Protein kinase domain-containing protein

Overview
NameProtein kinase domain-containing protein
Smed IDSMED30031879
Length (bp)1790
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein kinase domain-containing protein (SMED30031879) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30031879) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein kinase domain-containing protein (SMED30031879) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30031879) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031879

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30031879h1SMcG0020358 dd_Smed_v4_15542_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30031879h1SMcG0020358 dd_Smed_v4_15542_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30031879h1SMcG0020358 dd_Smed_v4_15542_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30031879h1SMcG0020358 dd_Smed_v6_15542_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30031879h1SMcG0020358 dd_Smed_v4_15542_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MOK (MOK protein kinase [Source:HGNC Symbol;Acc:HGNC:9833])

HSP 1 Score: 409.453 bits (1051), Expect = 5.225e-138
Identity = 182/309 (58.90%), Postives = 244/309 (78.96%), Query Frame = 1
Query:   58 IKDFRLISKKGEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVNNLREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIKGRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQSLKIADFGSCKTIFSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASILKNFKKSRSVSFNFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFKELRSNSGTTDPQSMDVLSKKGKP 984
            +K+++ I K GEGTFSEV+K Q++++ +Y+ACK+MKQ +E+ +QVNNLREIQA+RRLNPH NIL+LHEVVFD+KSG+L LI ELMDMN+YELI+GR+  L E  +  YM+QL + L HIH+NGIFHRDVKPENILI+   LK+ DFGSC++++S+ PYTEYISTRWYRAPECLLTDG+Y+Y+MDLWS GCV +EI SL+PLFPG NE+DQI KIHD++G+P   IL  FK+SR+++F+FP +KGSGI  L  ++S + +S++  ++ YDP  R+    AL HPYF+E R     T+ +++    K G P
Sbjct:    1 MKNYKAIGKIGEGTFSEVMKMQSLRDGNYYACKQMKQRFESIEQVNNLREIQALRRLNPHPNILMLHEVVFDRKSGSLALICELMDMNIYELIRGRRYPLSEKKIMHYMYQLCKSLDHIHRNGIFHRDVKPENILIKQDVLKLGDFGSCRSVYSKQPYTEYISTRWYRAPECLLTDGFYTYKMDLWSAGCVFYEIASLQPLFPGVNELDQISKIHDVIGTPAQKILTKFKQSRAMNFDFPFKKGSGIPLLTTNLSPQCLSLLHAMVAYDPDERIAAHQALQHPYFQEQRK----TEKRALGSHRKAGFP 305          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MOK (MOK protein kinase [Source:HGNC Symbol;Acc:HGNC:9833])

HSP 1 Score: 407.527 bits (1046), Expect = 2.485e-137
Identity = 183/309 (59.22%), Postives = 245/309 (79.29%), Query Frame = 1
Query:   58 IKDFRLISKKGEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVNNLREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIKGRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQSLKIADFGSCKTIFSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASILKNFKKSRSVSFNFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFKELRSNSGTTDPQSMDVLSKKGKP 984
            +K+++ I K GEGTFSEV+K Q++++ +Y+ACK+MKQ +E+ +QVNNLREIQA+RRLNPH NIL+LHEVVFD+KSG+L LI ELMDMN+YELI+GR+  L E  +  YM+QL + L HIH+NGIFHRDVKPENILI+D  LK+ DFGSC++++S+ PYTEYISTRWYRAPECLLTDG+Y+Y+MDLWS GCV +EI SL+PLFPG NE+DQI KIHD++G+P   IL  FK+SR+++F+FP +KGSGI  L  ++S + +S++  ++ YDP  R+    AL HPYF+E R     T+ +++    K G P
Sbjct:    1 MKNYKAIGKIGEGTFSEVMKMQSLRDGNYYACKQMKQRFESIEQVNNLREIQALRRLNPHPNILMLHEVVFDRKSGSLALICELMDMNIYELIRGRRYPLSEKKIMHYMYQLCKSLDHIHRNGIFHRDVKPENILIKD-VLKLGDFGSCRSVYSKQPYTEYISTRWYRAPECLLTDGFYTYKMDLWSAGCVFYEIASLQPLFPGVNELDQISKIHDVIGTPAQKILTKFKQSRAMNFDFPFKKGSGIPLLTTNLSPQCLSLLHAMVAYDPDERIAAHQALQHPYFQEQRK----TEKRALGSHRKAGFP 304          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MOK (MOK protein kinase [Source:HGNC Symbol;Acc:HGNC:9833])

HSP 1 Score: 340.502 bits (872), Expect = 1.433e-111
Identity = 157/309 (50.81%), Postives = 216/309 (69.90%), Query Frame = 1
Query:   58 IKDFRLISKKGEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVNNLREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIKGRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQSLKIADFGSCKTIFSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASILKNFKKSRSVSFNFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFKELRSNSGTTDPQSMDVLSKKGKP 984
            +K+++ I K GEGTFSEV+K Q++++ +Y+ACK+MKQ +E+                              D+KSG+L LI ELMDMN+YELI+GR+  L E  +  YM+QL + L HIH+NGIFHRDVKPENILI+   LK+ DFGSC++++S+ PYTEYISTRWYRAPECLLTDG+Y+Y+MDLWS GCV +EI SL+PLFPG NE+DQI KIHD++G+P   IL  FK+SR+++F+FP +KGSGI  L  ++S + +S++  ++ YDP  R+    AL HPYF+E R     T+ +++    K G P
Sbjct:    1 MKNYKAIGKIGEGTFSEVMKMQSLRDGNYYACKQMKQRFES------------------------------DRKSGSLALICELMDMNIYELIRGRRYPLSEKKIMHYMYQLCKSLDHIHRNGIFHRDVKPENILIKQDVLKLGDFGSCRSVYSKQPYTEYISTRWYRAPECLLTDGFYTYKMDLWSAGCVFYEIASLQPLFPGVNELDQISKIHDVIGTPAQKILTKFKQSRAMNFDFPFKKGSGIPLLTTNLSPQCLSLLHAMVAYDPDERIAAHQALQHPYFQEQRK----TEKRALGSHRKAGFP 275          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MOK (MOK protein kinase [Source:HGNC Symbol;Acc:HGNC:9833])

HSP 1 Score: 244.588 bits (623), Expect = 1.481e-77
Identity = 103/168 (61.31%), Postives = 135/168 (80.36%), Query Frame = 1
Query:  421 NGIFHRDVKPENILIRDQSLKIADFGSCKTIFSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASILKNFKKSRSVSFNFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFKELR 924
            NGIFHRDVKPENILI+   LK+ DFGSC++++S+ PYTEYISTRWYRAPECLLTDG+Y+Y+MDLWS GCV +EI SL+PLFPG NE+DQI KIHD++G+P   IL  FK+SR+++F+FP +KGSGI  L  ++S + +S++  ++ YDP  R+    AL HPYF+E R
Sbjct:    2 NGIFHRDVKPENILIKQDVLKLGDFGSCRSVYSKQPYTEYISTRWYRAPECLLTDGFYTYKMDLWSAGCVFYEIASLQPLFPGVNELDQISKIHDVIGTPAQKILTKFKQSRAMNFDFPFKKGSGIPLLTTNLSPQCLSLLHAMVAYDPDERIAAHQALQHPYFQEQR 169          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: ICK (intestinal cell kinase [Source:HGNC Symbol;Acc:HGNC:21219])

HSP 1 Score: 249.98 bits (637), Expect = 5.978e-74
Identity = 120/285 (42.11%), Postives = 193/285 (67.72%), Query Frame = 1
Query:   67 FRLISKKGEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVNNLREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIKGRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQSL-KIADFGSCKTIFSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASIL-KNFKKSRSVSFNFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFK 915
            +  I + G+GT+  VL  +++++ +  A KKMK+ + +W++  NLRE++++++LN H N++ L EV+  +++  L  I E M  NLY+LIK R    PE  ++  M+Q++QGL  IHK+G FHRD+KPEN+L     L KIADFG  + I S+ PYT+Y+STRWYRAPE LL    YS  +D+W+VGC+M E+ +LRPLFPGA+E+D I KI  +LG+P  +   + ++ S +++F +P    + ++ L+ + S EAV +++ ++++DP +R T   AL +PYF+
Sbjct:    4 YTTIRQLGDGTYGSVLLGRSIESGELIAIKKMKRKFYSWEECMNLREVKSLKKLN-HANVVKLKEVI--RENDHLYFIFEYMKENLYQLIKERNKLFPESAIRNIMYQILQGLAFIHKHGFFHRDLKPENLLCMGPELVKIADFGLAREIRSKPPYTDYVSTRWYRAPEVLLRSTNYSSPIDVWAVGCIMAEVYTLRPLFPGASEIDTIFKICQVLGTPKKTDWPEGYQLSSAMNFRWPQCVPNNLKTLIPNASSEAVQLLRDMLQWDPKKRPTASQALRYPYFQ 285          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: dyf-5 (Serine/threonine-protein kinase dyf-5 [Source:UniProtKB/Swiss-Prot;Acc:B3WFY8])

HSP 1 Score: 235.728 bits (600), Expect = 1.572e-70
Identity = 113/289 (39.10%), Postives = 190/289 (65.74%), Query Frame = 1
Query:   58 IKDFRLISKK-GEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVNNLREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIKGRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQSL-KIADFGSCKTIFSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASIL-KNFKKSRSVSFNFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFK 915
            + D  L++K+ G+GTF EV+  + +   D  A K+MK+ + +W++  +LRE++++++LN H NI+ L EV+  +++  L  + E M  NLYEL+K R  Y PE  ++  ++Q++QGL  +HKNG FHRD+KPENI+     L KIADFG  + I S+ PYT+Y+STRWYRAPE LL    Y+  +D+W++GC+M E+  LRPLFPG +E+DQ+ KI  ILG+P+     + ++ + +++F F     + +E+++  +S E + ++  ++ ++P +R     +L + YF+
Sbjct:    7 LADRYLMTKRLGDGTFGEVMLAKKIDTGDRVAIKRMKKKFYSWEEAMSLREVKSLKKLN-HPNIIKLREVI--RENDILYFVFEFMQENLYELMKDRDRYFPESVIRNIIYQVLQGLAFMHKNGFFHRDMKPENIMCNGTELVKIADFGLAREIRSKPPYTDYVSTRWYRAPEILLRSTSYNSPIDMWALGCIMAELYILRPLFPGTSEMDQLFKIISILGTPNKDEWPEGYQLASAMNFRFQQVVATPMEQVVNTISKEGMKLMMDMMLWNPEKRPNANQSLRYKYFQ 292          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: dyf-5 (Serine/threonine-protein kinase dyf-5 [Source:UniProtKB/Swiss-Prot;Acc:B3WFY8])

HSP 1 Score: 234.958 bits (598), Expect = 2.218e-70
Identity = 113/289 (39.10%), Postives = 190/289 (65.74%), Query Frame = 1
Query:   58 IKDFRLISKK-GEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVNNLREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIKGRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQSL-KIADFGSCKTIFSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASIL-KNFKKSRSVSFNFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFK 915
            + D  L++K+ G+GTF EV+  + +   D  A K+MK+ + +W++  +LRE++++++LN H NI+ L EV+  +++  L  + E M  NLYEL+K R  Y PE  ++  ++Q++QGL  +HKNG FHRD+KPENI+     L KIADFG  + I S+ PYT+Y+STRWYRAPE LL    Y+  +D+W++GC+M E+  LRPLFPG +E+DQ+ KI  ILG+P+     + ++ + +++F F     + +E+++  +S E + ++  ++ ++P +R     +L + YF+
Sbjct:    7 LADRYLMTKRLGDGTFGEVMLAKKIDTGDRVAIKRMKKKFYSWEEAMSLREVKSLKKLN-HPNIIKLREVI--RENDILYFVFEFMQENLYELMKDRDRYFPESVIRNIIYQVLQGLAFMHKNGFFHRDMKPENIMCNGTELVKIADFGLAREIRSKPPYTDYVSTRWYRAPEILLRSTSYNSPIDMWALGCIMAELYILRPLFPGTSEMDQLFKIISILGTPNKDEWPEGYQLASAMNFRFQQVVATPMEQVVNTISKEGMKLMMDMMLWNPEKRPNANQSLRYKYFQ 292          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: gsk-3 (Glycogen synthase kinase-3 [Source:UniProtKB/Swiss-Prot;Acc:Q9U2Q9])

HSP 1 Score: 167.548 bits (423), Expect = 1.911e-46
Identity = 105/289 (36.33%), Postives = 157/289 (54.33%), Query Frame = 1
Query:   88 GEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVNNLREIQAMRRLNPHENILLLHEVVFD----KKSGTLCLILELMDMNLYELIK---GRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQS--LKIADFGSCKTIFSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASILKNFKKSRSVSFNFPIRKGSGIERLL-AHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFKELR 924
            G G+F  V   +     +  A KK+ Q     D+    RE+Q MR+LN H NI+ L    +     K    L LILE +   +Y + +    ++  +P   VK YM+QL++ L +IH  GI HRD+KP+N+LI  +S  LK+ DFGS K +    P   YI +R+YRAPE +     Y+  +D+WS G VM E+L  +P+FPG + VDQ+ +I  +LG+P    +++   +    F FP  K     ++   H   EA+ +I ++IEY P+ R T Q A  H +F ELR
Sbjct:   43 GNGSFGVVFLAKLSTTNEMVAIKKVLQ-----DKRFKNRELQIMRKLN-HPNIVKLKYFFYSSGEKKDELYLNLILEYVPETVYRVARHYSKQRQQIPMIYVKLYMYQLLRSLAYIHSIGICHRDIKPQNLLIDPESGVLKLCDFGSAKYLVRNEPNVSYICSRYYRAPELIFGATNYTNSIDVWSAGTVMAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIQSMNPNYK-EFKFPQIKAHPWNKVFRVHTPAEAIDLISKIIEYTPTSRPTPQAACQHAFFDELR 324          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: cdk-2 (Cyclin-dependent kinase 2 [Source:UniProtKB/Swiss-Prot;Acc:O61847])

HSP 1 Score: 166.777 bits (421), Expect = 2.613e-46
Identity = 100/291 (34.36%), Postives = 163/291 (56.01%), Query Frame = 1
Query:   67 FRLISKKGEGTFSEVLKCQNVKNKDYFACKKMKQHY-ETWDQVNNLREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDM---NLYELIKGRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQS-LKIADFGSCKTI-FSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASI---LKNFKKSRSVSFNFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYF 912
            F  + + GEGT+  V K  +V++    A K ++    E       LREI  ++ L  H+NI+ L ++++   +  L ++ E +D    NL E+++   + LP + VK +MWQL+  L + H   I HRD+KP+NIL+ D   +KIADFG  +   F    YT  + T WYR PE LL    YS  +D+WS+GC+  EI S +PLFPG  E+ Q+ KI +I+G+P+      + +F   ++V   +P+      E   + ++   + ++++++ Y P RRLT + AL+H YF
Sbjct:   15 FCSLRRIGEGTYGVVFKAIHVRDNVKCALKMIRTDRDEEGIPSTCLREISCIKDLQ-HDNIVTLFDIIY--ANSKLYMVFEFIDRDLKNLLEMLEPTNSVLPPNYVKSFMWQLLSALSYCHLRRIVHRDLKPQNILVSDSGVIKIADFGLARNFSFPSRNYTHEVVTLWYRPPEILLGSQRYSTSLDMWSLGCIFSEIASNKPLFPGECEISQLFKIFEIVGTPNIKSWPGVDSFPHYKAVFPQWPVNLKKLEET--SCLTGNGLDVLREILRYPPERRLTAKGALSHRYF 300          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: cdk-4 (Cyclin-dependent kinase 4 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q9XTR1])

