ras-related protein Rab-27A

Overview
Nameras-related protein Rab-27A
Smed IDSMED30031862
Length (bp)919
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ras-related protein Rab-27A (SMED30031862) t-SNE clustered cells

Violin plots show distribution of expression levels for ras-related protein Rab-27A (SMED30031862) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ras-related protein Rab-27A (SMED30031862) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ras-related protein Rab-27A (SMED30031862) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031862

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30031862h1SMcG0007066 Contig39483uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031862h1SMcG0007066 Contig39483newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30031862h1SMcG0007066 dd_Smed_v4_5306_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30031862h1SMcG0007066 dd_Smed_v4_5306_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30031862h1SMcG0007066 dd_Smed_v4_5306_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30031862h1SMcG0007066 dd_Smed_v4_5306_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30031862h1SMcG0007066 dd_Smed_v4_5306_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ras-related protein Rab-27A vs. Ensembl Human
Match: RAB27B (RAB27B, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9767])

HSP 1 Score: 174.866 bits (442), Expect = 3.901e-58
Identity = 75/135 (55.56%), Postives = 108/135 (80.00%), Query Frame = 2
Query:  260 KNTNGIIEKEARLNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERINKVLD 664
            +  NG   K  +++LQLWDTAGQERF+SLT +FFRDAMGFLL+FDLT + SF+N+R+WM  L+ N+Y ENPDIVL+GNK+DL  +R ++   A ELA ++ +PY ETSA++G+NVEKA +TL++L+M+R+ + ++
Sbjct:   56 QGPNGSSGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVE 190          

HSP 2 Score: 70.0922 bits (170), Expect = 3.901e-58
Identity = 33/49 (67.35%), Postives = 38/49 (77.55%), Query Frame = 1
Query:  106 DYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRVIY 252
            DYDYLIKLLALGDS VGKT  L RY DN +   F  TVG+DF++KRV+Y
Sbjct:    5 DYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVY 53          
BLAST of ras-related protein Rab-27A vs. Ensembl Human
Match: RAB27A (RAB27A, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9766])

HSP 1 Score: 172.94 bits (437), Expect = 3.571e-56
Identity = 72/134 (53.73%), Postives = 107/134 (79.85%), Query Frame = 2
Query:  263 NTNGIIEKEARLNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERINKVLD 664
              +G   +  R++LQLWDTAGQERF+SLT +FFRDAMGFLL+FDLT+E SF+N+R+W+  L++++Y ENPDIVL GNKSDL  +RV+  E A+ LA+++ +PY ETSA++G N+ +A + L++L+M+R+ + +D
Sbjct:   57 GPDGATGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVD 190          

HSP 2 Score: 65.855 bits (159), Expect = 3.571e-56
Identity = 30/49 (61.22%), Postives = 37/49 (75.51%), Query Frame = 1
Query:  106 DYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRVIY 252
            DYDYLIK LALGDS VGKT +L +Y D  +   F  TVG+DF++KRV+Y
Sbjct:    5 DYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVY 53          
BLAST of ras-related protein Rab-27A vs. Ensembl Human
Match: RAB27A (RAB27A, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9766])

HSP 1 Score: 172.94 bits (437), Expect = 3.571e-56
Identity = 72/134 (53.73%), Postives = 107/134 (79.85%), Query Frame = 2
Query:  263 NTNGIIEKEARLNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERINKVLD 664
              +G   +  R++LQLWDTAGQERF+SLT +FFRDAMGFLL+FDLT+E SF+N+R+W+  L++++Y ENPDIVL GNKSDL  +RV+  E A+ LA+++ +PY ETSA++G N+ +A + L++L+M+R+ + +D
Sbjct:   57 GPDGATGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVD 190          

HSP 2 Score: 65.855 bits (159), Expect = 3.571e-56
Identity = 30/49 (61.22%), Postives = 37/49 (75.51%), Query Frame = 1
Query:  106 DYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRVIY 252
            DYDYLIK LALGDS VGKT +L +Y D  +   F  TVG+DF++KRV+Y
Sbjct:    5 DYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVY 53          
BLAST of ras-related protein Rab-27A vs. Ensembl Human
Match: RAB27A (RAB27A, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9766])

HSP 1 Score: 172.94 bits (437), Expect = 3.571e-56
Identity = 72/134 (53.73%), Postives = 107/134 (79.85%), Query Frame = 2
Query:  263 NTNGIIEKEARLNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERINKVLD 664
              +G   +  R++LQLWDTAGQERF+SLT +FFRDAMGFLL+FDLT+E SF+N+R+W+  L++++Y ENPDIVL GNKSDL  +RV+  E A+ LA+++ +PY ETSA++G N+ +A + L++L+M+R+ + +D
Sbjct:   57 GPDGATGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVD 190          

HSP 2 Score: 65.855 bits (159), Expect = 3.571e-56
Identity = 30/49 (61.22%), Postives = 37/49 (75.51%), Query Frame = 1
Query:  106 DYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRVIY 252
            DYDYLIK LALGDS VGKT +L +Y D  +   F  TVG+DF++KRV+Y
Sbjct:    5 DYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVY 53          
BLAST of ras-related protein Rab-27A vs. Ensembl Human
Match: RAB27A (RAB27A, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9766])

HSP 1 Score: 172.94 bits (437), Expect = 3.571e-56
Identity = 72/134 (53.73%), Postives = 107/134 (79.85%), Query Frame = 2
Query:  263 NTNGIIEKEARLNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERINKVLD 664
              +G   +  R++LQLWDTAGQERF+SLT +FFRDAMGFLL+FDLT+E SF+N+R+W+  L++++Y ENPDIVL GNKSDL  +RV+  E A+ LA+++ +PY ETSA++G N+ +A + L++L+M+R+ + +D
Sbjct:   57 GPDGATGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVD 190          

HSP 2 Score: 65.855 bits (159), Expect = 3.571e-56
Identity = 30/49 (61.22%), Postives = 37/49 (75.51%), Query Frame = 1
Query:  106 DYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRVIY 252
            DYDYLIK LALGDS VGKT +L +Y D  +   F  TVG+DF++KRV+Y
Sbjct:    5 DYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVY 53          
BLAST of ras-related protein Rab-27A vs. Ensembl Celegans
Match: aex-6 (Rab27 [Source:UniProtKB/TrEMBL;Acc:G5EBS5])

HSP 1 Score: 162.925 bits (411), Expect = 2.589e-55
Identity = 69/118 (58.47%), Postives = 94/118 (79.66%), Query Frame = 2
Query:  302 LQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERINK 655
            LQLWDTAGQERF+SLT +FFRDAMGF+L+FD+T+E SF+NIRDW+  LK+++Y E PDI++ GNK+DL +RR +S   A +LA +  +PY ETSA +  NVEK+   L++LVM+RI +
Sbjct:   67 LQLWDTAGQERFRSLTTAFFRDAMGFILIFDITNEQSFLNIRDWLSQLKVHAYCEQPDIIICGNKADLENRRQVSTARAKQLADQLGLPYFETSACTSTNVEKSVDCLLDLVMQRIQQ 184          

HSP 2 Score: 71.633 bits (174), Expect = 2.589e-55
Identity = 33/49 (67.35%), Postives = 39/49 (79.59%), Query Frame = 1
Query:  106 DYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRVIY 252
            DYDYLIK LALGDS VGKT  L RY DN +T  F +TVG+DFK+K+V+Y
Sbjct:    3 DYDYLIKFLALGDSGVGKTSFLHRYTDNTFTGQFISTVGIDFKEKKVVY 51          
BLAST of ras-related protein Rab-27A vs. Ensembl Celegans
Match: rab-3 (Ras-related protein Rab-3 [Source:UniProtKB/Swiss-Prot;Acc:Q94986])

