180e-2530.00family with sequence similarity 227, member B [Sou... [more]
Fam227b1.180e-2530.00family with sequence similarity 227, member B [Sou... [more]
Fam227b3.861e-2530.00family with sequence similarity 227, member B [Sou... [more]
Fam227a1.684e-1231.25family with sequence similarity 227, member A [Sou... [more]
Fam227a2.015e-1231.25family with sequence similarity 227, member A [Sou... [more]
back to top
BLAST of Family with sequence similarity 227 member B vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q96M60|F227B_HUMAN5.540e-2532.49Protein FAM227B OS=Homo sapiens OX=9606 GN=FAM227B... [more]
sp|Q9D518|F227B_MOUSE8.254e-2530.00Protein FAM227B OS=Mus musculus OX=10090 GN=Fam227... [more]
sp|Q4R7D5|F227B_MACFA1.731e-2133.01Protein FAM227B OS=Macaca fascicularis OX=9541 GN=... [more]
sp|Q6AXP3|F227B_RAT1.787e-2031.07Protein FAM227B OS=Rattus norvegicus OX=10116 GN=F... [more]
sp|F5H4B4|F227A_HUMAN4.338e-1423.51Protein FAM227A OS=Homo sapiens OX=9606 GN=FAM227A... [more]
back to top
BLAST of Family with sequence similarity 227 member B vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267E6Z41.489e-4533.63Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1I8J8H95.993e-4332.25Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1S3JEK69.236e-4333.53protein FAM227B OS=Lingula unguis OX=7574 GN=LOC10... [more]
A0A1I8GZ372.199e-4231.75Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267F1195.874e-4232.65Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
back to top
BLAST of Family with sequence similarity 227 member B vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Family with sequence similarity 227 member B vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Family with sequence similarity 227 member B vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Family with sequence similarity 227 member B vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO479492.175e-2333.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO461283.252e-1535.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Family with sequence similarity 227 member B vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Family with sequence similarity 227 member B vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000052176.10.000e+099.51SMESG000052176.1[more]
SMESG000052176.10.000e+099.50SMESG000052176.1[more]
SMESG000046302.10.000e+098.79SMESG000046302.1[more]
SMESG000052176.10.000e+098.04SMESG000052176.1[more]
SMESG000046302.10.000e+098.76SMESG000046302.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031880 ID=SMED30031880|Name=Family with sequence similarity 227 member B|organism=Schmidtea mediterranea sexual|type=transcript|length=1592bp