HSP 1 Score: 158.688 bits (400), Expect = 2.045e-43
Identity = 95/295 (32.20%), Postives = 164/295 (55.59%), Query Frame = 1
Query:   58 IKDFRLISKKGEGTFSEVLKCQNVKN-KDYFACKKMKQHYETWDQVNNLREIQAMRRL--NPHENILLLHEVV--FDKKSGTLC--LILELMDMNLYELIKGRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILI-RDQSLKIADFGSCKTIFSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASILKNFKKSRSVSFN-FPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFK 915
            +KDF++    G+G +  V + +++ + KDY   + M          + LREI  M+ L    H NI+ L  V    D     L   +I+E  D +L+  ++     +PE   K    Q+++ L  +H + I HRD+KP+NIL+ RDQ++K+ADFG  K   +   +T  + T WYR+PE LL   YY+  +D+W++GC++ EI   +PLF G NE +Q+  I   +G+P   + K++     ++ + FP  + + ++ L   +S +A+  ++Q + YD S+RL+ + AL+HP+ K
Sbjct:   35 MKDFQIHQALGKGAYGNVYRVRSLHDGKDYALKQIMISSKNEGIPQSVLREITVMKHLARKAHPNIISLKSVFHQLDPVRAILKINMIMERCDWDLHTFLRNIPRGVPEQQAKHVTAQIVRALDFLHTHSIIHRDLKPQNILLNRDQTVKLADFGLSKEYSNTTAFTTLVVTLWYRSPEVLL-QSYYNSTVDMWALGCIVSEIYCRQPLFVGQNEAEQLTDIFKKMGTP---VGKDWPSESVIARDSFPQYRPTNLKDLSPQMSKQAIEFVQQCLRYDHSKRLSARGALSHPFLK 325          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: CG42366 (gene:FBgn0259712 transcript:FBtr0331633)

HSP 1 Score: 238.81 bits (608), Expect = 1.780e-69
Identity = 114/291 (39.18%), Postives = 188/291 (64.60%), Query Frame = 1
Query:   76 ISKKGEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVNNLREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIKGRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQSL-KIADFGSCKTIFSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASILKN-FKKSRSVSFNFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFKELRSNSGTT 942
            +++ G+GT+  V+  Q     +  A K+MK+ Y +W++  NLRE++++++L+ H NI+ L EV+  +++ TL  + E M  NLY++IK R  +LPE ++K  ++Q++ GL  +H++G FHRD+KPEN+L     L KIADFG  + I SR P+T+Y+STRWYRAPE LL    Y   +DLW++GC+M E+ + RPLFPG++EVDQ+ KI  +LG+PD     + ++ +  + F +P      +  +++  S   + +++ ++ YDP +R T Q +L +PYF  L+  S T 
Sbjct:    7 LTQLGDGTYGTVVLGQRKDTGEKVAIKRMKRKYYSWEEAMNLREVKSLKKLS-HPNIVKLKEVI--RENDTLYFVFEYMKENLYQMIKDRDTHLPEPELKSILFQVLTGLAFMHRHGFFHRDLKPENLLCSGPDLIKIADFGLAREIRSRPPFTDYVSTRWYRAPEVLLHSTNYGSTIDLWAMGCIMAELYTFRPLFPGSSEVDQLFKICSVLGTPDKDDWPDGYRLASMIHFRYPDCIKVPLSSVVSRCSQNGLDLLEDMLAYDPDKRPTAQQSLKYPYFHALKRISPTA 294          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: CG42366 (gene:FBgn0259712 transcript:FBtr0299965)

HSP 1 Score: 238.81 bits (608), Expect = 1.877e-69
Identity = 114/291 (39.18%), Postives = 188/291 (64.60%), Query Frame = 1
Query:   76 ISKKGEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVNNLREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIKGRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQSL-KIADFGSCKTIFSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASILKN-FKKSRSVSFNFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFKELRSNSGTT 942
            +++ G+GT+  V+  Q     +  A K+MK+ Y +W++  NLRE++++++L+ H NI+ L EV+  +++ TL  + E M  NLY++IK R  +LPE ++K  ++Q++ GL  +H++G FHRD+KPEN+L     L KIADFG  + I SR P+T+Y+STRWYRAPE LL    Y   +DLW++GC+M E+ + RPLFPG++EVDQ+ KI  +LG+PD     + ++ +  + F +P      +  +++  S   + +++ ++ YDP +R T Q +L +PYF  L+  S T 
Sbjct:    7 LTQLGDGTYGTVVLGQRKDTGEKVAIKRMKRKYYSWEEAMNLREVKSLKKLS-HPNIVKLKEVI--RENDTLYFVFEYMKENLYQMIKDRDTHLPEPELKSILFQVLTGLAFMHRHGFFHRDLKPENLLCSGPDLIKIADFGLAREIRSRPPFTDYVSTRWYRAPEVLLHSTNYGSTIDLWAMGCIMAELYTFRPLFPGSSEVDQLFKICSVLGTPDKDDWPDGYRLASMIHFRYPDCIKVPLSSVVSRCSQNGLDLLEDMLAYDPDKRPTAQQSLKYPYFHALKRISPTA 294          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: sgg (gene:FBgn0003371 transcript:FBtr0070475)

HSP 1 Score: 167.162 bits (422), Expect = 6.657e-45
Identity = 103/304 (33.88%), Postives = 166/304 (54.61%), Query Frame = 1
Query:   88 GEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVNNLREIQAMRRLNPHENILLLHEVVFDKKSGT------LCLILELMDMNLYELIK---GRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQS--LKIADFGSCKTIFSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASILKNFKKSRSVSFNFPIRKGSGIERLL-AHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFKELRSNSGTTDPQSMDV 963
            G G+F  V + +     +  A KK+ Q     D+    RE+Q MR+L  H NI+ L  + F   SG       L L+LE +   +Y++ +     K  +P + ++ YM+QL + L +IH  GI HRD+KP+N+L+  ++  LK+ DFGS K +    P   YI +R+YRAPE +     Y+ ++D+WS GCV+ E+L  +P+FPG + VDQ+ ++  +LG+P    ++    + +  F FP  K    +++       EA++++  L+EY PS R+T   A  HP+F ELR     T P   D+
Sbjct:   43 GNGSFGVVFQAKLCDTGELVAIKKVLQ-----DRRFKNRELQIMRKLE-HCNIVKL--LYFFYSSGEKRDEVFLNLVLEYIPETVYKVARQYAKTKQTIPINFIRLYMYQLFRSLAYIHSLGICHRDIKPQNLLLDPETAVLKLCDFGSAKQLLHGEPNVSYICSRYYRAPELIFGAINYTTKIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEVIKVLGTPTREQIREMNPNYT-EFKFPQIKSHPWQKVFRIRTPTEAINLVSLLLEYTPSARITPLKACAHPFFDELRMEGNHTLPNGRDM 337          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: sgg (gene:FBgn0003371 transcript:FBtr0070469)

HSP 1 Score: 167.162 bits (422), Expect = 7.117e-45
Identity = 103/304 (33.88%), Postives = 166/304 (54.61%), Query Frame = 1
Query:   88 GEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVNNLREIQAMRRLNPHENILLLHEVVFDKKSGT------LCLILELMDMNLYELIK---GRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQS--LKIADFGSCKTIFSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASILKNFKKSRSVSFNFPIRKGSGIERLL-AHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFKELRSNSGTTDPQSMDV 963
            G G+F  V + +     +  A KK+ Q     D+    RE+Q MR+L  H NI+ L  + F   SG       L L+LE +   +Y++ +     K  +P + ++ YM+QL + L +IH  GI HRD+KP+N+L+  ++  LK+ DFGS K +    P   YI +R+YRAPE +     Y+ ++D+WS GCV+ E+L  +P+FPG + VDQ+ ++  +LG+P    ++    + +  F FP  K    +++       EA++++  L+EY PS R+T   A  HP+F ELR     T P   D+
Sbjct:   61 GNGSFGVVFQAKLCDTGELVAIKKVLQ-----DRRFKNRELQIMRKLE-HCNIVKL--LYFFYSSGEKRDEVFLNLVLEYIPETVYKVARQYAKTKQTIPINFIRLYMYQLFRSLAYIHSLGICHRDIKPQNLLLDPETAVLKLCDFGSAKQLLHGEPNVSYICSRYYRAPELIFGAINYTTKIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEVIKVLGTPTREQIREMNPNYT-EFKFPQIKSHPWQKVFRIRTPTEAINLVSLLLEYTPSARITPLKACAHPFFDELRMEGNHTLPNGRDM 355          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: sgg (gene:FBgn0003371 transcript:FBtr0070472)

HSP 1 Score: 167.162 bits (422), Expect = 7.117e-45
Identity = 103/304 (33.88%), Postives = 166/304 (54.61%), Query Frame = 1
Query:   88 GEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVNNLREIQAMRRLNPHENILLLHEVVFDKKSGT------LCLILELMDMNLYELIK---GRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQS--LKIADFGSCKTIFSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASILKNFKKSRSVSFNFPIRKGSGIERLL-AHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFKELRSNSGTTDPQSMDV 963
            G G+F  V + +     +  A KK+ Q     D+    RE+Q MR+L  H NI+ L  + F   SG       L L+LE +   +Y++ +     K  +P + ++ YM+QL + L +IH  GI HRD+KP+N+L+  ++  LK+ DFGS K +    P   YI +R+YRAPE +     Y+ ++D+WS GCV+ E+L  +P+FPG + VDQ+ ++  +LG+P    ++    + +  F FP  K    +++       EA++++  L+EY PS R+T   A  HP+F ELR     T P   D+
Sbjct:   61 GNGSFGVVFQAKLCDTGELVAIKKVLQ-----DRRFKNRELQIMRKLE-HCNIVKL--LYFFYSSGEKRDEVFLNLVLEYIPETVYKVARQYAKTKQTIPINFIRLYMYQLFRSLAYIHSLGICHRDIKPQNLLLDPETAVLKLCDFGSAKQLLHGEPNVSYICSRYYRAPELIFGAINYTTKIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEVIKVLGTPTREQIREMNPNYT-EFKFPQIKSHPWQKVFRIRTPTEAINLVSLLLEYTPSARITPLKACAHPFFDELRMEGNHTLPNGRDM 355          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: mak (male germ cell-associated kinase [Source:ZFIN;Acc:ZDB-GENE-030131-7279])

HSP 1 Score: 234.572 bits (597), Expect = 1.791e-68
Identity = 115/285 (40.35%), Postives = 189/285 (66.32%), Query Frame = 1
Query:   67 FRLISKKGEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVNNLREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIKGRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQSL-KIADFGSCKTIFSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASIL-KNFKKSRSVSFNFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFK 915
            +  + + G+GT+  VL  ++ ++ +  A K+MK+ + +W++  NLRE++++++LN H N++ L EV+  +++  L  + E M  NLY+L+K R    PE  ++   +Q++QGL  IHK+G FHRD+KPEN+L     L KIADFG  + I SR PYT+Y+STRWYRAPE LL    YS  +D+W+VGC+M E+ +LRPLFPG +EVD+I KI  +LG+   S   +  + + +++F FP    + ++ L+ + + EA+ I++ L+++DP +R +   AL +PYF+
Sbjct:    4 YTTLKQLGDGTYGSVLMGKSNESGELVAIKRMKRKFYSWEECMNLREVKSLKKLN-HANVVKLKEVI--RENDHLYFVFEYMKENLYQLMKDRTKLFPESVIRNISFQILQGLSFIHKHGFFHRDMKPENLLCMGPELVKIADFGLAREIRSRPPYTDYVSTRWYRAPEVLLRSPVYSSPIDIWAVGCIMAELYTLRPLFPGNSEVDEIFKICQVLGTVKKSDWPEGHQLASAMNFRFPQCVPTPLKTLIPNATNEALDIMRDLLQWDPKKRPSAVKALRYPYFQ 285          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: mak (male germ cell-associated kinase [Source:ZFIN;Acc:ZDB-GENE-030131-7279])

HSP 1 Score: 232.646 bits (592), Expect = 1.021e-67
Identity = 114/286 (39.86%), Postives = 193/286 (67.48%), Query Frame = 1
Query:   67 FRLISKKGEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVNNLREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIKGRKNYL-PEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQSL-KIADFGSCKTIFSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASIL-KNFKKSRSVSFNFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFK 915
            +  + + G+GT+  VL  ++ ++ +  A K+MK+ + +W++  NLRE++++++LN H N++ L EV+  +++  L  + E M  NLY+L+K R+N +  E++++  M+Q++ GL  +HK+G FHRD+KPEN+L     L KIADFG  + I SR PYT+Y+STRWYRAPE LL    YS  +D+W+VGC+M E+ +LRPLFPG +EVD+I KI  +LG+   S   +  + + +++F FP    + ++ L+ + + EA+ I++ L+++DP +R +   AL +PYF+
Sbjct:    4 YTTLKQLGDGTYGSVLMGKSNESGELVAIKRMKRKFYSWEECMNLREVKSLKKLN-HANVVKLKEVI--RENDHLYFVFEYMKENLYQLMKDRENKMFTENEIRNIMFQVLSGLAFVHKHGFFHRDMKPENLLCMGPELVKIADFGLAREIRSRPPYTDYVSTRWYRAPEVLLRSPVYSSPIDIWAVGCIMAELYTLRPLFPGNSEVDEIFKICQVLGTVKKSDWPEGHQLASAMNFRFPQCVPTPLKTLIPNATNEALDIMRDLLQWDPKKRPSAVKALRYPYFQ 286          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: cdk2 (cyclin-dependent kinase 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2741])

HSP 1 Score: 171.785 bits (434), Expect = 1.899e-48
Identity = 98/292 (33.56%), Postives = 165/292 (56.51%), Query Frame = 1
Query:   58 IKDFRLISKKGEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVNN-LREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIKGRK-NYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQS-LKIADFGSCKTI-FSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASILKNFKKSRSVSFNFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFKEL 921
            ++ F+ + K GEGT+  V K +N    +  A KK++   ET    +  +REI  ++ LN H NI+ L +V+  +    L L+ E +  +L   +     + +    VK Y++QL+QGL   H + + HRD+KP+N+LI  Q  +K+ADFG  +        YT  + T WYRAPE LL   YYS  +D+WS+GC+  E+++ R LFPG +E+DQ+ +I   LG+PD SI            +FP      + +++  +  +   ++ Q++ YDP++R++ +NAL H +F+++
Sbjct:    1 MESFQKVEKIGEGTYGVVYKAKNKVTGETVALKKIRLDTETEGVPSTAIREISLLKELN-HPNIVKLRDVIHTENK--LYLVFEFLHQDLKRFMDSTSVSGISLPLVKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINAQGEIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMITRRALFPGDSEIDQLFRIFRTLGTPDESIWPGVTSMPDYKPSFPKWARQDLSKVVPPLDEDGRDLLGQMLTYDPNKRISAKNALVHRFFRDV 289          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: mapk7 (mitogen-activated protein kinase 7 [Source:ZFIN;Acc:ZDB-GENE-050320-10])

HSP 1 Score: 179.104 bits (453), Expect = 2.403e-47
Identity = 96/297 (32.32%), Postives = 163/297 (54.88%), Query Frame = 1
Query:   64 DFRLISKKGEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVN-NLREIQAMRRLNPHENIL----LLHEVVFDKKSGTLCLILELMDMNLYELIKGRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQ-SLKIADFGSCKTIFSRYP------YTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASILKNFKKSRSVSF--NFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYF 912
            ++ +I   G G +  V   +   N    A KK+   +E        LRE++ ++    H+NI+    +L  VV      ++ ++L+LM+ +L+++I  R+   PEH  + +++QL++GL +IH   + HRD+KP N+L+ +   LKI DFG  + + + Y        TEY++TRWYRAPE +L+  +YS  +DLWSVGC+  E+L  R +FPG N V Q+  I  +LG+P  SI+ +    R  S+  + P +    +  L       A++++  ++ +DP  R++   AL HPY 
Sbjct:   79 EYDIIETIGTGAYGVVSSARRRDNGQQVAIKKIPNAFEVVTNAKRTLRELKILKHFK-HDNIIAIKDILQPVVPHSAFKSVYVVLDLMESDLHQIIHSRQPLTPEH-TRYFLYQLLRGLKYIHSANVIHRDLKPSNLLVNENCELKIGDFGMARGLSAVYSEESRSFMTEYVATRWYRAPELMLSLHHYSLAIDLWSVGCIFGEMLGRRQMFPGKNYVHQLQLILSVLGTPPESIVGSIGSDRVRSYVRSLPSKAPEPLAALYPQAEPSALNLLAAMLRFDPRERISACQALEHPYL 373          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: mapk7 (mitogen-activated protein kinase 7 [Source:ZFIN;Acc:ZDB-GENE-050320-10])