HSP 1 Score: 124.79 bits (312), Expect = 2.477e-39
Identity = 53/130 (40.77%), Postives = 91/130 (70.00%), Query Frame = 2
Query:  275 IIEKEARLNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERINKVLD 664
            +   + R+ LQ+WDTAGQER++++T +++R AMGF+L++D+T+E SF +++DW   +K  S+ EN  +VLVGNK D+ S RV+S +   +LA +  + + ETSA    NV+  F+ L+E++ +++ + LD
Sbjct:   78 VFRGDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNSVQDWCTQIKTYSW-ENAQVVLVGNKCDMDSERVVSMDRGRQLADQLGLEFFETSAKENINVKAVFEKLVEIICDKMAESLD 206          

HSP 2 Score: 56.225 bits (134), Expect = 2.477e-39
Identity = 31/63 (49.21%), Postives = 42/63 (66.67%), Query Frame = 1
Query:   88 STAGNDD--YDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRVIYTPKKHK 270
            +T G  D  +DY+ KLL +G+SSVGKT  L RY D+++T  F +TVG+DFK K V    K+ K
Sbjct:   24 ATPGQPDQNFDYMFKLLIIGNSSVGKTSFLFRYCDDSFTSAFVSTVGIDFKVKTVFRGDKRVK 86          
BLAST of ras-related protein Rab-27A vs. Ensembl Celegans
Match: rab-3 (Ras-related protein Rab-3 [Source:UniProtKB/Swiss-Prot;Acc:Q94986])

HSP 1 Score: 124.405 bits (311), Expect = 2.521e-39
Identity = 53/130 (40.77%), Postives = 91/130 (70.00%), Query Frame = 2
Query:  275 IIEKEARLNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERINKVLD 664
            +   + R+ LQ+WDTAGQER++++T +++R AMGF+L++D+T+E SF +++DW   +K  S+ EN  +VLVGNK D+ S RV+S +   +LA +  + + ETSA    NV+  F+ L+E++ +++ + LD
Sbjct:   64 VFRGDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNSVQDWCTQIKTYSW-ENAQVVLVGNKCDMDSERVVSMDRGRQLADQLGLEFFETSAKENINVKAVFEKLVEIICDKMAESLD 192          

HSP 2 Score: 56.6102 bits (135), Expect = 2.521e-39
Identity = 31/65 (47.69%), Postives = 42/65 (64.62%), Query Frame = 1
Query:   82 NSSTAGNDD--YDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRVIYTPKKHK 270
              +T G  D  +DY+ KLL +G+SSVGKT  L RY D+++T  F +TVG+DFK K V    K+ K
Sbjct:    8 QGATPGQPDQNFDYMFKLLIIGNSSVGKTSFLFRYCDDSFTSAFVSTVGIDFKVKTVFRGDKRVK 72          
BLAST of ras-related protein Rab-27A vs. Ensembl Celegans
Match: rab-1 (RAB family [Source:UniProtKB/TrEMBL;Acc:Q9UAQ6])

HSP 1 Score: 119.398 bits (298), Expect = 6.011e-39
Identity = 52/122 (42.62%), Postives = 87/122 (71.31%), Query Frame = 2
Query:  296 LNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYS-ENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERINKV 658
            + LQ+WDTAGQERF+++T S++R A G ++V+D+TD+ +F N++ W++  +I+ Y+ EN + +LVGNK DL+++R +  + A + A +  +P+LETSA S  NVE+AF T+   +  R+  V
Sbjct:   60 IKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDITDQETFNNVKQWLQ--EIDRYACENVNKLLVGNKCDLTAKRAVETQAAQDYAGQLGIPFLETSAKSSTNVEQAFLTMASEIKSRMGPV 179          

HSP 2 Score: 60.077 bits (144), Expect = 6.011e-39
Identity = 27/48 (56.25%), Postives = 36/48 (75.00%), Query Frame = 1
Query:   91 TAGNDDYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFK 234
             A N +YDYL KLL +GDS VGK+C+L R+ D+ YT  + +T+GVDFK
Sbjct:    2 AAMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFK 49          
BLAST of ras-related protein Rab-27A vs. Ensembl Celegans
Match: rab-8 (RAB family; Rab8 [Source:UniProtKB/TrEMBL;Acc:G5EFC1])

HSP 1 Score: 108.997 bits (271), Expect = 3.947e-35
Identity = 48/111 (43.24%), Postives = 83/111 (74.77%), Query Frame = 2
Query:  293 RLNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTL 625
            ++ LQ+WDTAGQERF+++T +++R AMG +LV+D+T+E SF NI++W+R ++ ++ S+  + +++GNK D+  RR +S +   +LA E+   +LETSA +  N+++AF TL
Sbjct:   56 KIKLQIWDTAGQERFRTITTAYYRGAMGIILVYDITNERSFENIKNWIRNIEEHAASD-VERMIIGNKCDIEERREVSRDRGEQLAIEYGTKFLETSAKANLNIDEAFFTL 165          

HSP 2 Score: 57.7658 bits (138), Expect = 3.947e-35
Identity = 27/54 (50.00%), Postives = 38/54 (70.37%), Query Frame = 1
Query:  109 YDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRVIYTPKKHK 270
            YDYL KLL +GDS VGKTC+L R+ D+++   F +T+G+DFK + +    KK K
Sbjct:    5 YDYLFKLLLIGDSGVGKTCVLFRFSDDSFNNSFISTIGIDFKIRTIELDGKKIK 58          
BLAST of ras-related protein Rab-27A vs. Ensembl Fly
Match: Rab27 (gene:FBgn0025382 transcript:FBtr0070294)

HSP 1 Score: 152.14 bits (383), Expect = 5.738e-51
Identity = 65/122 (53.28%), Postives = 92/122 (75.41%), Query Frame = 2
Query:  284 KEARLNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERI 649
            +  R++LQ+WDTAGQERF+SLT +F+RDAMGFLL+FDLT E SF+   +W+  L+ ++YSE+PD+VL GNK DL   RV+S +    L + + +PY+ETSA +G NV++A + L+  VMERI
Sbjct:   60 RRHRIHLQIWDTAGQERFRSLTTAFYRDAMGFLLIFDLTSEKSFLETANWLSQLRTHAYSEDPDVVLCGNKCDLLQLRVVSRDQVAALCRRYRLPYIETSACTGANVKEAVELLVGRVMERI 181          

HSP 2 Score: 68.5514 bits (166), Expect = 5.738e-51
Identity = 30/60 (50.00%), Postives = 42/60 (70.00%), Query Frame = 1
Query:   91 TAGNDDYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRVIYTPKKHK 270
            T  N DYDYL+K L LGDS VGKTC+L +Y D  +   F +TVG+DF++KR++Y  +  +
Sbjct:    2 TGANIDYDYLLKFLVLGDSGVGKTCLLYQYTDGRFHTQFISTVGIDFREKRLLYNSRGRR 61          
BLAST of ras-related protein Rab-27A vs. Ensembl Fly
Match: Rab27 (gene:FBgn0025382 transcript:FBtr0070293)