TATATAAATCTTATATGAAAATTGAAAAAAATATTTCAAAATGAATACAT
TGAATCGGTTTTGTTCTCCAATGCATCCAATGGATGAAAATTTGGATGAT
ACTGATATTATTCGTGAAAAGAAAATTGAATTTATTAAACTAAGAGAACT
TACGAAATCTCCTTATTCAATTGGATCTGTAATTGACATTGAAAATAAAA
TTTCTAAATTAGAGGAACAGATTAAAGGTTTTGAAACGAAAATTTCATGG
GAAGACATTGACTCAGACGAAGTGGTTGATAATGGTGGTAATGATAATCA
AATACAAGTTAATTTAAACATTAAAAAAGAAAAAAAAGAGGTAGAAAAAT
TTGCTGGAATATTTTCTGTAATCTCTACTGTGGACTTTAATAAACCAGAA
AGAATAAAGAAAATTGTTAAAAAATCTTTGAAAAACCCGTCAAAATCAAA
ATTGCATTTTGATAATAAAGCTCTTCCAAAACTAATTGAGCTATGTCAAC
ACCCAGGATTCAACTGGATAAAAATTACAGAATTACCATTTTCTGTACAA
CCTGAATTTATTTTAAAGCGAGTGCATGAGTCCCAACCATTGACGTTCAT
TAAAATCTACAAAGAATTTTTCGACAAATGGTTCTACTGCCAAAAAATAC
AAGATCTTCTGAAAGATATGTTTTGGTACATCTTCATTTCTAAATATGGT
TCGGATGTCGATAAAAAAGATTTGAGTAATTATTTTTCTCGAGCTTCCGA
AAGTTATGTTGGATTTCTTTTCAAAATAACAATGGAAAAGCCATATTATC
AAGAAAAATTTAAAAAAGTGCTTCCGAACTTACTTAGCCAAGCTCTTTAC
GTAGCATTATCTGAATGCTTTCCAGATTCCTGGATCCAATTCAATAATGA
TTTTGTAGAGAATATTATGCAATTAGTGTTCTTTTGGCTAAGTGGAATAA
GACCTACTAAAGGATCTTGGAGTTGTTGGAATATGGAAGAACTTAAGCCT
ACTGAACAGAAATTAAAAGAAAAGGCAATTGAAGAACAATTACGCATTGG
ATTTTCGGATCTTCAGATTGAAAAGAAAACACCTGAGAAGGATCAGTTGA
AAAATTCAGTTTCGACAAAATCAACTTTACTTGGAGCTTTGAACCATTCA
AACAATGTCCTATTTAATGTCAGTGGACACAGCCCTTTAATTCAGTGGTA
CTTCAAAAAGAATAATATAAATATTAATGTTGGGACAAGTAACTTAGTAA
AACACAAAGAAATCTTGCCAAGACTTAACGAAGACAATAGTGAAACGCTA
GCTGATGTTGTATCGAAAAGTGTAAAAAGTTTACAAAGTAGAAAGATGAT
TTACAAAAAGTTTCTTGAACGAAATTCTTTAGAAACAAAACGATTTCAGA
AACTTCAAAAAATAAGCAATTTTAGCAATGAAAAAAGACAAGAAAAACTG
TTACTGAATAAATCAAAAATTCATAAATTAAGTAATTTAATTATGCATGA
ATATTTGAAAGATAAAGATTCAATTTCTTTTGGGGCCGACAAAGCAGTTA
CAGATGCAATTCAGGAAGCCTAATAAATGATGTAACTCTTTG
back to top

protein sequence of SMED30031880-orf-1

>SMED30031880-orf-1 ID=SMED30031880-orf-1|Name=SMED30031880-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=511bp
MNTLNRFCSPMHPMDENLDDTDIIREKKIEFIKLRELTKSPYSIGSVIDI
ENKISKLEEQIKGFETKISWEDIDSDEVVDNGGNDNQIQVNLNIKKEKKE
VEKFAGIFSVISTVDFNKPERIKKIVKKSLKNPSKSKLHFDNKALPKLIE
LCQHPGFNWIKITELPFSVQPEFILKRVHESQPLTFIKIYKEFFDKWFYC
QKIQDLLKDMFWYIFISKYGSDVDKKDLSNYFSRASESYVGFLFKITMEK
PYYQEKFKKVLPNLLSQALYVALSECFPDSWIQFNNDFVENIMQLVFFWL
SGIRPTKGSWSCWNMEELKPTEQKLKEKAIEEQLRIGFSDLQIEKKTPEK
DQLKNSVSTKSTLLGALNHSNNVLFNVSGHSPLIQWYFKKNNININVGTS
NLVKHKEILPRLNEDNSETLADVVSKSVKSLQSRKMIYKKFLERNSLETK
RFQKLQKISNFSNEKRQEKLLLNKSKIHKLSNLIMHEYLKDKDSISFGAD
KAVTDAIQEA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR029417FAM227
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
Vocabulary: biological process
TermDefinition
GO:0008150biological_process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 47..67
IPR029417FAM227 ProteinPFAMPF14922FWWhcoord: 163..314
e-value: 1.3E-35
score: 122.5
IPR029417FAM227 ProteinPANTHERPTHR33560FAMILY NOT NAMEDcoord: 1..347
coord: 345..508