HSP 1 Score: 179.104 bits (453), Expect = 2.403e-47
Identity = 96/297 (32.32%), Postives = 163/297 (54.88%), Query Frame = 1
Query:   64 DFRLISKKGEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVN-NLREIQAMRRLNPHENIL----LLHEVVFDKKSGTLCLILELMDMNLYELIKGRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQ-SLKIADFGSCKTIFSRYP------YTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASILKNFKKSRSVSF--NFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYF 912
            ++ +I   G G +  V   +   N    A KK+   +E        LRE++ ++    H+NI+    +L  VV      ++ ++L+LM+ +L+++I  R+   PEH  + +++QL++GL +IH   + HRD+KP N+L+ +   LKI DFG  + + + Y        TEY++TRWYRAPE +L+  +YS  +DLWSVGC+  E+L  R +FPG N V Q+  I  +LG+P  SI+ +    R  S+  + P +    +  L       A++++  ++ +DP  R++   AL HPY 
Sbjct:   79 EYDIIETIGTGAYGVVSSARRRDNGQQVAIKKIPNAFEVVTNAKRTLRELKILKHFK-HDNIIAIKDILQPVVPHSAFKSVYVVLDLMESDLHQIIHSRQPLTPEH-TRYFLYQLLRGLKYIHSANVIHRDLKPSNLLVNENCELKIGDFGMARGLSAVYSEESRSFMTEYVATRWYRAPELMLSLHHYSLAIDLWSVGCIFGEMLGRRQMFPGKNYVHQLQLILSVLGTPPESIVGSIGSDRVRSYVRSLPSKAPEPLAALYPQAEPSALNLLAAMLRFDPRERISACQALEHPYL 373          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: ltb4r2 (leukotriene B4 receptor 2 [Source:Xenbase;Acc:XB-GENE-984956])

HSP 1 Score: 406.757 bits (1044), Expect = 5.012e-137
Identity = 178/286 (62.24%), Postives = 238/286 (83.22%), Query Frame = 1
Query:   67 FRLISKKGEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVNNLREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIKGRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQSLKIADFGSCKTIFSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASILKNFKKSRSVSFNFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFKELR 924
            ++ ISK GEGTFSEVLK Q++++ +++ACKKMKQ +++ +QVNNLRE+QA+RRL+PH NIL L EV+FD+KSG L LI ELMDMN+YELI+GR++ LP++ +++YM+QL + L HIH+NGIFHRDVKPENILI+   LK+ DFGSC+++FS+ PYTEYISTRWYRAPECLLTDGYY+Y+MD+WS GCV FEI SL PLFPG+NE+DQI KIHD++G+PD ++L+ FK+SRS+SF+FP +KG+GI RLL ++  + +S++  ++EYDP  R      L HPYF E R
Sbjct:    7 YKTISKIGEGTFSEVLKTQSLQDGNFYACKKMKQQFKSAEQVNNLREVQALRRLSPHPNILTLCEVIFDRKSGGLSLICELMDMNIYELIRGRRHPLPQNKLRQYMYQLCKSLEHIHRNGIFHRDVKPENILIKQDVLKLGDFGSCRSVFSKQPYTEYISTRWYRAPECLLTDGYYTYKMDIWSAGCVFFEIASLHPLFPGSNELDQISKIHDVIGTPDQALLQKFKQSRSMSFDFPSKKGTGITRLLPNMPPDCLSLMCAMLEYDPDERPNASQTLQHPYFTEHR 292          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: ltb4r2 (leukotriene B4 receptor 2 [Source:Xenbase;Acc:XB-GENE-984956])

HSP 1 Score: 406.757 bits (1044), Expect = 7.020e-137
Identity = 178/286 (62.24%), Postives = 238/286 (83.22%), Query Frame = 1
Query:   67 FRLISKKGEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVNNLREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIKGRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQSLKIADFGSCKTIFSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASILKNFKKSRSVSFNFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFKELR 924
            ++ ISK GEGTFSEVLK Q++++ +++ACKKMKQ +++ +QVNNLRE+QA+RRL+PH NIL L EV+FD+KSG L LI ELMDMN+YELI+GR++ LP++ +++YM+QL + L HIH+NGIFHRDVKPENILI+   LK+ DFGSC+++FS+ PYTEYISTRWYRAPECLLTDGYY+Y+MD+WS GCV FEI SL PLFPG+NE+DQI KIHD++G+PD ++L+ FK+SRS+SF+FP +KG+GI RLL ++  + +S++  ++EYDP  R      L HPYF E R
Sbjct:    4 YKTISKIGEGTFSEVLKTQSLQDGNFYACKKMKQQFKSAEQVNNLREVQALRRLSPHPNILTLCEVIFDRKSGGLSLICELMDMNIYELIRGRRHPLPQNKLRQYMYQLCKSLEHIHRNGIFHRDVKPENILIKQDVLKLGDFGSCRSVFSKQPYTEYISTRWYRAPECLLTDGYYTYKMDIWSAGCVFFEIASLHPLFPGSNELDQISKIHDVIGTPDQALLQKFKQSRSMSFDFPSKKGTGITRLLPNMPPDCLSLMCAMLEYDPDERPNASQTLQHPYFTEHR 289          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: ltb4r2 (leukotriene B4 receptor 2 [Source:Xenbase;Acc:XB-GENE-984956])

HSP 1 Score: 337.806 bits (865), Expect = 8.928e-111
Identity = 156/286 (54.55%), Postives = 208/286 (72.73%), Query Frame = 1
Query:   67 FRLISKKGEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVNNLREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIKGRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQSLKIADFGSCKTIFSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASILKNFKKSRSVSFNFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFKELR 924
            ++ ISK GEGTFSEVLK Q++++ +++ACKKMKQ +++ +QVNNLRE+QA+RRL+PH NIL L EV+FD+KSG L LI ELMDMN+YELI+GR++ LP++ +++YM+QL + L HIH+NGIFHRDVKPENILI+   LK+ DFGSC+++FS+ PYTEYISTRWYRAPECLLTDGYY+Y+MD+WS GCV FEI                                   +SRS+SF+FP +KG+GI RLL ++  + +S++  ++EYDP  R      L HPYF E R
Sbjct:    4 YKTISKIGEGTFSEVLKTQSLQDGNFYACKKMKQQFKSAEQVNNLREVQALRRLSPHPNILTLCEVIFDRKSGGLSLICELMDMNIYELIRGRRHPLPQNKLRQYMYQLCKSLEHIHRNGIFHRDVKPENILIKQDVLKLGDFGSCRSVFSKQPYTEYISTRWYRAPECLLTDGYYTYKMDIWSAGCVFFEI----------------------------------ARSRSMSFDFPSKKGTGITRLLPNMPPDCLSLMCAMLEYDPDERPNASQTLQHPYFTEHR 255          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: dnajc3 (DnaJ heat shock protein family (Hsp40) member C3 [Source:Xenbase;Acc:XB-GENE-997043])

HSP 1 Score: 241.891 bits (616), Expect = 2.257e-71
Identity = 116/285 (40.70%), Postives = 190/285 (66.67%), Query Frame = 1
Query:   67 FRLISKKGEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVNNLREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIKGRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQSL-KIADFGSCKTIFSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASIL-KNFKKSRSVSFNFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFK 915
            +  + + G+GT+  VL  ++ ++ +  A K+MK+ + +W++  NLRE++++++LN H N++ L EV+  +++  L  + E M  NLY+L+K R    PE  ++  M+Q++QGL  IHK+G FHRD+KPEN+L     L KIADFG  + + S+ PYT+Y+STRWYRAPE LL    YS  +D+W+VG +M E+ +LRPLFPG +EVDQI KI  +LG+P  +   + ++ + S++F FP      ++ L+ + S +A+S+++  +++DP +R T   AL HPYF+
Sbjct:    4 YTTMKQLGDGTYGSVLMGRSNESGELVAIKRMKRKFYSWEECMNLREVKSLKKLN-HANVVKLKEVI--RENDQLFFVFEYMKENLYQLMKDRNKLFPESVIRNIMYQILQGLAFIHKHGFFHRDMKPENLLCMGPELVKIADFGLVRELRSQPPYTDYVSTRWYRAPEVLLRSSSYSSPIDIWAVGSIMAELYTLRPLFPGTSEVDQIFKICQVLGTPKKNDWPEGYQLAASMNFRFPQCVPINLKTLIPNASEDALSLMRDTMQWDPKKRPTASQALRHPYFQ 285          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: ICK (intestinal cell (MAK-like) kinase [Source:NCBI gene;Acc:100498050])

HSP 1 Score: 237.269 bits (604), Expect = 3.901e-71
Identity = 113/285 (39.65%), Postives = 188/285 (65.96%), Query Frame = 1
Query:   67 FRLISKKGEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVNNLREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIKGRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQSL-KIADFGSCKTIFSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDAS-ILKNFKKSRSVSFNFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFK 915
            +  + + G+GT+  V+  ++V++ +  A KKMK+ + +WD+  NLRE++++++LN H N++ L EV+  +++  L  + E M  NLY+L+K R    PE  ++  M+Q++QGL +IHK G FHRD+KPEN+L     L KIADFG  +   SR PYT+Y+STRWYRAPE LL    Y+  +D+W+VGC+M EI +LRPLFPG++EVD I KI  +LG+P  +   + F+ + +++F +     S ++ L+ +   + + +++ ++++DP +R T   AL + YF+
Sbjct:    4 YTTVKQLGDGTYGSVILGRSVESGELVAIKKMKRKFYSWDECMNLREVKSLKKLN-HANVIKLKEVI--RENNQLYFVFEYMKENLYQLMKDRNKLFPESIIRNIMYQILQGLAYIHKYGFFHRDLKPENLLCMGPELVKIADFGLARETRSRPPYTDYVSTRWYRAPEVLLRATNYNSPIDIWAVGCIMAEIYTLRPLFPGSSEVDTIFKICQVLGTPKKNDWFEGFQLASAMNFRWAHCVPSNLKTLIPNACADGIQVMRDMLQWDPKKRPTASQALRYSYFQ 285          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Mok (MOK protein kinase [Source:MGI Symbol;Acc:MGI:1336881])

HSP 1 Score: 407.142 bits (1045), Expect = 3.137e-137
Identity = 177/295 (60.00%), Postives = 238/295 (80.68%), Query Frame = 1
Query:   58 IKDFRLISKKGEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVNNLREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIKGRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQSLKIADFGSCKTIFSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASILKNFKKSRSVSFNFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFKELRSNSGTT 942
            +K+++ I K GEGTFSEV+K Q++++ +Y+ACK+MKQH+E+ +QVN+LREIQA+RRLNPH NIL LHEVVFD+KSG+L LI ELMDMN+YELI+GR++ L E  +  YM+QL + L H+H+NGIFHRDVKPENIL++   LK+ DFGSC++++S+ PYTEYISTRWYRAPECLLTDG+Y+Y+MDLWS GCV +EI SL+PLFPG NE+DQI KIHD++G+P    L  FK+SR++SF+FP +KGSGI  L A++S + +S++  ++ YDP  R+    AL HPYF+  R+    T
Sbjct:    1 MKNYKAIGKIGEGTFSEVMKMQSLRDGNYYACKQMKQHFESIEQVNSLREIQALRRLNPHPNILALHEVVFDRKSGSLALICELMDMNIYELIRGRRHPLSEKKIMLYMYQLCKSLDHMHRNGIFHRDVKPENILVKQDVLKLGDFGSCRSVYSKQPYTEYISTRWYRAPECLLTDGFYTYKMDLWSAGCVFYEIASLQPLFPGVNELDQISKIHDVIGTPCQKTLTKFKQSRAMSFDFPFKKGSGIPLLTANLSPQCLSLLHAMVAYDPDERIAAHQALQHPYFQVQRAAETQT 295          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Ick (intestinal cell kinase [Source:MGI Symbol;Acc:MGI:1934157])

HSP 1 Score: 250.751 bits (639), Expect = 2.528e-75
Identity = 122/285 (42.81%), Postives = 193/285 (67.72%), Query Frame = 1
Query:   67 FRLISKKGEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVNNLREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIKGRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQSL-KIADFGSCKTIFSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASIL-KNFKKSRSVSFNFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFK 915
            +  I + G+GT+  VL  +++++ +  A KKMK+ + +W++  NLRE++++++LN H NI+ L EV+  +++  L  I E M  NLY+LIK R    PE  ++  M+Q++QGL  IHK+G FHRD+KPEN+L     L KIADFG  + I SR PYT+Y+STRWYRAPE LL    YS  +D+W+VGC+M E+ +LRPLFPGA+E+D I KI  +LG+P  +   + ++ S +++F +P    + ++ L+ + S EA+ +++ L+++DP +R T   AL +PYF+
Sbjct:    4 YTTIKQLGDGTYGSVLLGRSIESGELIAIKKMKRKFYSWEECMNLREVKSLKKLN-HANIVKLKEVI--RENDHLYFIFEYMKENLYQLIKERNKLFPESAIRNIMYQILQGLAFIHKHGFFHRDLKPENLLCMGPELVKIADFGLAREIRSRPPYTDYVSTRWYRAPEVLLRSTNYSSPIDIWAVGCIMAEVYTLRPLFPGASEIDTIFKICQVLGTPKKTDWPEGYQLSSAMNFLWPQCIPNNLKTLIPNASSEAIQLLRDLLQWDPKKRPTASQALRYPYFQ 285          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Ick (intestinal cell kinase [Source:MGI Symbol;Acc:MGI:1934157])

HSP 1 Score: 251.136 bits (640), Expect = 1.293e-74
Identity = 122/285 (42.81%), Postives = 193/285 (67.72%), Query Frame = 1
Query:   67 FRLISKKGEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVNNLREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIKGRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQSL-KIADFGSCKTIFSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASIL-KNFKKSRSVSFNFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFK 915
            +  I + G+GT+  VL  +++++ +  A KKMK+ + +W++  NLRE++++++LN H NI+ L EV+  +++  L  I E M  NLY+LIK R    PE  ++  M+Q++QGL  IHK+G FHRD+KPEN+L     L KIADFG  + I SR PYT+Y+STRWYRAPE LL    YS  +D+W+VGC+M E+ +LRPLFPGA+E+D I KI  +LG+P  +   + ++ S +++F +P    + ++ L+ + S EA+ +++ L+++DP +R T   AL +PYF+
Sbjct:    4 YTTIKQLGDGTYGSVLLGRSIESGELIAIKKMKRKFYSWEECMNLREVKSLKKLN-HANIVKLKEVI--RENDHLYFIFEYMKENLYQLIKERNKLFPESAIRNIMYQILQGLAFIHKHGFFHRDLKPENLLCMGPELVKIADFGLAREIRSRPPYTDYVSTRWYRAPEVLLRSTNYSSPIDIWAVGCIMAEVYTLRPLFPGASEIDTIFKICQVLGTPKKTDWPEGYQLSSAMNFLWPQCIPNNLKTLIPNASSEAIQLLRDLLQWDPKKRPTASQALRYPYFQ 285          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Ick (intestinal cell kinase [Source:MGI Symbol;Acc:MGI:1934157])

HSP 1 Score: 251.136 bits (640), Expect = 1.293e-74
Identity = 122/285 (42.81%), Postives = 193/285 (67.72%), Query Frame = 1
Query:   67 FRLISKKGEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVNNLREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIKGRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQSL-KIADFGSCKTIFSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASIL-KNFKKSRSVSFNFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFK 915
            +  I + G+GT+  VL  +++++ +  A KKMK+ + +W++  NLRE++++++LN H NI+ L EV+  +++  L  I E M  NLY+LIK R    PE  ++  M+Q++QGL  IHK+G FHRD+KPEN+L     L KIADFG  + I SR PYT+Y+STRWYRAPE LL    YS  +D+W+VGC+M E+ +LRPLFPGA+E+D I KI  +LG+P  +   + ++ S +++F +P    + ++ L+ + S EA+ +++ L+++DP +R T   AL +PYF+
Sbjct:    4 YTTIKQLGDGTYGSVLLGRSIESGELIAIKKMKRKFYSWEECMNLREVKSLKKLN-HANIVKLKEVI--RENDHLYFIFEYMKENLYQLIKERNKLFPESAIRNIMYQILQGLAFIHKHGFFHRDLKPENLLCMGPELVKIADFGLAREIRSRPPYTDYVSTRWYRAPEVLLRSTNYSSPIDIWAVGCIMAEVYTLRPLFPGASEIDTIFKICQVLGTPKKTDWPEGYQLSSAMNFLWPQCIPNNLKTLIPNASSEAIQLLRDLLQWDPKKRPTASQALRYPYFQ 285          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Mak (male germ cell-associated kinase [Source:MGI Symbol;Acc:MGI:96913])