HSP 1 Score: 152.14 bits (383), Expect = 2.991e-46
Identity = 65/122 (53.28%), Postives = 92/122 (75.41%), Query Frame = 2
Query:  284 KEARLNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERI 649
            +  R++LQ+WDTAGQERF+SLT +F+RDAMGFLL+FDLT E SF+   +W+  L+ ++YSE+PD+VL GNK DL   RV+S +    L + + +PY+ETSA +G NV++A + L+  VMERI
Sbjct:   66 RRHRIHLQIWDTAGQERFRSLTTAFYRDAMGFLLIFDLTSEKSFLETANWLSQLRTHAYSEDPDVVLCGNKCDLLQLRVVSRDQVAALCRRYRLPYIETSACTGANVKEAVELLVGRVMERI 187          

HSP 2 Score: 52.373 bits (124), Expect = 2.991e-46
Identity = 22/49 (44.90%), Postives = 34/49 (69.39%), Query Frame = 1
Query:  124 KLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRVIYTPKKHK 270
            + L LGDS VGKTC+L +Y D  +   F +TVG+DF++KR++Y  +  +
Sbjct:   19 QFLVLGDSGVGKTCLLYQYTDGRFHTQFISTVGIDFREKRLLYNSRGRR 67          
BLAST of ras-related protein Rab-27A vs. Ensembl Fly
Match: Rab1 (gene:FBgn0285937 transcript:FBtr0084104)

HSP 1 Score: 126.716 bits (317), Expect = 6.020e-41
Identity = 56/120 (46.67%), Postives = 86/120 (71.67%), Query Frame = 2
Query:  296 LNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYS-ENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERIN 652
            + LQ+WDTAGQERF+++T S++R A G ++V+D TD+ SF N++ W+   +I  Y+ EN + +LVGNKSDL++++V+ H TA E A +  +P+LETSA S  NVE+AF T+   +  R+ 
Sbjct:   60 IKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLE--EIERYACENVNKLLVGNKSDLTTKKVVDHTTAAEYAAQLGIPFLETSAKSATNVEQAFMTMAAEIKNRVG 177          

HSP 2 Score: 60.077 bits (144), Expect = 6.020e-41
Identity = 26/45 (57.78%), Postives = 35/45 (77.78%), Query Frame = 1
Query:  100 NDDYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFK 234
            N +YDYL KLL +GDS VGK+C+L R+ D+ YT  + +T+GVDFK
Sbjct:    5 NPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFK 49          
BLAST of ras-related protein Rab-27A vs. Ensembl Fly
Match: Rab3 (gene:FBgn0005586 transcript:FBtr0473383)

HSP 1 Score: 125.176 bits (313), Expect = 1.711e-39
Identity = 52/130 (40.00%), Postives = 94/130 (72.31%), Query Frame = 2
Query:  275 IIEKEARLNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERINKVLD 664
            +   + R+ LQ+WDTAGQER++++T +++R AMGF+L++D+T+E+SF +++DW+  +K  S+ +N  ++LVGNK D+  +RVIS E   +LA +  V + ETSA    NV+  F+ L++++ +++++ LD
Sbjct:   63 VFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSW-DNAQVILVGNKCDMEDQRVISFERGRQLADQLGVEFFETSAKENVNVKAVFERLVDIICDKMSESLD 191          

HSP 2 Score: 56.9954 bits (136), Expect = 1.711e-39
Identity = 29/59 (49.15%), Postives = 41/59 (69.49%), Query Frame = 1
Query:   94 AGNDDYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRVIYTPKKHK 270
            A + ++DY+ KLL +G+SSVGKT  L RY D+++T  F +TVG+DFK K V    K+ K
Sbjct:   13 AADQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRHDKRVK 71          
BLAST of ras-related protein Rab-27A vs. Ensembl Fly
Match: Rab3 (gene:FBgn0005586 transcript:FBtr0088257)

HSP 1 Score: 125.176 bits (313), Expect = 1.711e-39
Identity = 52/130 (40.00%), Postives = 94/130 (72.31%), Query Frame = 2
Query:  275 IIEKEARLNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERINKVLD 664
            +   + R+ LQ+WDTAGQER++++T +++R AMGF+L++D+T+E+SF +++DW+  +K  S+ +N  ++LVGNK D+  +RVIS E   +LA +  V + ETSA    NV+  F+ L++++ +++++ LD
Sbjct:   63 VFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSW-DNAQVILVGNKCDMEDQRVISFERGRQLADQLGVEFFETSAKENVNVKAVFERLVDIICDKMSESLD 191          

HSP 2 Score: 56.9954 bits (136), Expect = 1.711e-39
Identity = 29/59 (49.15%), Postives = 41/59 (69.49%), Query Frame = 1
Query:   94 AGNDDYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRVIYTPKKHK 270
            A + ++DY+ KLL +G+SSVGKT  L RY D+++T  F +TVG+DFK K V    K+ K
Sbjct:   13 AADQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRHDKRVK 71          
BLAST of ras-related protein Rab-27A vs. Ensembl Zebrafish
Match: rab27b (RAB27B, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-120215-85])

HSP 1 Score: 173.326 bits (438), Expect = 1.034e-59
Identity = 75/132 (56.82%), Postives = 105/132 (79.55%), Query Frame = 2
Query:  269 NGIIEKEARLNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERINKVLD 664
            NG   K  +++LQLWDTAGQERF+SLT +FFRDAMGFLL+FDLT + SF+N+R+WM  L+ N+Y ENPDIVLVGNK+DL+ +R +  + A ELA ++ +PY ETSA++G  V+KA  TL++LVM+R+ + ++
Sbjct:   66 NGTTGKTFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLVGNKADLADQREVQEKQAKELADKYGIPYFETSAATGSEVDKAVVTLLDLVMKRMEQCVE 197          

HSP 2 Score: 76.6406 bits (187), Expect = 1.034e-59
Identity = 37/61 (60.66%), Postives = 46/61 (75.41%), Query Frame = 1
Query:   73 IMTNSSTAGNDDYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRVIYT 255
            + ++SST  + DYDYLIKLLALGDS VGKT  L RY DN +   F  TVG+DF++KRV+YT
Sbjct:    1 MFSSSSTMTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYT 61          
BLAST of ras-related protein Rab-27A vs. Ensembl Zebrafish
Match: rab27b (RAB27B, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-120215-85])

HSP 1 Score: 173.326 bits (438), Expect = 1.428e-59
Identity = 75/132 (56.82%), Postives = 105/132 (79.55%), Query Frame = 2
Query:  269 NGIIEKEARLNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERINKVLD 664
            NG   K  +++LQLWDTAGQERF+SLT +FFRDAMGFLL+FDLT + SF+N+R+WM  L+ N+Y ENPDIVLVGNK+DL+ +R +  + A ELA ++ +PY ETSA++G  V+KA  TL++LVM+R+ + ++
Sbjct:   66 NGTTGKTFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLVGNKADLADQREVQEKQAKELADKYGIPYFETSAATGSEVDKAVVTLLDLVMKRMEQCVE 197          

HSP 2 Score: 76.2554 bits (186), Expect = 1.428e-59
Identity = 37/59 (62.71%), Postives = 45/59 (76.27%), Query Frame = 1
Query:   79 TNSSTAGNDDYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRVIYT 255
            ++SST  + DYDYLIKLLALGDS VGKT  L RY DN +   F  TVG+DF++KRV+YT
Sbjct:    3 SSSSTMTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYT 61          
BLAST of ras-related protein Rab-27A vs. Ensembl Zebrafish
Match: rab27a (RAB27A, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-050913-46])

HSP 1 Score: 176.022 bits (445), Expect = 7.097e-57
Identity = 75/132 (56.82%), Postives = 106/132 (80.30%), Query Frame = 2
Query:  269 NGIIEKEARLNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERINKVLD 664
            +G   +  R+++QLWDTAGQERF+SLT +FFRDAMGFLL+FDLT+E SF+N+R+WM  L+ ++Y ENPDIVL GNKSDL  +R +  E A ELA+++ VPY ETSA++GENV +A + L++L+M+R+ + +D
Sbjct:   59 DGTAGRGQRIHIQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWMSQLQTHAYCENPDIVLCGNKSDLEEQRAVKAENARELAEKYGVPYFETSAANGENVSRAVEVLLDLIMKRMERCVD 190          

HSP 2 Score: 64.6994 bits (156), Expect = 7.097e-57
Identity = 30/49 (61.22%), Postives = 37/49 (75.51%), Query Frame = 1
Query:  106 DYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRVIY 252
            DYDYLIK LALGDS VGKT  L +Y D+ +   F  TVG+DF++KRV+Y
Sbjct:    5 DYDYLIKFLALGDSGVGKTSFLYQYTDSKFNSKFITTVGIDFREKRVVY 53          
BLAST of ras-related protein Rab-27A vs. Ensembl Zebrafish
Match: rab1bb (RAB1B, member RAS oncogene family b [Source:ZFIN;Acc:ZDB-GENE-040625-133])

HSP 1 Score: 123.25 bits (308), Expect = 1.612e-40
Identity = 54/119 (45.38%), Postives = 89/119 (74.79%), Query Frame = 2
Query:  296 LNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSY-SENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERI 649
            + LQ+WDTAGQERF+++T S++R A G ++V+D+TD+ S+ N++ W++  +I+ Y SEN + +LVGNK DL++++V+ + TA E A    +P+LETSA +  NVE+AF T+ E + +R+
Sbjct:   57 IKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYNNVKQWLK--EIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAEEIKKRM 173          

HSP 2 Score: 62.3882 bits (150), Expect = 1.612e-40
Identity = 28/45 (62.22%), Postives = 35/45 (77.78%), Query Frame = 1
Query:  100 NDDYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFK 234
            N +YDYL KLL +GDS VGK+CIL R+ D+ YT  F +T+GVDFK
Sbjct:    2 NPEYDYLFKLLLIGDSGVGKSCILLRFADDTYTESFISTIGVDFK 46          
BLAST of ras-related protein Rab-27A vs. Ensembl Zebrafish
Match: rab1bb (RAB1B, member RAS oncogene family b [Source:ZFIN;Acc:ZDB-GENE-040625-133])

HSP 1 Score: 123.25 bits (308), Expect = 1.612e-40
Identity = 54/119 (45.38%), Postives = 89/119 (74.79%), Query Frame = 2
Query:  296 LNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSY-SENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERI 649
            + LQ+WDTAGQERF+++T S++R A G ++V+D+TD+ S+ N++ W++  +I+ Y SEN + +LVGNK DL++++V+ + TA E A    +P+LETSA +  NVE+AF T+ E + +R+
Sbjct:   57 IKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYNNVKQWLK--EIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAEEIKKRM 173          

HSP 2 Score: 62.3882 bits (150), Expect = 1.612e-40
Identity = 28/45 (62.22%), Postives = 35/45 (77.78%), Query Frame = 1
Query:  100 NDDYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFK 234
            N +YDYL KLL +GDS VGK+CIL R+ D+ YT  F +T+GVDFK
Sbjct:    2 NPEYDYLFKLLLIGDSGVGKSCILLRFADDTYTESFISTIGVDFK 46          
BLAST of ras-related protein Rab-27A vs. Ensembl Xenopus
Match: lemd3 (LEM domain containing 3 [Source:Xenbase;Acc:XB-GENE-486033])

HSP 1 Score: 174.481 bits (441), Expect = 7.718e-59
Identity = 75/134 (55.97%), Postives = 106/134 (79.10%), Query Frame = 2
Query:  263 NTNGIIEKEARLNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERINKVLD 664
               G   K  +++LQLWDTAGQERF+SLT +FFRDAMGFLL+FDLT + SF+N+R+WM  L+ N+Y ENPDIVL+GNK+DLS +R ++   A ELA ++ +PY ETSA+SG++VEK+  TL++L+M+R+ + +D
Sbjct:  147 GPGGTHGKTFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLSDQREVNERQAKELADKYGIPYFETSAASGQDVEKSVDTLLDLIMKRMEQCVD 280          

HSP 2 Score: 73.1738 bits (178), Expect = 7.718e-59
Identity = 36/56 (64.29%), Postives = 42/56 (75.00%), Query Frame = 1
Query:   88 STAGNDDYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRVIYT 255
            ST  + DYDYLIKLLALGDS VGKT  L RY DN +   F  TVG+DF++KRVIY+
Sbjct:   89 STMTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVIYS 144          
BLAST of ras-related protein Rab-27A vs. Ensembl Xenopus
Match: lemd3 (LEM domain containing 3 [Source:Xenbase;Acc:XB-GENE-486033])

HSP 1 Score: 174.096 bits (440), Expect = 5.002e-58
Identity = 75/132 (56.82%), Postives = 106/132 (80.30%), Query Frame = 2
Query:  269 NGIIEKEARLNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERINKVLD 664
             G   K  +++LQLWDTAGQERF+SLT +FFRDAMGFLL+FDLT + SF+N+R+WM  L+ N+Y ENPDIVL+GNK+DLS +R ++   A ELA ++ +PY ETSA+SG++VEK+  TL++L+M+R+ + +D
Sbjct:   59 GGTHGKTFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLSDQREVNERQAKELADKYGIPYFETSAASGQDVEKSVDTLLDLIMKRMEQCVD 190          

HSP 2 Score: 70.8626 bits (172), Expect = 5.002e-58
Identity = 34/50 (68.00%), Postives = 39/50 (78.00%), Query Frame = 1
Query:  106 DYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRVIYT 255
            DYDYLIKLLALGDS VGKT  L RY DN +   F  TVG+DF++KRVIY+
Sbjct:    5 DYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVIYS 54          
BLAST of ras-related protein Rab-27A vs. Ensembl Xenopus
Match: rab27a (RAB27A, member RAS oncogene family [Source:NCBI gene;Acc:493339])

HSP 1 Score: 165.622 bits (418), Expect = 2.815e-53
Identity = 75/132 (56.82%), Postives = 105/132 (79.55%), Query Frame = 2
Query:  269 NGIIEKEARLNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERINKVLD 664
            +GI  +  R++LQLWDTAGQERF+SLT +FFRDAMGFLL+FDLT+E SF+N+R+WM  L++++Y ENPDIVL GNK DL  +R +  E A E A+++ +PY ETSA+ G NV KA +TL++L+M+R+ + +D
Sbjct:   59 DGISGRGQRVHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWMSQLQVHAYCENPDIVLCGNKCDLDEQRAVKEEEAKEFAEKYGIPYFETSAAIGTNVNKAVETLLDLIMKRMERCVD 190          