HSP 1 Score: 241.891 bits (616), Expect = 2.826e-71
Identity = 116/285 (40.70%), Postives = 188/285 (65.96%), Query Frame = 1
Query:   67 FRLISKKGEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVNNLREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIKGRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQSL-KIADFGSCKTIFSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASIL-KNFKKSRSVSFNFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFK 915
            +  + + G+GT+  VL  ++ ++ +  A K+MK+ + +WD+  NLRE++++++LN H N++ L EV+  +++  L  + E M  NLY+L+K R    PE  ++  M+Q++QGL  IHK+G FHRD+KPEN+L     L KIADFG  + + S+ PYT+Y+STRWYRAPE LL    YS  +D+W+VG +M E+ + RPLFPG +EVD+I KI  +LG+P  S   + ++ + S++F FP      ++ L+ + S EA+ ++ +++ +DP +R T   AL HPYF+
Sbjct:    4 YTTMKQLGDGTYGSVLMGKSNESGELVAIKRMKRKFYSWDECMNLREVKSLKKLN-HANVIKLKEVI--RENDHLYFVFEYMKENLYQLMKDRNKLFPESVIRNIMYQILQGLAFIHKHGFFHRDMKPENLLCMGPELVKIADFGLARELRSQPPYTDYVSTRWYRAPEVLLRSSVYSSPIDVWAVGSIMAELYTFRPLFPGTSEVDEIFKICQVLGTPKKSDWPEGYQLASSMNFRFPQCIPINLKTLIPNASSEAIQLMTEMLNWDPKKRPTASQALKHPYFQ 285          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9UQ07|MOK_HUMAN (MAPK/MAK/MRK overlapping kinase OS=Homo sapiens OX=9606 GN=MOK PE=2 SV=1)

HSP 1 Score: 409.453 bits (1051), Expect = 2.509e-137
Identity = 182/309 (58.90%), Postives = 244/309 (78.96%), Query Frame = 1
Query:   58 IKDFRLISKKGEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVNNLREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIKGRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQSLKIADFGSCKTIFSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASILKNFKKSRSVSFNFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFKELRSNSGTTDPQSMDVLSKKGKP 984
            +K+++ I K GEGTFSEV+K Q++++ +Y+ACK+MKQ +E+ +QVNNLREIQA+RRLNPH NIL+LHEVVFD+KSG+L LI ELMDMN+YELI+GR+  L E  +  YM+QL + L HIH+NGIFHRDVKPENILI+   LK+ DFGSC++++S+ PYTEYISTRWYRAPECLLTDG+Y+Y+MDLWS GCV +EI SL+PLFPG NE+DQI KIHD++G+P   IL  FK+SR+++F+FP +KGSGI  L  ++S + +S++  ++ YDP  R+    AL HPYF+E R     T+ +++    K G P
Sbjct:    1 MKNYKAIGKIGEGTFSEVMKMQSLRDGNYYACKQMKQRFESIEQVNNLREIQALRRLNPHPNILMLHEVVFDRKSGSLALICELMDMNIYELIRGRRYPLSEKKIMHYMYQLCKSLDHIHRNGIFHRDVKPENILIKQDVLKLGDFGSCRSVYSKQPYTEYISTRWYRAPECLLTDGFYTYKMDLWSAGCVFYEIASLQPLFPGVNELDQISKIHDVIGTPAQKILTKFKQSRAMNFDFPFKKGSGIPLLTTNLSPQCLSLLHAMVAYDPDERIAAHQALQHPYFQEQRK----TEKRALGSHRKAGFP 305          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9WVS4|MOK_MOUSE (MAPK/MAK/MRK overlapping kinase OS=Mus musculus OX=10090 GN=Mok PE=1 SV=1)

HSP 1 Score: 407.142 bits (1045), Expect = 2.194e-136
Identity = 177/295 (60.00%), Postives = 238/295 (80.68%), Query Frame = 1
Query:   58 IKDFRLISKKGEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVNNLREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIKGRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQSLKIADFGSCKTIFSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASILKNFKKSRSVSFNFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFKELRSNSGTT 942
            +K+++ I K GEGTFSEV+K Q++++ +Y+ACK+MKQH+E+ +QVN+LREIQA+RRLNPH NIL LHEVVFD+KSG+L LI ELMDMN+YELI+GR++ L E  +  YM+QL + L H+H+NGIFHRDVKPENIL++   LK+ DFGSC++++S+ PYTEYISTRWYRAPECLLTDG+Y+Y+MDLWS GCV +EI SL+PLFPG NE+DQI KIHD++G+P    L  FK+SR++SF+FP +KGSGI  L A++S + +S++  ++ YDP  R+    AL HPYF+  R+    T
Sbjct:    1 MKNYKAIGKIGEGTFSEVMKMQSLRDGNYYACKQMKQHFESIEQVNSLREIQALRRLNPHPNILALHEVVFDRKSGSLALICELMDMNIYELIRGRRHPLSEKKIMLYMYQLCKSLDHMHRNGIFHRDVKPENILVKQDVLKLGDFGSCRSVYSKQPYTEYISTRWYRAPECLLTDGFYTYKMDLWSAGCVFYEIASLQPLFPGVNELDQISKIHDVIGTPCQKTLTKFKQSRAMSFDFPFKKGSGIPLLTANLSPQCLSLLHAMVAYDPDERIAAHQALQHPYFQVQRAAETQT 295          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q84SN3|CDKF3_ORYSJ (Cyclin-dependent kinase F-3 OS=Oryza sativa subsp. japonica OX=39947 GN=CDKF-3 PE=2 SV=1)

HSP 1 Score: 249.98 bits (637), Expect = 1.838e-75
Identity = 117/286 (40.91%), Postives = 187/286 (65.38%), Query Frame = 1
Query:   58 IKDFRLISKKGEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVNNLREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIKGRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQSLKIADFGSCKTIFSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASIL-KNFKKSRSVSFNFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYF 912
            ++ +++I + G+GT   V +  N +  +  A KKMK+ +  W++  +LRE++A+++LN H NI+ L EV  +     L  I E M+ NLY++I+ R+    E +++ +M Q++QGL ++H NG FHRD+KPEN+L+ D ++KIADFG  + + S  PYT+Y+STRWYRAPE LL    Y+  +D+W+VG ++ E+ +L PLFPG +E DQ+ KI  +LG+PD ++  +     RS SFNF       +  L+ + +LEA+ +I+QL  +DP RR T + +L HP+F
Sbjct:    1 MERYKVIREIGDGTCGNVFRAYNTETNEIVAVKKMKRKFFQWEECISLREVKALQKLN-HPNIVKLKEVTMENHE--LFFIFENMECNLYDVIRERQAAFSEEEIRNFMVQILQGLAYMHNNGYFHRDLKPENLLVTDGTVKIADFGLAREVSSSPPYTDYVSTRWYRAPEVLLQSSAYTPAIDMWAVGAILAELFTLSPLFPGGSETDQLYKICAVLGTPDHTVWPEGMNLPRSSSFNFFQIPPRNLWELIPNATLEAIDLIQQLCSWDPRRRPTAEQSLQHPFF 283          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|P43294|MHK_ARATH (Serine/threonine-protein kinase MHK OS=Arabidopsis thaliana OX=3702 GN=MHK PE=2 SV=2)

HSP 1 Score: 247.284 bits (630), Expect = 3.276e-74
Identity = 121/283 (42.76%), Postives = 184/283 (65.02%), Query Frame = 1
Query:   67 FRLISKKGEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVNNLREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIKGRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQSLKIADFGSCKTIFSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASILKNFKK-SRSVSFNFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYF 912
            ++++ + G+GT   V K  N++  +  A KKMK+ +  W++  NLRE++A+R+LN H +I+ L E+V  ++   L  I E MD NLY ++K R+    E +++ +M Q++QGL H+HKNG FHRD+KPEN+L+ +  LKIADFG  + + S  PYTEY+STRWYRAPE LL    Y+  +D+W+VG ++ E+ +L PLFPG +E+DQ+ KI  +LG PD +     K  SR +S +      + I  LL + + EA+ +I +L  +DP +R T   ALNHP+F
Sbjct:   12 YKILEELGDGTCGSVYKAVNLETYEVVAVKKMKRKFYYWEECVNLREVKALRKLN-HPHIIKLKEIV--REHNELFFIFECMDHNLYHIMKERERPFSEGEIRSFMSQMLQGLAHMHKNGYFHRDLKPENLLVTNNILKIADFGLAREVASMPPYTEYVSTRWYRAPEVLLQSSLYTPAVDMWAVGAILAELYALTPLFPGESEIDQLYKICCVLGKPDWTTFPEAKSISRIMSISHTEFPQTRIADLLPNAAPEAIDLINRLCSWDPLKRPTADEALNHPFF 291          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9JKV2|CILK1_MOUSE (Serine/threonine-protein kinase ICK OS=Mus musculus OX=10090 GN=Cilk1 PE=1 SV=2)

HSP 1 Score: 251.136 bits (640), Expect = 9.045e-74
Identity = 122/285 (42.81%), Postives = 193/285 (67.72%), Query Frame = 1
Query:   67 FRLISKKGEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVNNLREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIKGRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQSL-KIADFGSCKTIFSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASIL-KNFKKSRSVSFNFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFK 915
            +  I + G+GT+  VL  +++++ +  A KKMK+ + +W++  NLRE++++++LN H NI+ L EV+  +++  L  I E M  NLY+LIK R    PE  ++  M+Q++QGL  IHK+G FHRD+KPEN+L     L KIADFG  + I SR PYT+Y+STRWYRAPE LL    YS  +D+W+VGC+M E+ +LRPLFPGA+E+D I KI  +LG+P  +   + ++ S +++F +P    + ++ L+ + S EA+ +++ L+++DP +R T   AL +PYF+
Sbjct:    4 YTTIKQLGDGTYGSVLLGRSIESGELIAIKKMKRKFYSWEECMNLREVKSLKKLN-HANIVKLKEVI--RENDHLYFIFEYMKENLYQLIKERNKLFPESAIRNIMYQILQGLAFIHKHGFFHRDLKPENLLCMGPELVKIADFGLAREIRSRPPYTDYVSTRWYRAPEVLLRSTNYSSPIDIWAVGCIMAEVYTLRPLFPGASEIDTIFKICQVLGTPKKTDWPEGYQLSSAMNFLWPQCIPNNLKTLIPNASSEAIQLLRDLLQWDPKKRPTASQALRYPYFQ 285          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: K1QVT7 (MAPK/MAK/MRK overlapping kinase OS=Crassostrea gigas OX=29159 GN=CGI_10017610 PE=4 SV=1)

HSP 1 Score: 453.366 bits (1165), Expect = 3.493e-151
Identity = 198/291 (68.04%), Postives = 250/291 (85.91%), Query Frame = 1
Query:   55 MIKDFRLISKKGEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVNNLREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIKGRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQSLKIADFGSCKTIFSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASILKNFKKSRSVSFNFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFKELRS 927
            +  ++R++ KKGEGTFSEVLKCQ++K   Y+ACKKMKQ Y++ +QVNNLREIQAMRRL+PH NIL L EV+FDKKSGTL LI ELMDMN+YELI+G+++YLPE  VK YM+QL++ + H+H+NGIFHRDVKPENILIR+  LK+ADFGSC++++S+ PYTEYISTRWYRAPECLLTDGYY+Y+MD+WSVGCV FEILSL PLFPG+NEVDQI KIHDI+G+PD+S+L   KKSR ++FNFP +KG+GIERLL H + EA+ +I Q+  YDP  R+T + A+ HPYFK+LR+
Sbjct:    5 LFPEYRILGKKGEGTFSEVLKCQHLKEGSYWACKKMKQTYDSLEQVNNLREIQAMRRLSPHANILELQEVIFDKKSGTLVLICELMDMNIYELIRGKRHYLPERKVKHYMYQLLKSVEHMHRNGIFHRDVKPENILIREDVLKLADFGSCRSVYSKQPYTEYISTRWYRAPECLLTDGYYTYKMDIWSVGCVFFEILSLHPLFPGSNEVDQIAKIHDIMGTPDSSVLDKLKKSRGMNFNFPQKKGTGIERLLPHCTQEAIELIYQMCTYDPDERITAKQAIRHPYFKDLRT 295          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A3Q0JV15 (MAPK/MAK/MRK overlapping kinase OS=Ciona intestinalis OX=7719 GN=LOC100186816 PE=4 SV=1)

HSP 1 Score: 446.047 bits (1146), Expect = 3.394e-148
Identity = 192/303 (63.37%), Postives = 255/303 (84.16%), Query Frame = 1
Query:   19 LNSKMNMN*FTKMIKDFRLISKKGEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVNNLREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIKGRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQSLKIADFGSCKTIFSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASILKNFK-KSRSVSFNFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFKELR 924
            +  ++ ++  +    ++R++ KKGEGTFSEVLKCQ+VK+  Y+ACKKMKQHY+  DQVNNLREIQAMRRLNPH NI+ LHE+++DKK+GT+ LI ELMDMN+YELI+GR++Y+PE  VK +M+QL++ L H+H+ GIFHRDVKPENILI+D  LK+ADFGSC++++S+ PYTEYISTRWYRAPECLLTDGYY+Y+MDLWSVGCV+FE++SL PLFPGANEVDQI KIHD+LG+PDASIL   K ++R ++F+FP +KG+GIE+LL H S + + +I ++  YDP  R+T + AL HPYF+++R
Sbjct:   17 MQGRLRLDTLSPFSPEYRILGKKGEGTFSEVLKCQHVKDGTYYACKKMKQHYDGVDQVNNLREIQAMRRLNPHANIIGLHEIIYDKKTGTVALICELMDMNIYELIRGRRHYVPEPKVKSFMYQLLKSLDHMHRCGIFHRDVKPENILIKDDVLKLADFGSCRSVYSKQPYTEYISTRWYRAPECLLTDGYYTYRMDLWSVGCVLFEVMSLHPLFPGANEVDQISKIHDVLGTPDASILNKMKHRNRGINFDFPQKKGTGIEKLLPHASQQCIELIYKMCTYDPDERITAKQALRHPYFRDIR 319          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: V4A342 (Protein kinase domain-containing protein (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_127222 PE=4 SV=1)

HSP 1 Score: 436.417 bits (1121), Expect = 2.132e-147
Identity = 197/287 (68.64%), Postives = 245/287 (85.37%), Query Frame = 1
Query:   64 DFRLISKKGEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVNNLREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIKGRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQSLKIADFGSCKTIFSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASILKNFKKSRSVSFNFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFKELR 924
            ++R+I KKGEGTFSEVLKCQN+K+  Y+ACKKMKQ Y+  DQVNNLREIQAMR+LNPH NIL L EV+FDKKSGTL LI ELMDMN+YELI+ +K+ LPE+ V  +++QLI+ + H+H NGIFHRDVKPENILI+D  LK+ADFGSC+++ S+ PYTEYISTRWYRAPECLLTDG+YSY+MD+WSVGCV FEILSL PLFPG+NEVDQI KIHD++G+PD ++LK  ++SR ++FNFP +KGSGIERLL HV+ +A+++I  +  YDP  RLT + AL HPYFKEL+
Sbjct:    1 EYRIIGKKGEGTFSEVLKCQNIKDGGYWACKKMKQSYDNMDQVNNLREIQAMRKLNPHNNILELEEVIFDKKSGTLVLICELMDMNIYELIRDQKSPLPEYQVTSFIYQLIKAVEHMHCNGIFHRDVKPENILIKDDLLKLADFGSCRSLHSKQPYTEYISTRWYRAPECLLTDGFYSYKMDMWSVGCVFFEILSLHPLFPGSNEVDQIAKIHDVMGTPDQAVLKKLRRSRGMNFNFPPKKGSGIERLLPHVTEDAIALIYLMCTYDPDDRLTARQALRHPYFKELK 287          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A1S3HJ06 (MAPK/MAK/MRK overlapping kinase isoform X3 OS=Lingula unguis OX=7574 GN=LOC106154954 PE=4 SV=1)

HSP 1 Score: 439.884 bits (1130), Expect = 5.868e-146
Identity = 189/291 (64.95%), Postives = 248/291 (85.22%), Query Frame = 1
Query:   55 MIKDFRLISKKGEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVNNLREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIKGRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQSLKIADFGSCKTIFSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASILKNFK-KSRSVSFNFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFKELR 924
            +++ +R++ KKGEGTFSEVLKCQ++K   Y+ACKKMKQHY++ +QVNNLREIQA+RRLNPH N++ LHE+++DKK+G L LI ELMDMN+YELI+G++++L E  +K YM+QL + + H+H+NGIFHRDVKPENILI+D  LK+ADFGSC++I+S+ PYTEYISTRWYRAPECLLTDGYYSY+MD+WSVGCV FEI+SL PLFPG+NEVDQI KIHD+LG+PD SIL   + K+R ++FNFP +KGSG+E+L+ H S +A+ +I ++  YDP  R++ + AL HPYFKELR
Sbjct:    4 VMQKYRVLGKKGEGTFSEVLKCQHIKEGSYWACKKMKQHYDSMEQVNNLREIQALRRLNPHPNVINLHEILYDKKTGVLVLICELMDMNIYELIRGKRHHLLESTIKPYMYQLCKSIEHLHRNGIFHRDVKPENILIKDDVLKLADFGSCRSIYSKQPYTEYISTRWYRAPECLLTDGYYSYKMDIWSVGCVFFEIVSLHPLFPGSNEVDQIAKIHDVLGTPDPSILNKLRNKTRGMNFNFPAKKGSGVEKLVPHASQQAIDLIYKMCAYDPDERISAKQALKHPYFKELR 294          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A1S3IBU0 (MAPK/MAK/MRK overlapping kinase-like isoform X3 OS=Lingula unguis OX=7574 GN=LOC106162769 PE=4 SV=1)