HSP 2 Score: 63.5438 bits (153), Expect = 2.815e-53
Identity = 30/49 (61.22%), Postives = 36/49 (73.47%), Query Frame = 1
Query:  106 DYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRVIY 252
            DYDYLIK LALGDS VGKT  L +Y D  +   F  TVG+DF++KRV+Y
Sbjct:    5 DYDYLIKFLALGDSGVGKTSFLYQYTDAKFNSKFITTVGIDFREKRVVY 53          
BLAST of ras-related protein Rab-27A vs. Ensembl Xenopus
Match: rab27a (RAB27A, member RAS oncogene family [Source:NCBI gene;Acc:493339])

HSP 1 Score: 162.54 bits (410), Expect = 2.092e-52
Identity = 75/131 (57.25%), Postives = 104/131 (79.39%), Query Frame = 2
Query:  269 NGIIEKEARLNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERINKVL 661
            +GI  +  R++LQLWDTAGQERF+SLT +FFRDAMGFLL+FDLT+E SF+N+R+WM  L++++Y ENPDIVL GNK DL  +R +  E A E A+++ +PY ETSA+ G NV KA +TL++L+M+R+ + L
Sbjct:   59 DGISGRGQRVHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWMSQLQVHAYCENPDIVLCGNKCDLDEQRAVKEEEAKEFAEKYGIPYFETSAAIGTNVNKAVETLLDLIMKRMERNL 189          

HSP 2 Score: 63.5438 bits (153), Expect = 2.092e-52
Identity = 30/49 (61.22%), Postives = 36/49 (73.47%), Query Frame = 1
Query:  106 DYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRVIY 252
            DYDYLIK LALGDS VGKT  L +Y D  +   F  TVG+DF++KRV+Y
Sbjct:    5 DYDYLIKFLALGDSGVGKTSFLYQYTDAKFNSKFITTVGIDFREKRVVY 53          
BLAST of ras-related protein Rab-27A vs. Ensembl Xenopus
Match: rab1a (RAB1A, member RAS oncogene family [Source:NCBI gene;Acc:448007])

HSP 1 Score: 122.479 bits (306), Expect = 2.235e-39
Identity = 54/120 (45.00%), Postives = 88/120 (73.33%), Query Frame = 2
Query:  296 LNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSY-SENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERIN 652
            + LQ+WDTAGQERF+++T S++R A G ++V+D+TD+ SF N++ W++  +I+ Y SEN + +LVGNK DL++++V+ + TA E A    +P+LETSA +  NVE+AF T+   + +R+ 
Sbjct:   60 IKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQ--EIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMG 177          

HSP 2 Score: 60.077 bits (144), Expect = 2.235e-39
Identity = 26/45 (57.78%), Postives = 35/45 (77.78%), Query Frame = 1
Query:  100 NDDYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFK 234
            N +YDYL KLL +GDS VGK+C+L R+ D+ YT  + +T+GVDFK
Sbjct:    5 NPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFK 49          
BLAST of ras-related protein Rab-27A vs. Ensembl Mouse
Match: Rab27b (RAB27B, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1931295])

HSP 1 Score: 175.252 bits (443), Expect = 2.501e-58
Identity = 74/135 (54.81%), Postives = 109/135 (80.74%), Query Frame = 2
Query:  260 KNTNGIIEKEARLNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERINKVLD 664
            +  +G   K  +++LQLWDTAGQERF+SLT +FFRDAMGFLL+FDLT + SF+N+R+WM  L+ N+Y ENPDIVL+GNK+DL  +R ++   A ELA+++ +PY ETSA++G+NVEK+ +TL++L+M+R+ K ++
Sbjct:   56 QGADGASGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELAEKYGIPYFETSAATGQNVEKSVETLLDLIMKRMEKCVE 190          

HSP 2 Score: 70.0922 bits (170), Expect = 2.501e-58
Identity = 33/49 (67.35%), Postives = 38/49 (77.55%), Query Frame = 1
Query:  106 DYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRVIY 252
            DYDYLIKLLALGDS VGKT  L RY DN +   F  TVG+DF++KRV+Y
Sbjct:    5 DYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVY 53          
BLAST of ras-related protein Rab-27A vs. Ensembl Mouse
Match: Rab27b (RAB27B, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1931295])

HSP 1 Score: 175.252 bits (443), Expect = 2.501e-58
Identity = 74/135 (54.81%), Postives = 109/135 (80.74%), Query Frame = 2
Query:  260 KNTNGIIEKEARLNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERINKVLD 664
            +  +G   K  +++LQLWDTAGQERF+SLT +FFRDAMGFLL+FDLT + SF+N+R+WM  L+ N+Y ENPDIVL+GNK+DL  +R ++   A ELA+++ +PY ETSA++G+NVEK+ +TL++L+M+R+ K ++
Sbjct:   56 QGADGASGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELAEKYGIPYFETSAATGQNVEKSVETLLDLIMKRMEKCVE 190          

HSP 2 Score: 70.0922 bits (170), Expect = 2.501e-58
Identity = 33/49 (67.35%), Postives = 38/49 (77.55%), Query Frame = 1
Query:  106 DYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRVIY 252
            DYDYLIKLLALGDS VGKT  L RY DN +   F  TVG+DF++KRV+Y
Sbjct:    5 DYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVY 53          
BLAST of ras-related protein Rab-27A vs. Ensembl Mouse
Match: Rab27b (RAB27B, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1931295])

HSP 1 Score: 175.252 bits (443), Expect = 2.501e-58
Identity = 74/135 (54.81%), Postives = 109/135 (80.74%), Query Frame = 2
Query:  260 KNTNGIIEKEARLNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERINKVLD 664
            +  +G   K  +++LQLWDTAGQERF+SLT +FFRDAMGFLL+FDLT + SF+N+R+WM  L+ N+Y ENPDIVL+GNK+DL  +R ++   A ELA+++ +PY ETSA++G+NVEK+ +TL++L+M+R+ K ++
Sbjct:   56 QGADGASGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELAEKYGIPYFETSAATGQNVEKSVETLLDLIMKRMEKCVE 190          

HSP 2 Score: 70.0922 bits (170), Expect = 2.501e-58
Identity = 33/49 (67.35%), Postives = 38/49 (77.55%), Query Frame = 1
Query:  106 DYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRVIY 252
            DYDYLIKLLALGDS VGKT  L RY DN +   F  TVG+DF++KRV+Y
Sbjct:    5 DYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVY 53          
BLAST of ras-related protein Rab-27A vs. Ensembl Mouse
Match: Rab27a (RAB27A, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1861441])

HSP 1 Score: 172.555 bits (436), Expect = 3.765e-56
Identity = 72/132 (54.55%), Postives = 106/132 (80.30%), Query Frame = 2
Query:  269 NGIIEKEARLNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERINKVLD 664
            +G + +  R++LQLWDTAGQERF+SLT +FFRDAMGFLL+FDLT+E SF+N+R+W+  L++++Y ENPDIVL GNKSDL  +R +  E A ELA+++ +PY ETSA++G N+  A + L++L+M+R+ + +D
Sbjct:   59 DGAVGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRAVKEEEARELAEKYGIPYFETSAANGTNISHAIEMLLDLIMKRMERCVD 190          

HSP 2 Score: 65.4698 bits (158), Expect = 3.765e-56
Identity = 30/49 (61.22%), Postives = 37/49 (75.51%), Query Frame = 1
Query:  106 DYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRVIY 252
            DYDYLIK LALGDS VGKT +L +Y D  +   F  TVG+DF++KRV+Y
Sbjct:    5 DYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVY 53          
BLAST of ras-related protein Rab-27A vs. Ensembl Mouse
Match: Rab27a (RAB27A, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1861441])