HSP 1 Score: 439.884 bits (1130), Expect = 5.997e-146
Identity = 189/291 (64.95%), Postives = 248/291 (85.22%), Query Frame = 1
Query:   55 MIKDFRLISKKGEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVNNLREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIKGRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQSLKIADFGSCKTIFSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASILKNFK-KSRSVSFNFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFKELR 924
            +++ +R++ KKGEGTFSEVLKCQ++K   Y+ACKKMKQHY++ +QVNNLREIQA+RRLNPH N++ LHE+++DKK+G L LI ELMDMN+YELI+G++++L E  +K YM+QL + + H+H+NGIFHRDVKPENILI+D  LK+ADFGSC++I+S+ PYTEYISTRWYRAPECLLTDGYYSY+MD+WSVGCV FEI+SL PLFPG+NEVDQI KIHD+LG+PD SIL   + K+R ++FNFP +KGSG+E+L+ H S +A+ +I ++  YDP  R++ + AL HPYFKELR
Sbjct:    4 VMQKYRVLGKKGEGTFSEVLKCQHIKEGSYWACKKMKQHYDSMEQVNNLREIQALRRLNPHPNVINLHEILYDKKTGVLVLICELMDMNIYELIRGKRHHLLESTIKPYMYQLCKSIEHLHRNGIFHRDVKPENILIKDDVLKLADFGSCRSIYSKQPYTEYISTRWYRAPECLLTDGYYSYKMDIWSVGCVFFEIVSLHPLFPGSNEVDQIAKIHDVLGTPDPSILNKLRNKTRGMNFNFPTKKGSGVEKLVPHASQQAIDLIYKMCAYDPDERISAKQALKHPYFKELR 294          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: MOK (MOK protein kinase [Source:HGNC Symbol;Acc:HGNC:9833])

HSP 1 Score: 376.326 bits (965), Expect = 2.161e-125
Identity = 168/279 (60.22%), Postives = 224/279 (80.29%), Query Frame = 1
Query:   88 GEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVNNLREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIKGRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQSLKIADFGSCKTIFSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASILKNFKKSRSVSFNFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFKELR 924
            GEGTFSEV+K QN+KN  ++ACK MKQ   + +Q +NLRE+QAM+RL+PH NIL LHE++FD  + TL LI ELM+MN+YELI+GR+  L E+ VK YM+QL + L H+H NGIFHRDVKPENILI+   LK+ADFGSC++++S+ P+TEYISTRWYRAPECLLTDGYYS +MD+WS GCV FEI+SL PLFPG+NEVDQ+ KIHD+LG+P++ +L+ FK+SRS+ F+F  RKG G+ +L+   S  ++S++ Q++ YDP  R++ + AL H  F+ELR
Sbjct:   14 GEGTFSEVVKVQNLKNGKHYACKTMKQSINSLEQAHNLREVQAMKRLSPHPNILQLHELIFDPDTRTLSLICELMEMNIYELIRGRQYPLTENKVKHYMYQLCKALDHMHSNGIFHRDVKPENILIKHDVLKLADFGSCRSVYSKPPHTEYISTRWYRAPECLLTDGYYSLKMDIWSAGCVFFEIMSLNPLFPGSNEVDQVSKIHDVLGTPESMVLQKFKQSRSMHFDFLPRKGCGLSQLVPRCSAPSLSLLYQMLAYDPDERISARVALQHTCFRELR 292          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: ICK (serine/threonine-protein kinase ICK-like [Source:NCBI gene;Acc:103040253])

HSP 1 Score: 243.047 bits (619), Expect = 5.297e-72
Identity = 118/285 (41.40%), Postives = 187/285 (65.61%), Query Frame = 1
Query:   67 FRLISKKGEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVNNLREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIKGRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQSL-KIADFGSCKTIFSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDAS-ILKNFKKSRSVSFNFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFK 915
            +  + + G+GT+  V+  + +++ +  A KKMK+ + +W++  NLRE++++++LN H N++ L EV+  ++   L  + E M  NLY+L+K R    PE  V+  M+Q++QGL  IHK+G FHRD+KPEN+L     L KIADFG  + I SR PYT+Y+STRWYRAPE LL    YS  +D W+VGC+M E+ SLRPLFPG++EVD I KI  +LG+P  +   + +  + ++SF +P    + +  L+ + S EA+ +++ L+++DP +R     AL +PYF+
Sbjct:    4 YSALRQLGDGTYGSVILSRCLESGELVAIKKMKRKFYSWEECMNLREVKSLKKLN-HANVIKLKEVI--REHDHLYFVFEYMKENLYQLMKDRTRLFPESAVRNIMFQILQGLAFIHKHGFFHRDLKPENLLCMGPELVKIADFGLAREIRSRPPYTDYVSTRWYRAPEVLLRSTSYSSPIDQWAVGCIMAELYSLRPLFPGSSEVDTIFKICQVLGTPKKNDWAEGYHLAATMSFRWPQCVPTSLRTLIPNASTEAIQLMRDLLQWDPKKRPAASQALRYPYFQ 285          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: ICK (serine/threonine-protein kinase ICK-like [Source:NCBI gene;Acc:103040253])

HSP 1 Score: 243.817 bits (621), Expect = 5.765e-72
Identity = 118/285 (41.40%), Postives = 187/285 (65.61%), Query Frame = 1
Query:   67 FRLISKKGEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVNNLREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIKGRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQSL-KIADFGSCKTIFSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDAS-ILKNFKKSRSVSFNFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFK 915
            +  + + G+GT+  V+  + +++ +  A KKMK+ + +W++  NLRE++++++LN H N++ L EV+  ++   L  + E M  NLY+L+K R    PE  V+  M+Q++QGL  IHK+G FHRD+KPEN+L     L KIADFG  + I SR PYT+Y+STRWYRAPE LL    YS  +D W+VGC+M E+ SLRPLFPG++EVD I KI  +LG+P  +   + +  + ++SF +P    + +  L+ + S EA+ +++ L+++DP +R     AL +PYF+
Sbjct:    4 YSALRQLGDGTYGSVILSRCLESGELVAIKKMKRKFYSWEECMNLREVKSLKKLN-HANVIKLKEVI--REHDHLYFVFEYMKENLYQLMKDRTRLFPESAVRNIMFQILQGLAFIHKHGFFHRDLKPENLLCMGPELVKIADFGLAREIRSRPPYTDYVSTRWYRAPEVLLRSTSYSSPIDQWAVGCIMAELYSLRPLFPGSSEVDTIFKICQVLGTPKKNDWAEGYHLAATMSFRWPQCVPTSLRTLIPNASTEAIQLMRDLLQWDPKKRPAASQALRYPYFQ 285          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: mak (male germ cell associated kinase [Source:NCBI gene;Acc:103025131])

HSP 1 Score: 225.713 bits (574), Expect = 3.334e-65
Identity = 108/254 (42.52%), Postives = 171/254 (67.32%), Query Frame = 1
Query:  160 MKQHYETWDQVNNLREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIKGRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQSL-KIADFGSCKTIFSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGS-PDASILKNFKKSRSVSFNFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFK 915
            MK+ + +W++  NLRE++++++LN H N++ L EV+  +++  L  + E M  NLY+L+K R    PE  ++   +Q++QGL  IHK+G FHRD+KPEN+L     L KIADFG  +   SR PYT+Y+STRWYRAPE LL    YS  +D+W+VGC+M E+ +LRPLFPG +EVD+I KI  +LG+       + ++ + +++F FP    + ++ L+ + S EA++++K L+++DP +R T   AL +PYF+
Sbjct:    1 MKRKFYSWEECMNLREVKSLKKLN-HANVVKLKEVI--RENDHLYFVFEYMKENLYQLMKDRNKLFPESAIRNITFQILQGLSFIHKHGFFHRDMKPENLLCMGPELVKIADFGLARETRSRPPYTDYVSTRWYRAPEVLLRSSMYSSPIDMWAVGCIMAELYTLRPLFPGNSEVDEIFKICQVLGTVKKTDWPEGYQLAAAMNFRFPQCVPTPLKTLIPNASNEALTLMKDLLQWDPKKRPTAVQALRYPYFQ 251          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: mak (male germ cell associated kinase [Source:NCBI gene;Acc:103025131])

HSP 1 Score: 221.861 bits (564), Expect = 4.609e-64
Identity = 107/255 (41.96%), Postives = 176/255 (69.02%), Query Frame = 1
Query:  160 MKQHYETWDQVNNLREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIKGRKNYL-PEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQSL-KIADFGSCKTIFSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASIL-KNFKKSRSVSFNFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFK 915
            MK+ + +W++  NLRE++++++LN H N++ L EV+  +++  L  + E M  NLY+L+K R+N +  E++++  M+Q++ GL  +HK+G FHRD+KPEN+L     L KIADFG  +   SR PYT+Y+STRWYRAPE LL    YS  +D+W+VGC+M E+ +LRPLFPG +EVD+I KI  +LG+   +   + ++ + +++F FP    + ++ L+ + S EA++++K L+++DP +R T   AL +PYF+
Sbjct:    1 MKRKFYSWEECMNLREVKSLKKLN-HANVVKLKEVI--RENDHLYFVFEYMKENLYQLMKDRENKMFTENEIRNIMFQVLSGLAFVHKHGFFHRDMKPENLLCMGPELVKIADFGLARETRSRPPYTDYVSTRWYRAPEVLLRSSMYSSPIDMWAVGCIMAELYTLRPLFPGNSEVDEIFKICQVLGTVKKTDWPEGYQLAAAMNFRFPQCVPTPLKTLIPNASNEALTLMKDLLQWDPKKRPTAVQALRYPYFQ 252          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: mak (male germ cell-associated kinase [Source:ZFIN;Acc:ZDB-GENE-030131-7279])

HSP 1 Score: 237.654 bits (605), Expect = 2.836e-70
Identity = 114/285 (40.00%), Postives = 188/285 (65.96%), Query Frame = 1
Query:   67 FRLISKKGEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVNNLREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIKGRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQSL-KIADFGSCKTIFSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASIL-KNFKKSRSVSFNFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFK 915
            +  I + G+GT+  VL  ++ +  +  A KKMK+ + +WD+  NLRE++++++LN H N++ L EV+  +++  L  + E M  NLY+L+K R    PE  ++  M+Q++QGL  IHK+G FHRD+KPEN+L     L KIADFG  + I SR PYT+Y+STRWYR PE LL    YS  +D+W++GC+M E+ +LRPLFPG++EVDQI KI  +LG+P  +   +  + + +++F +P    + ++ L+ + S EA+ +++ ++ ++P +R     +L +PYF+
Sbjct:    4 YTTIKQLGDGTYGSVLMGRSNETGELVAIKKMKRKFYSWDECMNLREVKSLKKLN-HANVIKLKEVI--RENDCLYFVFEYMKENLYQLMKDRNKLFPESMIRNIMYQILQGLAFIHKHGFFHRDMKPENLLCMGPELVKIADFGLAREIRSRPPYTDYVSTRWYRGPEVLLRSTSYSSPIDIWALGCIMAELYTLRPLFPGSSEVDQIFKICQVLGTPKKNDWPEGHQLAAAMNFRWPQCVPTNLKTLIPNASNEAIHLMRDMLHWEPKKRPNAVQSLRYPYFQ 285          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: cdk2 (cyclin-dependent kinase 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2741])

HSP 1 Score: 178.333 bits (451), Expect = 1.309e-51
Identity = 99/293 (33.79%), Postives = 170/293 (58.02%), Query Frame = 1
Query:   58 IKDFRLISKKGEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVNN-LREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIK-GRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQ-SLKIADFGSCKTI-FSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASILKNFKKSRSVSFNFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFKELR 924
            + +F+ + K GEGT+  V K +N    +  A KK++   ET    +  +REI  +R LN H NI+ L  ++  +K   L L+ EL+D +L + +     + +P   VK Y++QL+QG+   H + I HRD+KP+N+LI  + ++K+ADFG  +     +  YT  + T WYRAPE LL   +YS  +D+WS+GC+  E+L+ R LFPG +E+DQ+ +I   LG+PD  +     +       FP      + +++  ++ E   ++  +++YDP++R+T   AL+H +F+ ++
Sbjct:    1 MDNFQKVEKIGEGTYGVVYKARNKLTGEAVALKKIRLDTETEGVPSTAIREISLLRELN-HPNIVRLLTIIHSEKK--LYLVFELLDQDLKKFMDNATPSGIPLPLVKSYLYQLLQGIAFCHSHRILHRDLKPQNLLINAEGAIKLADFGLARAFGVPQRTYTHEVVTLWYRAPEILLGCKHYSTSVDVWSIGCIFAEMLTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVSQLPDYKSTFPRWANQELTKVVPTLNFEGRDLLALMLQYDPNQRVTANMALSHCFFQNVK 290          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: cdk2 (cyclin-dependent kinase 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2741])

HSP 1 Score: 175.637 bits (444), Expect = 1.214e-50
Identity = 104/297 (35.02%), Postives = 165/297 (55.56%), Query Frame = 1
Query:   67 FRLISKKGEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVNN-LREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIKGRKNY---LPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILI-RDQSLKIADFGSCKTI-FSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASILKNFKKSRSVSFNFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFKELRSNSGT 939
            F+ + K GEGT+  V K ++    D  A KK++   ET    +  +REI  +R LN H NI+ L +V+  +    L L+ E +D +L + +         LP   VK YM QL+QG+   H     HRD+KP+N+LI  D ++K+ADFG  +        YT  + T WYRAPE LL   YYS  +D+WS+GC+  E+L+ R LFPG +E+DQ+ +I   LG+PD ++ +   +      +FP      + +++  +      ++ Q+++YDP+RR++ + ALNH +F  L  +  T
Sbjct:    4 FQKVEKIGEGTYGVVYKARHKMTGDTVALKKIRLDTETEGVPSTAIREIALLRELN-HPNIVRLLDVIHSETK--LYLVFEFLDQDLKKYMDNAPPLGISLPL--VKSYMHQLLQGIAFCHAQRTLHRDLKPQNLLINADGAIKLADFGLARAFGVPLRTYTHEVVTLWYRAPEILLGCKYYSTAVDVWSLGCIFAEMLTRRALFPGDSEIDQLFRIFRTLGTPDETVWQGITQLPDYKPSFPRWCAQDLTKVVPLLDAAGHDLLMQMLQYDPTRRVSAKAALNHHFFHNLEHHVPT 295          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008013.1 (pep scaffold:Pmarinus_7.0:GL478839:10839:40406:1 gene:ENSPMAG00000007231.1 transcript:ENSPMAT00000008013.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 174.096 bits (440), Expect = 4.641e-48
Identity = 93/290 (32.07%), Postives = 166/290 (57.24%), Query Frame = 1
Query:   58 IKDFRLISKKGEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVNNLREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIKGRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQS-LKIADFG--SCKTIFSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASILKNFKKSRSV-SFNFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFK 915
            ++ +  + K GEGT++ V K ++    +  A K+++  +E       +RE+  ++ L  H NI+ LH++V   KS  L L+ E ++ +L + +    N +  H+VK ++ QL++GL + HK  + HRD+KP+N+LI D+  LK+ADFG    K++ ++  Y+  + T WYR P+ LL    YS Q+D+W VGC+ FE+ + RPLFPG+   D++  I  +LGSP   +      +    S+NFP  +   +      + ++ + ++ + + Y+   R++ ++AL  PYFK
Sbjct:  195 LETYTKLDKLGEGTYATVYKGRSKLTDNLVALKEIRLEHEEGAPCTAIREVSLLKDLK-HANIVTLHDIVHTDKS--LTLVFEYLEKDLKQYMDDCGNIMSMHNVKIFLLQLLRGLAYCHKRRVLHRDLKPQNLLINDKGELKLADFGLARAKSVPTK-TYSNEVVTLWYRPPDVLLGSTEYSTQIDMWGVGCIFFEMAAGRPLFPGSTVEDELHLIFRMLGSPREDMWPGISSNEEYKSYNFPKYRSEPMITHAPRLDVDGLDLLSKFLLYEAKARISAEDALKRPYFK 480          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: mapk1 (mitogen-activated protein kinase 1 [Source:ZFIN;Acc:ZDB-GENE-030722-2])