HSP 1 Score: 172.555 bits (436), Expect = 3.765e-56
Identity = 72/132 (54.55%), Postives = 106/132 (80.30%), Query Frame = 2
Query:  269 NGIIEKEARLNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERINKVLD 664
            +G + +  R++LQLWDTAGQERF+SLT +FFRDAMGFLL+FDLT+E SF+N+R+W+  L++++Y ENPDIVL GNKSDL  +R +  E A ELA+++ +PY ETSA++G N+  A + L++L+M+R+ + +D
Sbjct:   59 DGAVGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRAVKEEEARELAEKYGIPYFETSAANGTNISHAIEMLLDLIMKRMERCVD 190          

HSP 2 Score: 65.4698 bits (158), Expect = 3.765e-56
Identity = 30/49 (61.22%), Postives = 37/49 (75.51%), Query Frame = 1
Query:  106 DYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRVIY 252
            DYDYLIK LALGDS VGKT +L +Y D  +   F  TVG+DF++KRV+Y
Sbjct:    5 DYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVY 53          
BLAST of ras-related protein Rab-27A vs. UniProt/SwissProt
Match: sp|Q99P58|RB27B_MOUSE (Ras-related protein Rab-27B OS=Mus musculus OX=10090 GN=Rab27b PE=1 SV=3)

HSP 1 Score: 175.252 bits (443), Expect = 1.478e-57
Identity = 74/135 (54.81%), Postives = 109/135 (80.74%), Query Frame = 2
Query:  260 KNTNGIIEKEARLNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERINKVLD 664
            +  +G   K  +++LQLWDTAGQERF+SLT +FFRDAMGFLL+FDLT + SF+N+R+WM  L+ N+Y ENPDIVL+GNK+DL  +R ++   A ELA+++ +PY ETSA++G+NVEK+ +TL++L+M+R+ K ++
Sbjct:   56 QGADGASGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELAEKYGIPYFETSAATGQNVEKSVETLLDLIMKRMEKCVE 190          

HSP 2 Score: 70.0922 bits (170), Expect = 1.478e-57
Identity = 33/49 (67.35%), Postives = 38/49 (77.55%), Query Frame = 1
Query:  106 DYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRVIY 252
            DYDYLIKLLALGDS VGKT  L RY DN +   F  TVG+DF++KRV+Y
Sbjct:    5 DYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVY 53          
BLAST of ras-related protein Rab-27A vs. UniProt/SwissProt
Match: sp|O00194|RB27B_HUMAN (Ras-related protein Rab-27B OS=Homo sapiens OX=9606 GN=RAB27B PE=1 SV=4)

HSP 1 Score: 174.866 bits (442), Expect = 1.674e-57
Identity = 75/135 (55.56%), Postives = 108/135 (80.00%), Query Frame = 2
Query:  260 KNTNGIIEKEARLNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERINKVLD 664
            +  NG   K  +++LQLWDTAGQERF+SLT +FFRDAMGFLL+FDLT + SF+N+R+WM  L+ N+Y ENPDIVL+GNK+DL  +R ++   A ELA ++ +PY ETSA++G+NVEKA +TL++L+M+R+ + ++
Sbjct:   56 QGPNGSSGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVE 190          

HSP 2 Score: 70.0922 bits (170), Expect = 1.674e-57
Identity = 33/49 (67.35%), Postives = 38/49 (77.55%), Query Frame = 1
Query:  106 DYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRVIY 252
            DYDYLIKLLALGDS VGKT  L RY DN +   F  TVG+DF++KRV+Y
Sbjct:    5 DYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVY 53          
BLAST of ras-related protein Rab-27A vs. UniProt/SwissProt
Match: sp|Q8HZJ5|RB27B_BOVIN (Ras-related protein Rab-27B OS=Bos taurus OX=9913 GN=RAB27B PE=2 SV=3)

HSP 1 Score: 175.637 bits (444), Expect = 1.960e-57
Identity = 74/135 (54.81%), Postives = 110/135 (81.48%), Query Frame = 2
Query:  260 KNTNGIIEKEARLNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERINKVLD 664
            +  NG   K  +++LQLWDTAGQERF+SLT +FFRDAMGFLL+FDLT + SF+N+R+WM  L+ N+Y ENPDIVL+GNK+DL  +R ++   A +LA+++++PY ETSA++G+NVEKA +TL++L+M+R+ + ++
Sbjct:   56 QGPNGPTGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARDLAEKYSIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVE 190          

HSP 2 Score: 69.3218 bits (168), Expect = 1.960e-57
Identity = 33/49 (67.35%), Postives = 37/49 (75.51%), Query Frame = 1
Query:  106 DYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRVIY 252
            DYDYLIKLLALGDS VGKT  L RY DN +   F  TVG+DF++KRV Y
Sbjct:    5 DYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVAY 53          
BLAST of ras-related protein Rab-27A vs. UniProt/SwissProt
Match: sp|Q99P74|RB27B_RAT (Ras-related protein Rab-27B OS=Rattus norvegicus OX=10116 GN=Rab27b PE=2 SV=3)

HSP 1 Score: 173.326 bits (438), Expect = 5.477e-57
Identity = 74/135 (54.81%), Postives = 109/135 (80.74%), Query Frame = 2
Query:  260 KNTNGIIEKEARLNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERINKVLD 664
            +  +G   K  +++LQLWDTAGQERF+SLT +FFRDAMGFLL+FDLT + SF+N+R+WM  L+ N+Y ENPDIVL+GNK+DL  +R ++   A ELA+++ +PY ETSA++G+NVEK+ +TL++L+M+R+ K ++
Sbjct:   56 QGADGSSGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLLDQREVNERQARELAEKYGIPYFETSAATGQNVEKSVETLLDLIMKRMEKCVE 190          

HSP 2 Score: 70.0922 bits (170), Expect = 5.477e-57
Identity = 33/49 (67.35%), Postives = 38/49 (77.55%), Query Frame = 1
Query:  106 DYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRVIY 252
            DYDYLIKLLALGDS VGKT  L RY DN +   F  TVG+DF++KRV+Y
Sbjct:    5 DYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVY 53          
BLAST of ras-related protein Rab-27A vs. UniProt/SwissProt
Match: sp|Q4LE85|RB27A_PIG (Ras-related protein Rab-27A OS=Sus scrofa OX=9823 GN=RAB27A PE=2 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 1.013e-55
Identity = 75/132 (56.82%), Postives = 107/132 (81.06%), Query Frame = 2
Query:  269 NGIIEKEARLNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERINKVLD 664
            +G I +  R++LQLWDTAGQERF+SLT +FFRDAMGFLL+FDLT+E SF+N+R+W+  L++++Y ENPDIVL GNKSDL  +RV+  E A  LA+++ +PY ETSA++G NV  A +TL++L+M+R+ + +D
Sbjct:   59 DGAIGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEARGLAEKYGIPYFETSAANGTNVSLAIETLLDLIMKRMERCVD 190          