HSP 1 Score: 163.696 bits (413), Expect = 2.131e-45
Identity = 98/293 (33.45%), Postives = 169/293 (57.68%), Query Frame = 1
Query:   76 ISKKGEGTFSEVLKCQNVKNKDYFACKKMKQ-HYETWDQVNNLREIQAMRRLNPHENILLLHEVVFDK---KSGTLCLILELMDMNLYELIKGRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQS-LKIADFGSCKTIFSRYPYT----EYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSP---DASILKNFKKSRSVSFNFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFKE 918
            +S  GEG +  V    +       A KK+    ++T+ Q   LREI+ + R   HENI+ +++++      +   + ++ +LM+ +LY+L+KG++  L    +  +++Q+++GL +IH   + HRD+KP N+L+     LKI DFG  +     + +T    EY++TRWYRAPE +L    Y+  +D+WSVGC++ E+LS RPLFPG + +DQ+  I  ILGSP   D   + N  K+R+   + P +      RL      +A+ ++ +++ ++P RR+T + AL HPY ++
Sbjct:   39 LSYIGEGAYGMVCAAFDNVKLVRVAIKKISPFEHQTYCQ-RTLREIKILLRFK-HENIIGINDILRASTIDQMKDVYIVQDLMETDLYKLLKGQQ--LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPLFPGKHYLDQLNHILGILGSPSQEDLDCIINM-KARNYLQSLPPKAKVPWNRLFPKADSKALDLLDKMLTFNPHRRITVEEALAHPYLEQ 326          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: PHO85 (Cyclin-dependent kinase; has ten cyclin partners; involved in regulating the cellular response to nutrient levels and environmental conditions and progression through the cell cycle; human lissencephaly-associated homolog CDK5 functionally complements null mutation [Source:SGD;Acc:S000005952])

HSP 1 Score: 167.548 bits (423), Expect = 8.296e-48
Identity = 99/296 (33.45%), Postives = 161/296 (54.39%), Query Frame = 1
Query:   67 FRLISKKGEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVNNLREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIKGRK-----NYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQS-LKIADFGSCKTI-FSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASILKNFKKSRSVSFNFPIRKGSGIERLLAHVSLEAV-----SIIKQLIEYDPSRRLTTQNALNHPYFKE 918
            F+ + K G GT++ V K  N     Y A K++K   E       +REI  M+ L  HENI+ L++V+  +    L L+ E MD +L + +  R        L  + VK + WQL+QGL   H+N I HRD+KP+N+LI  +  LK+ DFG  +        ++  + T WYRAP+ L+    YS  +D+WS GC++ E+++ +PLFPG N+ +Q+  I DI+G+P+ S+  +  K    + N   R    + ++L   + E +       +  L++ +P  RL+ + AL+HP+F E
Sbjct:    7 FKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIREISLMKELK-HENIVRLYDVIHTENK--LTLVFEFMDNDLKKYMDSRTVGNTPRGLELNLVKYFQWQLLQGLAFCHENKILHRDLKPQNLLINKRGQLKLGDFGLARAFGIPVNTFSSEVVTLWYRAPDVLMGSRTYSTSIDIWSCGCILAEMITGKPLFPGTNDEEQLKLIFDIMGTPNESLWPSVTKLPKYNPNIQQRPPRDLRQVLQPHTKEPLDGNLMDFLHGLLQLNPDMRLSAKQALHHPWFAE 299          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: CDC28 (Cyclin-dependent kinase (CDK) catalytic subunit; master regulator of mitotic and meiotic cell cycles; alternately associates with G1, S, G2/M phase cyclins, which provide substrate specificity; regulates metabolism, basal transcription, chromosome dynamics, growth and morphogenesis; transcript induction in osmostress involves antisense RNA; human homologs CDK1, CDK2, CDK3 can complement yeast conditional cdc28 mutants; human CDK1, CDK2 can complement yeast cdc28 null mutant [Source:SGD;Acc:S000000364])

HSP 1 Score: 161.77 bits (408), Expect = 1.007e-45
Identity = 94/295 (31.86%), Postives = 166/295 (56.27%), Query Frame = 1
Query:   58 IKDFRLISKKGEGTFSEVLKCQNVK---NKDYFACKKMKQHYETWDQVNN-LREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIKG--RKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILI-RDQSLKIADFGSCKTI-FSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASILKNFKKSRSVSFNFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFKE 918
            + +++ + K GEGT+  V K  +++    +   A KK++   E     +  +REI  ++ L   +NI+ L+++V    +  L L+ E +D++L   ++G  +   L    VK++M QL +G+ + H + I HRD+KP+N+LI +D +LK+ DFG  +        YT  I T WYRAPE LL    YS  +D WS+GC+  E+ + +P+F G +E+DQI KI  +LG+P+ +I  +         +FP  +   + +++  +    + ++ +L+ YDP  R++ + A  HPYF+E
Sbjct:    5 LANYKRLEKVGEGTYGVVYKALDLRPGQGQRVVALKKIRLESEDEGVPSTAIREISLLKELK-DDNIVRLYDIVH-SDAHKLYLVFEFLDLDLKRYMEGIPKDQPLGADIVKKFMMQLCKGIAYCHSHRILHRDLKPQNLLINKDGNLKLGDFGLARAFGVPLRAYTHEIVTLWYRAPEVLLGGKQYSTGVDTWSIGCIFAEMCNRKPIFSGDSEIDQIFKIFRVLGTPNEAIWPDIVYLPDFKPSFPQWRRKDLSQVVPSLDPRGIDLLDKLLAYDPINRISARRAAIHPYFQE 297          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: IME2 (Serine/threonine protein kinase involved in activation of meiosis; associates with Ime1p and mediates its stability, activates Ndt80p; IME2 expression is positively regulated by Ime1p; human CDK2 can complement ime2 null mutant [Source:SGD;Acc:S000003642])

HSP 1 Score: 167.548 bits (423), Expect = 4.593e-45
Identity = 95/304 (31.25%), Postives = 157/304 (51.64%), Query Frame = 1
Query:  127 VKNKDYFACKKMKQHYETWDQVNNLREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIKGRKNY---LPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQS------------------LKIADFGSCKTIFSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASILKNFKKSRSVSFNFPIRKGSGIERLLAHVSLE--------------------AVSIIKQLIEYDPSRRLTTQNALNHPYFK 915
             K +   A K M     T      +REI+ +  +  +++++ + EV  D ++  L +++E M+ NLY+++K R+     +P   +K  + Q++ GL HIH++  FHRD+KPENILI   +                  +K+ADFG  + + ++ PYT Y+STRWYR+PE LL  GYYS  +D+W+ GCV  E+   R LFPGANE+DQI KI ++LG+P      +F  +  ++   P         L+  ++L+                       ++K+ + +DP+ R T Q     P+F+
Sbjct:   88 TKTQGVVAIKTMMTKLHTLQDYTRVREIKFILAIPANDHLIQIFEVFIDSENYQLHIVMECMEQNLYQMMKHRRRRVFSIPS--LKSILSQILAGLKHIHEHNFFHRDLKPENILITPSTQYFEKEYMNQIGYQDNYVIKLADFGLARHVENKNPYTAYVSTRWYRSPEILLRSGYYSKPLDIWAFGCVAVEVTVFRALFPGANEIDQIWKILEVLGTPIKR--SDFVNTNHITAPPPGGFWDDASNLVHKLNLKLPYVEGSSLDHLLSSSQLSDLSEVVKKCLRWDPNERATAQELCEMPFFE 387          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: HOG1 (Mitogen-activated protein kinase involved in osmoregulation; controls global reallocation of RNAPII during osmotic shock; mediates recruitment/activation of RNAPII at Hot1p-dependent promoters; binds calmodulin; stimulates antisense transcription to activate CDC28; defines novel S-phase checkpoint with Mrc1p that prevent replication/transcription conflicts; nuclear form represses pseudohyphal growth; autophosphorylates; protein abundance increases under DNA replication stress [Source:SGD;Acc:S000004103])

HSP 1 Score: 157.918 bits (398), Expect = 6.317e-43
Identity = 90/278 (32.37%), Postives = 150/278 (53.96%), Query Frame = 1
Query:   88 GEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVN-NLREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIKGRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQ-SLKIADFGSCKTIFSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASILKNFKKSRSVSF--NFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPY 909
            G G F  V    +       A KK+ + + T        RE++ ++ L  HEN++ L ++ F      +  + EL   +L+ L++ R   L +  V+ +++Q+++GL ++H  G+ HRD+KP NILI +   LKI DFG  +        T Y+STR+YRAPE +LT   Y  ++D+WS GC+  E++  +PLFPG + V Q   I D+LGSP   ++       ++ F  + P R           V  +AV ++++++ +DP +R+T  +AL HPY
Sbjct:   30 GMGAFGLVCSATDTLTSQPVAIKKIMKPFSTAVLAKRTYRELKLLKHLR-HENLICLQDI-FLSPLEDIYFVTELQGTDLHRLLQTRP--LEKQFVQYFLYQILRGLKYVHSAGVIHRDLKPSNILINENCDLKICDFGLAR--IQDPQMTGYVSTRYYRAPEIMLTWQKYDVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPKDVINTICSENTLKFVTSLPHRDPIPFSERFKTVEPDAVDLLEKMLVFDPKKRITAADALAHPY 301          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: FUS3 (Mitogen-activated serine/threonine protein kinase involved in mating; phosphoactivated by Ste7p; substrates include Ste12p, Far1p, Bni1p, Sst2p; inhibits invasive growth during mating by phosphorylating Tec1p, promoting its; inhibits recruitment of Ste5p, Cdc42p-mediated asymmetry and mating morphogenesis [Source:SGD;Acc:S000000112])

HSP 1 Score: 155.606 bits (392), Expect = 8.742e-43
Identity = 88/302 (29.14%), Postives = 165/302 (54.64%), Query Frame = 1
Query:   64 DFRLISKKGEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVNNLREIQAMRRLNPHENILLLHEVVFD---KKSGTLCLILELMDMNLYELIKGRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQS-LKIADFGSCKTI-----------FSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDA-SILKNFKKSRSVSF--NFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFK 915
            DF+L S  GEG +  V    +    +  A KK++   +    +  LREI+ ++    HENI+ +  +      +    + +I ELM  +L+ +I  +   L +  ++ +++Q ++ +  +H + + HRD+KP N+LI     LK+ DFG  + I             +   TEY++TRWYRAPE +LT   YS  MD+WS GC++ E+   RP+FPG +   Q+  I  I+G+P + + L+  +  R+  +  + P+   + +E++   V+ + + ++++++ +DP++R+T + AL HPY +
Sbjct:   12 DFQLKSLLGEGAYGVVCSATHKPTGEIVAIKKIEPFDKPLFALRTLREIKILKHFK-HENIITIFNIQRPDSFENFNEVYIIQELMQTDLHRVISTQ--MLSDDHIQYFIYQTLRAVKVLHGSNVIHRDLKPSNLLINSNCDLKVCDFGLARIIDESAADNSEPTGQQSGMTEYVATRWYRAPEVMLTSAKYSRAMDVWSCGCILAELFLRRPIFPGRDYRHQLLLIFGIIGTPHSDNDLRCIESPRAREYIKSLPMYPAAPLEKMFPRVNPKGIDLLQRMLVFDPAKRITAKEALEHPYLQ 310          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO40290 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7S4])

HSP 1 Score: 412.92 bits (1060), Expect = 4.786e-142
Identity = 182/287 (63.41%), Postives = 241/287 (83.97%), Query Frame = 1
Query:   67 FRLISKKGEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVNNLREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIKGRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQSLKIADFGSCKTIFSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASILKNFK-KSRSVSFNFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFKELR 924
            +R++ KKGEGTFSEVLK Q+++N +YFACKKMKQ Y++ +QVNNLREIQAMRRL PH +++ L E+++D+KSG L LI+ELMDMNLYELI+G+++YLPE  VK YM+QL++ + H H+NGIFHRDVKPENIL++D  +K+AD GSC++++S+ PYTEYISTRWYRAPECLLTDG+Y+++MDLWSVGCV FEI+SL PLFPG+NEVDQI KIHD+LG+P  SIL+ FK KSR +++NFP +KG+GI +LL H S   + +I+ L  YDP  R++ + AL H YF++LR
Sbjct:    2 YRILGKKGEGTFSEVLKVQDIRNGNYFACKKMKQQYDSLEQVNNLREIQAMRRLTPHAHVVELKEIIYDRKSGKLALIMELMDMNLYELIRGKRHYLPEAKVKSYMFQLLKSIDHAHRNGIFHRDVKPENILLKDDIIKLADLGSCRSVYSKQPYTEYISTRWYRAPECLLTDGFYTHKMDLWSVGCVFFEIMSLHPLFPGSNEVDQIAKIHDVLGTPVPSILQKFKNKSRHMNYNFPQKKGTGINKLLPHASNMCIELIELLCTYDPDERISAKQALRHEYFRDLR 288          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO41147 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S560])

HSP 1 Score: 249.21 bits (635), Expect = 2.647e-78
Identity = 121/288 (42.01%), Postives = 192/288 (66.67%), Query Frame = 1
Query:   58 IKDFRLISKKGEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVNNLREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIKGRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQSL-KIADFGSCKTIFSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASIL-KNFKKSRSVSFNFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFK 915
            +K ++ I + G+GT+  V   +N++  +  A KKMK+ Y +WD+  NLRE++++R+L+ H NI+ L EV+  +++  L  + E M  NLY+++K R   LPE  ++  ++Q++QGL  IHK+G FHRD+KPEN+L     L KIADFG  +   SR PYT+Y+STRWYRAPE LL    YS  +D+W+VGC+M E+ +LRPLFPG++EVD+I K+  +LG P      +  K + +++F FP  K + +  L+ + S EA+ ++++++ ++P +R T   AL+ PYFK
Sbjct:    1 MKRYQSIKQLGDGTYGSVELAKNIQTGETVAIKKMKKKYFSWDECINLREVKSLRKLS-HTNIVKLKEVI--RENDHLYFVFEYMKENLYQMMKNRDKLLPESVIRNVIYQILQGLAFIHKHGYFHRDMKPENLLCTGHELVKIADFGLARETRSRPPYTDYVSTRWYRAPEVLLRSTNYSSPIDIWAVGCIMAELYTLRPLFPGSSEVDEIFKVCSVLGPPKPDEWPEGHKLASAMNFKFPQTKATSLHSLIPNASAEAIQLMQEMLFWNPKKRPTAAQALHFPYFK 285          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO40573 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6R5])

HSP 1 Score: 178.718 bits (452), Expect = 1.589e-50
Identity = 95/307 (30.94%), Postives = 171/307 (55.70%), Query Frame = 1
Query:   67 FRLISKKGEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVNNL-REIQAMRRLNPHENILLLHEVV--------FDKKSGTLCLILELMDMNLYELIKGRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQS-LKIADFGSCKTIFS------RYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASILKNFKKSRSVSF--NFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFKELRSNS 933
            ++LI   G G +  V    + +     A KK+ + ++         RE++ +R    H+NI+ + +++        FD     + ++L+LM+ +L+ +I   +    EH V+ +++Q+++GL +IH   + HRD+KP N+L+ + + LKI DFG  + + S      R+  TEY++TRWYRAPE +L+   YS  +D+WSVGC++ E++  RPLFPGAN ++Q+  I  + G+P  + ++     R  ++    P +     E+       EA++++ Q+++ DP  R+T +NAL HP+ KE  S  
Sbjct:   23 YKLIETIGNGAYGVVCSAMDTRTGAKVAVKKISRAFDVLTTARRTHRELKILRHFK-HDNIICIRDILKPPVNLDEFDD----VYVVLDLMESDLHRIIHTDQPLTTEH-VRYFLYQILRGLKYIHSAKVLHRDLKPSNLLVNENAELKIGDFGMARGLCSSPLEQKRF-MTEYVATRWYRAPELMLSLNEYSEAIDMWSVGCILAEMIGRRPLFPGANYLNQLQMILSVTGTPSQNFIERMGAERVKTYLNQLPHKDPVPFEKFFPKAHPEAINLLSQMLQLDPKERITVENALQHPFLKEYHSEE 322          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO35402 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLJ0])