HSP 2 Score: 65.4698 bits (158), Expect = 1.013e-55
Identity = 30/49 (61.22%), Postives = 37/49 (75.51%), Query Frame = 1
Query:  106 DYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRVIY 252
            DYDYLIK LALGDS VGKT +L +Y D  +   F  TVG+DF++KRV+Y
Sbjct:    5 DYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVY 53          
BLAST of ras-related protein Rab-27A vs. TrEMBL
Match: A0A0P7V199 (Ras-related protein Rab-27B-like OS=Scleropages formosus OX=113540 GN=Z043_104246 PE=4 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 1.274e-57
Identity = 76/134 (56.72%), Postives = 106/134 (79.10%), Query Frame = 2
Query:  263 NTNGIIEKEARLNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERINKVLD 664
            + NG   K  +++LQLWDTAGQERF+SLT +FFRDAMGFLL+FDLT + SF+N+R+WM  L+ N+Y ENPDIVLVGNK+DL+ +R +  + A ELA ++ +PY ETSA++G  V+KA  TL++LVM+R+ + +D
Sbjct:   81 SPNGTTGKTFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLVGNKADLADQREVQEKQAKELADKYGIPYFETSAATGSEVDKAVITLLDLVMKRMEQCVD 214          

HSP 2 Score: 78.9518 bits (193), Expect = 1.274e-57
Identity = 39/68 (57.35%), Postives = 50/68 (73.53%), Query Frame = 1
Query:   55 NLSFIS-IMTNSSTAGNDDYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRVIYT 255
            N++F+  ++T  ST  + DYDYLIKLLALGDS VGKT  L RY DN +   F  TVG+DF++KRV+YT
Sbjct:   11 NIAFLEKVLTAVSTMTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYT 78          
BLAST of ras-related protein Rab-27A vs. TrEMBL
Match: A0A402FD92 (Uncharacterized protein OS=Paroedura picta OX=143630 GN=parPi_0016506 PE=4 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 3.655e-57
Identity = 75/135 (55.56%), Postives = 111/135 (82.22%), Query Frame = 2
Query:  260 KNTNGIIEKEARLNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERINKVLD 664
            + TNG   K  +++LQLWDTAGQERF+SLT +FFRDAMGFLL+FDLT + SF+N+R+WM  L+ N+Y ENPDIVL+GNK+DLS +R ++ + A +LA ++ +PY ETSA++G+N++KA +TL++L+M+R+ + +D
Sbjct:   67 RGTNGSPGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLSDQREVNEKQAKDLADKYGIPYFETSAATGQNIDKAVETLLDLIMKRMEQCVD 201          

HSP 2 Score: 72.7886 bits (177), Expect = 3.655e-57
Identity = 37/65 (56.92%), Postives = 45/65 (69.23%), Query Frame = 1
Query:   67 ISIMTNSSTAGNDDYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRVIYTPK 261
            +SIMT+       DYDYLIKLLALGDS VGKT  L RY DN +   F  TVG+DF++KRV+Y  +
Sbjct:    9 VSIMTDG------DYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNSR 67          
BLAST of ras-related protein Rab-27A vs. TrEMBL
Match: A0A2D4KLG2 (Uncharacterized protein (Fragment) OS=Micrurus paraensis OX=1970185 PE=4 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 4.833e-57
Identity = 76/127 (59.84%), Postives = 106/127 (83.46%), Query Frame = 2
Query:  284 KEARLNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERINKVLD 664
            K  +++LQLWDTAGQERF+SLT +FFRDAMGFLL+FDLT + SF+N+R+WM  L+ N+Y ENPDIVL+GNK+DLS +R ++   A ELA ++ +PY ETSA+SG+NVEKA +TL++L+M+R+ + +D
Sbjct:  108 KAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLSDQREVNERQAKELADKYGIPYFETSAASGQNVEKAVETLLDLIMKRMEQCVD 234          

HSP 2 Score: 73.559 bits (179), Expect = 4.833e-57
Identity = 35/55 (63.64%), Postives = 42/55 (76.36%), Query Frame = 1
Query:   88 STAGNDDYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRVIY 252
            ST  + DYDYLIKLLALGDS VGKT +L RY DN +   F  TVG+DF++KRV+Y
Sbjct:   43 STMTDGDYDYLIKLLALGDSGVGKTTLLYRYTDNKFNPKFITTVGIDFREKRVVY 97          
BLAST of ras-related protein Rab-27A vs. TrEMBL
Match: A0A2D4NQ51 (Uncharacterized protein (Fragment) OS=Micrurus surinamensis OX=129470 PE=4 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 5.199e-57
Identity = 76/127 (59.84%), Postives = 106/127 (83.46%), Query Frame = 2
Query:  284 KEARLNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERINKVLD 664
            K  +++LQLWDTAGQERF+SLT +FFRDAMGFLL+FDLT + SF+N+R+WM  L+ N+Y ENPDIVL+GNK+DLS +R ++   A ELA ++ +PY ETSA+SG+NVEKA +TL++L+M+R+ + +D
Sbjct:  140 KAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLSDQREVNERQAKELADKYGIPYFETSAASGQNVEKAVETLLDLIMKRMEQCVD 266          

HSP 2 Score: 73.559 bits (179), Expect = 5.199e-57
Identity = 35/55 (63.64%), Postives = 42/55 (76.36%), Query Frame = 1
Query:   88 STAGNDDYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRVIY 252
            ST  + DYDYLIKLLALGDS VGKT +L RY DN +   F  TVG+DF++KRV+Y
Sbjct:   75 STMTDGDYDYLIKLLALGDSGVGKTTLLYRYTDNKFNPKFITTVGIDFREKRVVY 129          
BLAST of ras-related protein Rab-27A vs. TrEMBL
Match: A0A5F8GU64 (RAB27B, member RAS oncogene family OS=Monodelphis domestica OX=13616 GN=RAB27B PE=4 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 9.246e-57
Identity = 75/135 (55.56%), Postives = 109/135 (80.74%), Query Frame = 2
Query:  260 KNTNGIIEKEARLNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERINKVLD 664
            +  NG   K  +++LQLWDTAGQERF+SLT +FFRDAMGFLL+FDLT + SF+N+R+WM  L+ N+Y ENPDIVL+GNK+DLS +R ++ + A +LA ++ +PY ETSA++G+NVEKA  TL++L+M+R+ + ++
Sbjct:   71 RGPNGTPGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLSDQREVNEQQARDLADKYGIPYFETSAATGQNVEKAVDTLLDLIMKRMEQCVE 205          

HSP 2 Score: 73.1738 bits (178), Expect = 9.246e-57
Identity = 38/62 (61.29%), Postives = 44/62 (70.97%), Query Frame = 1
Query:   67 ISIMTNSSTAGNDDYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRVIY 252
            ISIMT+       DYDYLIKLLALGDS VGKT  L RY DN +   F  TVG+DF++KRV+Y
Sbjct:   13 ISIMTDG------DYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVY 68          
BLAST of ras-related protein Rab-27A vs. Ensembl Cavefish
Match: rab27b (RAB27B, member RAS oncogene family [Source:NCBI gene;Acc:103022885])

HSP 1 Score: 173.711 bits (439), Expect = 3.484e-58
Identity = 75/132 (56.82%), Postives = 105/132 (79.55%), Query Frame = 2
Query:  269 NGIIEKEARLNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERINKVLD 664
            NG   K  +++LQLWDTAGQERF+SLT +FFRDAMGFLL+FDLT + SF+N+R+WM  L+ N+Y ENPDIVLVGNK+DL+ +R +  + A ELA ++ +PY ETSA++G  V+KA  TL++LVM+R+ + ++
Sbjct:   59 NGTTGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLVGNKADLADQREVQEKQAKELADKYGIPYFETSAATGAQVDKAVVTLLDLVMKRMEQCVE 190          