HSP 1 Score: 176.022 bits (445), Expect = 4.357e-50
Identity = 103/283 (36.40%), Postives = 170/283 (60.07%), Query Frame = 1
Query:   88 GEGTFSEVLKCQNVKNKDYFACKK-MKQHYETWDQVNNLREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIKGRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILI-RDQSLKIADFGSCKTIFSRY--PYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASILKNFKKS-RSVSFNFP-IRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFKE 918
            GEG++  V+KC++  +    A KK ++   +   +   +RE++ +R+L  HEN++ L EV   KK   L L+ E +D  + + ++   N L E+ V++ MWQ+++ +  IH++ I HRDVKPENIL+ R   +K+ DFG  +T+ S     YT+Y++TRWYRAPE L+ D  Y   +D+W+VGC++ E+L+  PLFPG +++DQ+  I    G+  +   + F+K+   V    P I++   +ER    +S  AV ++K  ++ DPS R T    LNH +FK+
Sbjct:   11 GEGSYGMVMKCRHKDSNQIVAIKKFIESEDDKMVKKIAMREVRMLRQLR-HENLVNLIEVFRRKKR--LFLVFEFVDHTVLDDLERYPNGLDENTVRKVMWQVLRAIEFIHRHNIIHRDVKPENILVSRSGIVKLCDFGFARTLASGQGEAYTDYVATRWYRAPELLVGDTKYGRAVDVWAVGCLLAEMLTGEPLFPGDSDIDQLYHIMRCFGNLISRHREIFQKNPLFVGMRLPDIKEVEPMERRFPRISPMAVDMLKLCLKMDPSERPTCAQLLNHDFFKK 290          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO43671 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXS1])

HSP 1 Score: 173.326 bits (438), Expect = 2.468e-49
Identity = 94/288 (32.64%), Postives = 157/288 (54.51%), Query Frame = 1
Query:   58 IKDFRLISKKGEGTFSEVLKCQNVKNKDYFACKKMKQHYETWD-QVNNLREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIKGRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQSL-KIADFGSCKTI-FSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASILKNFKKSRSVSFNFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYF 912
            + DF  I K GEGT+  V K +N+K   + A KK++   E        +REI  ++ L  H N++ L  ++  +    L L+ E +  +L + +   +  L +  VK Y++Q+   ++  H   I HRD+KP+N+LI  + L K+ADFG  +        YT  + T WYRAPE LL    YS  +D+WS+G +  E+++ RPLF G +E+DQ+ +I  ILG+P     K           FP   G G+++ +  +  + + ++K+++ YDP+ R++ + +L HPYF
Sbjct:    1 MDDFSKIEKIGEGTYGVVYKAKNLKTGGFAALKKIRLEVEDEGIPSTAVREISLLKELRHHPNVVELQHILHQEPK--LYLVFEYLTCDLKKHLDTTRGMLDKTLVKSYLYQITNAIYFCHARRILHRDLKPQNLLIDSKGLIKLADFGLGRAFGIPVRAYTHEVVTLWYRAPEVLLGGQRYSCPIDVWSIGTIFAEMVTKRPLFHGDSEIDQLFRIFRILGTPTEETWKGVTSLPDYKPTFPKWAGDGLKKAVPQLDSDGLDLLKKMLIYDPALRISAKTSLKHPYF 286          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: MOK (MOK protein kinase [Source:NCBI gene;Acc:101173667])

HSP 1 Score: 385.956 bits (990), Expect = 4.043e-128
Identity = 164/288 (56.94%), Postives = 232/288 (80.56%), Query Frame = 1
Query:   61 KDFRLISKKGEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVNNLREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIKGRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQSLKIADFGSCKTIFSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASILKNFKKSRSVSFNFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFKELR 924
            + +++I K GEG FSEV+K Q++K+  ++ACK MKQ  ++ +Q N L+E+QAM+RL+PH NI+ LHE++FDK +GT+ L+ ELM+MN+YE ++ RK  LP+H VK YM+QL + L H+H  GIFHRDVKPENILI+   LK+ADFGSC++++S+ P+TEYISTRWYRAPECLLTDGYY+ +MD+WS GCV FEI+SL+PLFPGANE+DQ+ KIH++LG+PD S+L+ FK++R++ FNFP  KG+GI RL+ +    A+S++ Q++ YDP  R++ + AL H YF+E+R
Sbjct:   61 RGYKVIKKIGEGAFSEVVKTQSLKDGKFYACKTMKQTIKSLEQANKLQEVQAMKRLSPHANIIQLHELIFDKVTGTVSLVCELMEMNIYEFLQKRKKPLPDHMVKNYMYQLCKSLQHMHSCGIFHRDVKPENILIKQNDLKLADFGSCRSVYSKPPHTEYISTRWYRAPECLLTDGYYNLKMDIWSAGCVFFEIMSLKPLFPGANELDQVAKIHNVLGTPDQSLLQKFKQTRAMPFNFPPMKGTGISRLIPNCPAPALSLLYQMLAYDPDERISAETALRHTYFREIR 348          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: MOK (MOK protein kinase [Source:NCBI gene;Acc:101173667])

HSP 1 Score: 369.777 bits (948), Expect = 7.954e-122
Identity = 165/323 (51.08%), Postives = 233/323 (72.14%), Query Frame = 1
Query:   52 KMIKDFRLISKKGEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVNNLREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIKG--------------------------------RKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQSLKIADFGSCKTIFSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASILKNFKKSRSVSFNFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFKELR 924
            K +  +++I K GEG FSEV+K Q++K+  ++ACK MKQ  ++ +Q N L+E+QAM+RL+PH NI+ LHE++FDK +GT+ L+ ELM+MN+YE ++                                 RK  LP+H VK YM+QL + L H+H  GIFHRDVKPENILI+   LK+ADFGSC++++S+ P+TEYISTRWYRAPECLLTDGYY+ +MD+WS GCV FEI+SL+PLFPGANE+DQ+ KIH++LG+PD S+L+ FK++R++ FNFP  KG+GI RL+ +    A+S++ Q++ YDP  R++ + AL H YF+E+R
Sbjct:   20 KEMHRYKVIKKIGEGAFSEVVKTQSLKDGKFYACKTMKQTIKSLEQANKLQEVQAMKRLSPHANIIQLHELIFDKVTGTVSLVCELMEMNIYEFLQSKSALLEIKHVSMIGFMGIKKNANGRFLLFPAERKKPLPDHMVKNYMYQLCKSLQHMHSCGIFHRDVKPENILIKQNDLKLADFGSCRSVYSKPPHTEYISTRWYRAPECLLTDGYYNLKMDIWSAGCVFFEIMSLKPLFPGANELDQVAKIHNVLGTPDQSLLQKFKQTRAMPFNFPPMKGTGISRLIPNCPAPALSLLYQMLAYDPDERISAETALRHTYFREIR 342          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: mak (male germ cell associated kinase [Source:NCBI gene;Acc:101162081])

HSP 1 Score: 243.047 bits (619), Expect = 1.790e-71
Identity = 117/289 (40.48%), Postives = 192/289 (66.44%), Query Frame = 1
Query:   55 MIKDFRLISKKGEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVNNLREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIKGRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQSL-KIADFGSCKTIFSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASIL-KNFKKSRSVSFNFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFK 915
            M+  +  + + G+GT+  VL  +N ++ +Y A K+MK+ + +WD+  NLRE++++++LN H N++ L EV+  +++  L  + E M  NLY+L+K R    PE  ++   +Q++QGL  IHK+G FHRD+KPEN+L     L KIADFG  + I S+ PYT+Y+STRWYRAPE LL    Y   +DLW+VGC+M E+ +LRPLFPG +E+D+I KI  +LG+   +   + ++ + +++F FP    + ++ L+ + S EA++++K  +++DP +R T   AL +PYF+
Sbjct:    1 MMNRYTTLKQLGDGTYGSVLMGRNNESGEYVAIKRMKKKFYSWDECMNLREVKSLKKLN-HANVVKLKEVI--RENDHLYFVFEYMKENLYQLMKDRIKKFPESVIRNISFQILQGLSFIHKHGFFHRDMKPENLLCMGPELVKIADFGLAREIRSKPPYTDYVSTRWYRAPEVLLRSSTYGSPIDLWAVGCIMAELYTLRPLFPGNSEMDEIFKICQVLGTVKKTEWPEGYQLASAMNFRFPQCVPTHLKTLIPNASNEAIALMKDFLQWDPKKRPTAAQALRYPYFQ 286          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: mak (male germ cell associated kinase [Source:NCBI gene;Acc:101162081])

HSP 1 Score: 243.432 bits (620), Expect = 2.278e-71
Identity = 117/289 (40.48%), Postives = 192/289 (66.44%), Query Frame = 1
Query:   55 MIKDFRLISKKGEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVNNLREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIKGRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQSL-KIADFGSCKTIFSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASIL-KNFKKSRSVSFNFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFK 915
            M+  +  + + G+GT+  VL  +N ++ +Y A K+MK+ + +WD+  NLRE++++++LN H N++ L EV+  +++  L  + E M  NLY+L+K R    PE  ++   +Q++QGL  IHK+G FHRD+KPEN+L     L KIADFG  + I S+ PYT+Y+STRWYRAPE LL    Y   +DLW+VGC+M E+ +LRPLFPG +E+D+I KI  +LG+   +   + ++ + +++F FP    + ++ L+ + S EA++++K  +++DP +R T   AL +PYF+
Sbjct:    1 MMNRYTTLKQLGDGTYGSVLMGRNNESGEYVAIKRMKKKFYSWDECMNLREVKSLKKLN-HANVVKLKEVI--RENDHLYFVFEYMKENLYQLMKDRIKKFPESVIRNISFQILQGLSFIHKHGFFHRDMKPENLLCMGPELVKIADFGLAREIRSKPPYTDYVSTRWYRAPEVLLRSSTYGSPIDLWAVGCIMAELYTLRPLFPGNSEMDEIFKICQVLGTVKKTEWPEGYQLASAMNFRFPQCVPTHLKTLIPNASNEAIALMKDFLQWDPKKRPTAAQALRYPYFQ 286          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: mak (male germ cell associated kinase [Source:NCBI gene;Acc:101162081])

HSP 1 Score: 240.35 bits (612), Expect = 2.325e-71
Identity = 116/285 (40.70%), Postives = 190/285 (66.67%), Query Frame = 1
Query:   67 FRLISKKGEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVNNLREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIKGRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQSL-KIADFGSCKTIFSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASIL-KNFKKSRSVSFNFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFK 915
            +  + + G+GT+  VL  +N ++ +Y A K+MK+ + +WD+  NLRE++++++LN H N++ L EV+  +++  L  + E M  NLY+L+K R    PE  ++   +Q++QGL  IHK+G FHRD+KPEN+L     L KIADFG  + I S+ PYT+Y+STRWYRAPE LL    Y   +DLW+VGC+M E+ +LRPLFPG +E+D+I KI  +LG+   +   + ++ + +++F FP    + ++ L+ + S EA++++K  +++DP +R T   AL +PYF+
Sbjct:    4 YTTLKQLGDGTYGSVLMGRNNESGEYVAIKRMKKKFYSWDECMNLREVKSLKKLN-HANVVKLKEVI--RENDHLYFVFEYMKENLYQLMKDRIKKFPESVIRNISFQILQGLSFIHKHGFFHRDMKPENLLCMGPELVKIADFGLAREIRSKPPYTDYVSTRWYRAPEVLLRSSTYGSPIDLWAVGCIMAELYTLRPLFPGNSEMDEIFKICQVLGTVKKTEWPEGYQLASAMNFRFPQCVPTHLKTLIPNASNEAIALMKDFLQWDPKKRPTAAQALRYPYFQ 285          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000043386.1 (SMESG000043386.1)

HSP 1 Score: 857.825 bits (2215), Expect = 0.000e+0
Identity = 443/444 (99.77%), Postives = 444/444 (100.00%), Query Frame = 1
Query:   55 MIKDFRLISKKGEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVNNLREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIKGRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQSLKIADFGSCKTIFSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASILKNFKKSRSVSFNFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFKELRSNSGTTDPQSMDVLSKKGKPLNLIXXXXXXXXXXXXFNTESSLLIPDXXXXXXXXXXXXXXXISPSLVKSDNQNKLKEIPINSTRKSENNSNQVFFGNFNGVRKKSRRVIVDNSNSKPWAPLNSQSFLPKIYQSNLSQDNHPNSLFNNPFYSSE 1386
            MIKDFRLISKKGEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVNNLREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIKGRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQSLKIADFGSCKTIFSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASILKNFKKSRSVSFNFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFKELRSNSGTTDPQSMDVLSKKGKPLNLISSKENKENSQSEFNTESSLLIPDRISSRSNHSKNSFSIISPSLVKSDNQNKLKEIPINSTRKSENNSNQVFFGNFNGVRKKSRRVI+DNSNSKPWAPLNSQSFLPKIYQSNLSQDNHPNSLFNNPFYSSE
Sbjct:    1 MIKDFRLISKKGEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVNNLREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIKGRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQSLKIADFGSCKTIFSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASILKNFKKSRSVSFNFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFKELRSNSGTTDPQSMDVLSKKGKPLNLISSKENKENSQSEFNTESSLLIPDRISSRSNHSKNSFSIISPSLVKSDNQNKLKEIPINSTRKSENNSNQVFFGNFNGVRKKSRRVIIDNSNSKPWAPLNSQSFLPKIYQSNLSQDNHPNSLFNNPFYSSE 444          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000039711.1 (SMESG000039711.1)

HSP 1 Score: 229.95 bits (585), Expect = 5.277e-67
Identity = 116/292 (39.73%), Postives = 188/292 (64.38%), Query Frame = 1
Query:   67 FRLISKKGEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVNNLREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIKGRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIR-DQSLKIADFGSCKTIFSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASILKNFKK-SRSVSFNFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFKELRSNSG 936
            +  + + G+GT+  V+    V   +  A KKMK+ + +WD+  NLRE++++R L  H NI+ L EV+  ++   L LI E M+ NLYELIK R    PE  ++  +WQ+++GL +IHK G FHRD+KPEN++    + +KIADFG  + + S+ PYT+Y+STRWYRAPE LL    Y+  +D+++VGC+M E+ + RPLFPG++E+D I KI  +LG+P+ +     +K + +++F FP    + +  L+   S +A+ I+ ++I ++P  R T++++L + YFK     SG
Sbjct:    4 YNFVKQLGDGTYGSVILANVVGTSEKVAIKKMKKKFYSWDECLNLREVKSLRLLK-HPNIIRLKEVI--RERDCLYLIFEYMNQNLYELIKSRNKPFPEEAIRNIIWQVLEGLTYIHKEGFFHRDMKPENLMCNGSECVKIADFGLAREVRSQPPYTDYVSTRWYRAPEVLLRSVNYNSPIDIFAVGCIMAELYTFRPLFPGSSEIDMIYKICCVLGTPNKNDWPEGQKLAGTMNFKFPTVTSTNLSVLIPSASRDAIKIMLEMISWNPKNRPTSKDSLQYDYFKTNGQRSG 292          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000039711.1 (SMESG000039711.1)

HSP 1 Score: 226.868 bits (577), Expect = 6.113e-66
Identity = 115/292 (39.38%), Postives = 187/292 (64.04%), Query Frame = 1
Query:   67 FRLISKKGEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVNNLREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIKGRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQS-LKIADFGSCKTIFSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASILKNFKK-SRSVSFNFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFKELRSNSG 936
            +  + + G+GT+  V+    V   +  A KKMK+ + +WD+  NLRE++++R L  H NI+ L EV+  ++   L LI E M+ NLYELIK R    PE  ++  +WQ+++GL +IHK G FHRD+KPENIL    + +K+ADFG  ++  S  P+T+Y++TRWYRAPE LL    Y+  +D+++VGC+M E+ + RPLFPG++E+D I KI  +LG+P+ +     +K + +++F FP    + +  L+   S +A+ I+ ++I ++P  R T++++L + YFK     SG
Sbjct:    4 YNFVKQLGDGTYGSVILANVVGTSEKVAIKKMKKKFYSWDECLNLREVKSLRLLK-HPNIIRLKEVI--RERDCLYLIFEYMNQNLYELIKSRNKPFPEEAIRNIIWQVLEGLTYIHKEGYFHRDLKPENILCNSATQIKLADFGLARSTRSAPPFTDYVATRWYRAPEVLLRSVNYNSPIDIFAVGCIMAELYTFRPLFPGSSEIDMIYKICCVLGTPNKNDWPEGQKLAGTMNFKFPTVTSTNLSVLIPSASRDAIKIMLEMISWNPKNRPTSKDSLQYDYFKTNGQRSG 292          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000033370.1 (SMESG000033370.1)

HSP 1 Score: 170.629 bits (431), Expect = 2.199e-45
Identity = 105/298 (35.23%), Postives = 159/298 (53.36%), Query Frame = 1
Query:   52 KMIKDFRLISKKGEGTFSEVLKCQNVKNKDYFACKKMKQHYETWD-QVNNLREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIKGRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQS-LKIADFGSCKTIFSRYP-YTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASI------LKNFKKSRSVSFNFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFKE 918
            +++++F  ++K  EGT+  V + ++ K  +  A K++K   E     + +LREI  + +   HENI+ + EVV       + L+++ ++ +L  L+          +VK  M QL+  + H+H N I HRD+K  N+L+  +  LK+ADFG  +   S    YT  + T WYRAPE LL    YS Q+DLWSVGC+  E+L + PLFPG +E DQI  +   LG+P   I      L N K+     F +  R G      L+   LE   +I + + Y P RR+T + ALNH YF E
Sbjct:  277 RLVEEFECLNKIEEGTYGVVFRARDRKTNEIVALKRLKMEKERDGFPITSLREINTLMKAQ-HENIVTVREVVVGSNMDKIYLVMDFIEHDLKSLMISMVKPFEICEVKCLMLQLLSAVAHLHDNWILHRDLKTSNLLLSHRGVLKVADFGLAREYGSPLKNYTRVVVTLWYRAPELLLGTKIYSTQIDLWSVGCIFGELLLMMPLFPGKSEADQINILFKELGTPSEKIWPGVSNLPNIKRFEFGKFEYN-RLGKKFNLTLSESGLE---LINRFLAYCPERRITAEEALNHSYFNE 569          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000052413.1 (SMESG000052413.1)

HSP 1 Score: 162.54 bits (410), Expect = 6.787e-45
Identity = 94/292 (32.19%), Postives = 161/292 (55.14%), Query Frame = 1
Query:   58 IKDFRLISKKGEGTFSEVLKCQNVKNKDYFACKKMK-QHYETWDQVNNLREIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIKGRKNYLPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQS--LKIADFGSCKTIFSRYP-YTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLRPLFPGANEVDQIGKIHDILGSPDASILKNFKKSRSVSFNFPIRKGSGIERLLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFKEL 921
            + DF  I K GEGT+  V K  N    ++ A KK++ ++ E       LREI  ++ L  H NI+ L + + +K  G L L+ E ++M+L   +   +N + +  +K++ +Q++QGL + H     HRD+KP+N+L+      +K+ADFG  +   +     T  + T WYRAPE +L    YS  +D+WSV C+M E+++ +PLF G +E+DQ+  I  +LG+PD  +  +  K    +  FP+ +     RL+  +      ++++++ Y P  R   ++AL H YF +L
Sbjct:    5 LSDFTRIEKIGEGTYGIVYKSINKITNEFAAIKKIRSENDEDGIAPTTLREISILKELR-HPNIVYLQQTIAEK--GKLYLVFEYLNMDLRRYLDNEENPMNDIILKKFSYQIMQGLLYCHTRRFMHRDLKPQNLLVDTNKHIIKLADFGLARCYGAPVKNLTHEVVTLWYRAPEVILNAKRYSCAIDVWSVACIMAEMITYKPLFRGDSEIDQLFAIFKVLGTPDNKVWPDLDKFPGWNPLFPVWRYDLRSRLVEVIDENLFDLLEKMLVYHPLERTNIRDALLHDYFADL 293          
The following BLAST results are available for this feature:
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MOK5.225e-13858.90MOK protein kinase [Source:HGNC Symbol;Acc:HGNC:98... [more]
MOK2.485e-13759.22MOK protein kinase [Source:HGNC Symbol;Acc:HGNC:98... [more]
MOK1.433e-11150.81MOK protein kinase [Source:HGNC Symbol;Acc:HGNC:98... [more]
MOK1.481e-7761.31MOK protein kinase [Source:HGNC Symbol;Acc:HGNC:98... [more]
ICK5.978e-7442.11intestinal cell kinase [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dyf-51.572e-7039.10Serine/threonine-protein kinase dyf-5 [Source:Uni... [more]
dyf-52.218e-7039.10Serine/threonine-protein kinase dyf-5 [Source:Uni... [more]
gsk-31.911e-4636.33Glycogen synthase kinase-3 [Source:UniProtKB/Swis... [more]
cdk-22.613e-4634.36Cyclin-dependent kinase 2 [Source:UniProtKB/Swiss... [more]
cdk-42.045e-4332.20Cyclin-dependent kinase 4 homolog [Source:UniProt... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG423661.780e-6939.18gene:FBgn0259712 transcript:FBtr0331633[more]
CG423661.877e-6939.18gene:FBgn0259712 transcript:FBtr0299965[more]
sgg6.657e-4533.88gene:FBgn0003371 transcript:FBtr0070475[more]
sgg7.117e-4533.88gene:FBgn0003371 transcript:FBtr0070469[more]
sgg7.117e-4533.88gene:FBgn0003371 transcript:FBtr0070472[more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mak1.791e-6840.35male germ cell-associated kinase [Source:ZFIN;Acc:... [more]
mak1.021e-6739.86male germ cell-associated kinase [Source:ZFIN;Acc:... [more]
cdk21.899e-4833.56cyclin-dependent kinase 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
mapk72.403e-4732.32mitogen-activated protein kinase 7 [Source:ZFIN;Ac... [more]
mapk72.403e-4732.32mitogen-activated protein kinase 7 [Source:ZFIN;Ac... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ltb4r25.012e-13762.24leukotriene B4 receptor 2 [Source:Xenbase;Acc:XB-G... [more]
ltb4r27.020e-13762.24leukotriene B4 receptor 2 [Source:Xenbase;Acc:XB-G... [more]
ltb4r28.928e-11154.55leukotriene B4 receptor 2 [Source:Xenbase;Acc:XB-G... [more]
dnajc32.257e-7140.70DnaJ heat shock protein family (Hsp40) member C3 [... [more]
ICK3.901e-7139.65intestinal cell (MAK-like) kinase [Source:NCBI gen... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mok3.137e-13760.00MOK protein kinase [Source:MGI Symbol;Acc:MGI:1336... [more]
Ick2.528e-7542.81intestinal cell kinase [Source:MGI Symbol;Acc:MGI:... [more]
Ick1.293e-7442.81intestinal cell kinase [Source:MGI Symbol;Acc:MGI:... [more]
Ick1.293e-7442.81intestinal cell kinase [Source:MGI Symbol;Acc:MGI:... [more]
Mak2.826e-7140.70male germ cell-associated kinase [Source:MGI Symbo... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9UQ07|MOK_HUMAN2.509e-13758.90MAPK/MAK/MRK overlapping kinase OS=Homo sapiens OX... [more]
sp|Q9WVS4|MOK_MOUSE2.194e-13660.00MAPK/MAK/MRK overlapping kinase OS=Mus musculus OX... [more]
sp|Q84SN3|CDKF3_ORYSJ1.838e-7540.91Cyclin-dependent kinase F-3 OS=Oryza sativa subsp.... [more]
sp|P43294|MHK_ARATH3.276e-7442.76Serine/threonine-protein kinase MHK OS=Arabidopsis... [more]
sp|Q9JKV2|CILK1_MOUSE9.045e-7442.81Serine/threonine-protein kinase ICK OS=Mus musculu... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1QVT73.493e-15168.04MAPK/MAK/MRK overlapping kinase OS=Crassostrea gig... [more]
A0A3Q0JV153.394e-14863.37MAPK/MAK/MRK overlapping kinase OS=Ciona intestina... [more]
V4A3422.132e-14768.64Protein kinase domain-containing protein (Fragment... [more]
A0A1S3HJ065.868e-14664.95MAPK/MAK/MRK overlapping kinase isoform X3 OS=Ling... [more]
A0A1S3IBU05.997e-14664.95MAPK/MAK/MRK overlapping kinase-like isoform X3 OS... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MOK2.161e-12560.22MOK protein kinase [Source:HGNC Symbol;Acc:HGNC:98... [more]
ICK5.297e-7241.40serine/threonine-protein kinase ICK-like [Source:N... [more]
ICK5.765e-7241.40serine/threonine-protein kinase ICK-like [Source:N... [more]
mak3.334e-6542.52male germ cell associated kinase [Source:NCBI gene... [more]
mak4.609e-6441.96male germ cell associated kinase [Source:NCBI gene... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mak2.836e-7040.00male germ cell-associated kinase [Source:ZFIN;Acc:... [more]
cdk21.309e-5133.79cyclin-dependent kinase 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
cdk21.214e-5035.02cyclin-dependent kinase 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
ENSPMAT00000008013.14.641e-4832.07pep scaffold:Pmarinus_7.0:GL478839:10839:40406:1 g... [more]
mapk12.131e-4533.45mitogen-activated protein kinase 1 [Source:ZFIN;Ac... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PHO858.296e-4833.45Cyclin-dependent kinase; has ten cyclin partners; ... [more]
CDC281.007e-4531.86Cyclin-dependent kinase (CDK) catalytic subunit; m... [more]
IME24.593e-4531.25Serine/threonine protein kinase involved in activa... [more]
HOG16.317e-4332.37Mitogen-activated protein kinase involved in osmor... [more]
FUS38.742e-4329.14Mitogen-activated serine/threonine protein kinase ... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO402904.786e-14263.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411472.647e-7842.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO405731.589e-5030.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354024.357e-5036.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436712.468e-4932.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MOK4.043e-12856.94MOK protein kinase [Source:NCBI gene;Acc:101173667... [more]
MOK7.954e-12251.08MOK protein kinase [Source:NCBI gene;Acc:101173667... [more]
mak1.790e-7140.48male germ cell associated kinase [Source:NCBI gene... [more]
mak2.278e-7140.48male germ cell associated kinase [Source:NCBI gene... [more]
mak2.325e-7140.70male germ cell associated kinase [Source:NCBI gene... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000043386.10.000e+099.77SMESG000043386.1[more]
SMESG000039711.15.277e-6739.73SMESG000039711.1[more]
SMESG000039711.16.113e-6639.38SMESG000039711.1[more]
SMESG000033370.12.199e-4535.23SMESG000033370.1[more]
SMESG000052413.16.787e-4532.19SMESG000052413.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031879 ID=SMED30031879|Name=Protein kinase domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1790bp
TTCGAAGGTAAATAGCCGCTAAATTCCAAAATGAATATGAATTAATTTAC
GAAAATGATTAAAGATTTTAGACTAATTAGTAAAAAAGGTGAAGGCACAT
TTTCCGAGGTTCTCAAGTGTCAAAATGTAAAGAACAAGGATTATTTTGCC
TGTAAGAAAATGAAACAACATTACGAAACATGGGATCAGGTGAATAATCT
GAGGGAAATCCAAGCTATGAGACGGTTAAATCCCCATGAAAATATTCTCC
TTCTCCATGAAGTCGTTTTTGACAAGAAAAGTGGAACCCTCTGCCTAATA
TTGGAATTGATGGACATGAATTTGTATGAACTGATCAAGGGCCGTAAAAA
TTATTTACCTGAACATGACGTAAAGCGTTACATGTGGCAATTAATTCAAG
GATTGTTTCATATTCACAAAAATGGCATTTTTCACAGAGATGTTAAACCT
GAAAATATTTTAATAAGAGATCAATCGTTGAAAATTGCAGATTTTGGATC
GTGTAAAACTATATTTTCCCGGTATCCGTATACAGAATATATATCCACAA
GATGGTATCGGGCTCCTGAATGTCTATTAACCGATGGCTATTACAGCTAC
CAAATGGATCTTTGGAGTGTTGGGTGTGTAATGTTCGAGATTCTAAGCCT
TCGGCCATTATTTCCCGGTGCTAATGAAGTAGATCAAATCGGAAAGATTC
ACGACATATTGGGCAGTCCTGATGCAAGCATTTTAAAAAATTTTAAAAAG
AGTCGGTCGGTTTCATTCAATTTCCCAATTAGAAAAGGTTCCGGAATCGA
GAGATTGTTGGCTCATGTGTCATTAGAAGCAGTCAGTATAATAAAACAAT
TAATTGAATACGATCCGAGCCGCCGGTTGACAACGCAAAATGCACTAAAT
CATCCATATTTTAAAGAACTTAGATCTAATTCCGGAACAACTGATCCACA
GTCAATGGATGTTTTGAGTAAAAAAGGTAAGCCACTCAATTTAATATCGT
CAAAGGAAAATAAGGAAAATAGTCAGTCCGAATTCAATACAGAAAGCTCT
CTATTGATACCCGACAGGATTTCTTCCCGATCCAATCATTCAAAAAATTC
CTTCAGTATCATATCCCCCTCTCTAGTCAAATCAGACAATCAAAATAAAC
TCAAAGAAATCCCTATCAATTCTACCAGGAAATCAGAGAATAATTCTAAC
CAAGTGTTTTTTGGTAACTTCAATGGGGTTAGAAAGAAATCTCGAAGAGT
TATTGTTGACAATAGTAACAGCAAGCCATGGGCTCCGTTGAATTCACAGT
CATTTCTACCAAAGATATATCAGTCAAATTTATCTCAGGATAATCATCCT
AACTCTTTGTTTAATAATCCTTTTTATTCAAGTGAACTTTCAAATCTTAC
CAAAAATAAATCCACAACAAAATATTCGAAATATTATTCAAATGATAAGA
TAATCAAAACCTACTCTATGAGATTAAATGCGACATTTGGCACTCCATTT
TGTGACAGTTTGAGTTTTCTATTCACTCCGGAATCGGTCTTTGTGTAGTG
TTTTTTTAAATTTTGTGTTCGGATAGAAATTTTAACCAGCAACCAGGAAA
TTTGGTTACTCATTTGTCTGGTCTTTTCATAAATTTTAGACGCCCATGTA
GAAAACATAAACACAGCATGTCAATCATTAAAGTCCCTCACGTGGTTGTC
ACATTTATCAACCAACGAATGCGATTTGTCTATTTTGTGACTCAGCCGTG
GGTGTCACCAAATTTCGTATAAATACTTGATGAAATCGGC
back to top

protein sequence of SMED30031879-orf-1

>SMED30031879-orf-1 ID=SMED30031879-orf-1|Name=SMED30031879-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=498bp
MIKDFRLISKKGEGTFSEVLKCQNVKNKDYFACKKMKQHYETWDQVNNLR
EIQAMRRLNPHENILLLHEVVFDKKSGTLCLILELMDMNLYELIKGRKNY
LPEHDVKRYMWQLIQGLFHIHKNGIFHRDVKPENILIRDQSLKIADFGSC
KTIFSRYPYTEYISTRWYRAPECLLTDGYYSYQMDLWSVGCVMFEILSLR
PLFPGANEVDQIGKIHDILGSPDASILKNFKKSRSVSFNFPIRKGSGIER
LLAHVSLEAVSIIKQLIEYDPSRRLTTQNALNHPYFKELRSNSGTTDPQS
MDVLSKKGKPLNLISSKENKENSQSEFNTESSLLIPDRISSRSNHSKNSF
SIISPSLVKSDNQNKLKEIPINSTRKSENNSNQVFFGNFNGVRKKSRRVI
VDNSNSKPWAPLNSQSFLPKIYQSNLSQDNHPNSLFNNPFYSSELSNLTK
NKSTTKYSKYYSNDKIIKTYSMRLNATFGTPFCDSLSFLFTPESVFV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 5..286
e-value: 4.8E-86
score: 301.8
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 8..286
e-value: 1.5E-66
score: 224.5
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 5..286
score: 42.888
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 5..85
e-value: 2.7E-85
score: 288.1
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 86..287
e-value: 2.7E-85
score: 288.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 287..330
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 287..302
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 315..330
NoneNo IPR availablePANTHERPTHR24055MITOGEN-ACTIVATED PROTEIN KINASEcoord: 6..373
NoneNo IPR availablePANTHERPTHR24055:SF72MAPK/MAK/MRK OVERLAPPING KINASEcoord: 6..373
NoneNo IPR availableCDDcd07831STKc_MOKcoord: 5..286
e-value: 0.0
score: 524.144
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 125..137
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 2..290