HSP 2 Score: 71.2478 bits (173), Expect = 3.484e-58
Identity = 33/50 (66.00%), Postives = 39/50 (78.00%), Query Frame = 1
Query:  106 DYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRVIYT 255
            DYDYLIKLLALGDS VGKT  L RY DN +   F  TVG+DF++KRV+Y+
Sbjct:    5 DYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYS 54          
BLAST of ras-related protein Rab-27A vs. Ensembl Cavefish
Match: rab27a (RAB27A, member RAS oncogene family [Source:NCBI gene;Acc:103047190])

HSP 1 Score: 174.481 bits (441), Expect = 1.785e-56
Identity = 73/134 (54.48%), Postives = 107/134 (79.85%), Query Frame = 2
Query:  263 NTNGIIEKEARLNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERINKVLD 664
              +G   +  R+++QLWDTAGQERF+SLT +FFRDAMGFLL+FDL++E SF+N+R+WM  L++++Y ENPDIVL GNK DL  +R +S E A ELA+++ +PY ETSA++GENV +A + L++L+M+R+ + +D
Sbjct:   57 GPDGTPGRGQRIHIQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLSNEQSFLNVRNWMSQLQMHAYCENPDIVLCGNKCDLEDQRAVSEEEARELAEKYGIPYFETSAANGENVSRAVEVLLDLIMKRMERCVD 190          

HSP 2 Score: 64.3142 bits (155), Expect = 1.785e-56
Identity = 30/49 (61.22%), Postives = 36/49 (73.47%), Query Frame = 1
Query:  106 DYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRVIY 252
            DYDYLIK LALGDS VGKT  L +Y D  +   F  TVG+DF++KRV+Y
Sbjct:    5 DYDYLIKFLALGDSGVGKTSFLYQYTDGKFNSKFITTVGIDFREKRVVY 53          
BLAST of ras-related protein Rab-27A vs. Ensembl Cavefish
Match: rab27a (RAB27A, member RAS oncogene family [Source:NCBI gene;Acc:103047190])

HSP 1 Score: 174.481 bits (441), Expect = 1.785e-56
Identity = 73/134 (54.48%), Postives = 107/134 (79.85%), Query Frame = 2
Query:  263 NTNGIIEKEARLNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERINKVLD 664
              +G   +  R+++QLWDTAGQERF+SLT +FFRDAMGFLL+FDL++E SF+N+R+WM  L++++Y ENPDIVL GNK DL  +R +S E A ELA+++ +PY ETSA++GENV +A + L++L+M+R+ + +D
Sbjct:   57 GPDGTPGRGQRIHIQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLSNEQSFLNVRNWMSQLQMHAYCENPDIVLCGNKCDLEDQRAVSEEEARELAEKYGIPYFETSAANGENVSRAVEVLLDLIMKRMERCVD 190          

HSP 2 Score: 64.3142 bits (155), Expect = 1.785e-56
Identity = 30/49 (61.22%), Postives = 36/49 (73.47%), Query Frame = 1
Query:  106 DYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRVIY 252
            DYDYLIK LALGDS VGKT  L +Y D  +   F  TVG+DF++KRV+Y
Sbjct:    5 DYDYLIKFLALGDSGVGKTSFLYQYTDGKFNSKFITTVGIDFREKRVVY 53          
BLAST of ras-related protein Rab-27A vs. Ensembl Cavefish
Match: rab1ab (ras-related protein Rab-1A [Source:NCBI gene;Acc:103035225])

HSP 1 Score: 122.479 bits (306), Expect = 1.432e-39
Identity = 54/120 (45.00%), Postives = 88/120 (73.33%), Query Frame = 2
Query:  296 LNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSY-SENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERIN 652
            + LQ+WDTAGQERF+++T S++R A G ++V+D+TD+ SF N++ W++  +I+ Y SEN + +LVGNK DL++++V+ + TA E A    +P+LETSA +  NVE+AF T+   + +R+ 
Sbjct:   57 IKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQ--EIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMG 174          

HSP 2 Score: 60.077 bits (144), Expect = 1.432e-39
Identity = 26/49 (53.06%), Postives = 37/49 (75.51%), Query Frame = 1
Query:  100 NDDYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRV 246
            N +YDYL KLL +GDS VGK+C+L R+ D+ YT  + +T+GVDFK + +
Sbjct:    2 NPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTI 50          
BLAST of ras-related protein Rab-27A vs. Ensembl Cavefish
Match: zgc:171927 (ras-related protein ORAB-1-like [Source:NCBI gene;Acc:103045400])

HSP 1 Score: 119.783 bits (299), Expect = 5.110e-39
Identity = 57/127 (44.88%), Postives = 91/127 (71.65%), Query Frame = 2
Query:  278 IEKEARL-NLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYS-ENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERIN 652
            IE + ++  LQ+WDTAGQERF+++T S++R A G ++V+D+TD+ SF N++ W+   +I+ Y+ EN   +LVGNKSDL+S++V+   TA E A+   +P+LE+SA +  NVEKAF T+   + +R+ 
Sbjct:   50 IEMDGKIVKLQIWDTAGQERFRTITSSYYRGAHGIIIVYDVTDQESFNNLKQWLE--EIDRYACENVSKLLVGNKSDLTSKKVVDFTTAKEFAEPLKIPFLESSAKNASNVEKAFLTMASEIQKRLG 174          

HSP 2 Score: 60.4622 bits (145), Expect = 5.110e-39
Identity = 26/49 (53.06%), Postives = 37/49 (75.51%), Query Frame = 1
Query:  100 NDDYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRV 246
            N +YDYL KLL +GDS VGK+C+L R+ D+ YT  + +T+GVDFK + +
Sbjct:    2 NPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTI 50          
BLAST of ras-related protein Rab-27A vs. Ensembl Sea Lamprey
Match: rab27a (RAB27A, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-050913-46])

HSP 1 Score: 159.844 bits (403), Expect = 3.642e-51
Identity = 70/135 (51.85%), Postives = 103/135 (76.30%), Query Frame = 2
Query:  260 KNTNGIIEKEARLNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERINKVLD 664
            +  +G  ++  R++LQLWDTAGQERF+SLT +FFRDAMGFL++FDLT E +F+N+R+W+  L++++Y E+PDIVL GNKSDLS    I+ + A E A++  +PY ETSA +G NV  A +TL+ L+M+R+ + +D
Sbjct:   56 EGADGTAKQTKRVHLQLWDTAGQERFRSLTTAFFRDAMGFLVIFDLTSEQTFLNVRNWLNQLQMHAYCESPDIVLCGNKSDLSEHN-ITQKQAKEFAEKHGMPYFETSARTGNNVVPAVETLLGLIMKRMERCID 189          

HSP 2 Score: 58.9214 bits (141), Expect = 3.642e-51
Identity = 27/50 (54.00%), Postives = 37/50 (74.00%), Query Frame = 1
Query:  106 DYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRVIYT 255
            +YDYLIKLL LGDS VGK+ +L +Y +  +   +  TVG+DF++KRV YT
Sbjct:    5 EYDYLIKLLVLGDSGVGKSSLLCQYTEGRFHDKYITTVGIDFREKRVTYT 54          
BLAST of ras-related protein Rab-27A vs. Ensembl Sea Lamprey
Match: rab27a (RAB27A, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-050913-46])

HSP 1 Score: 158.688 bits (400), Expect = 1.835e-48
Identity = 66/120 (55.00%), Postives = 95/120 (79.17%), Query Frame = 2
Query:  293 RLNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERIN 652
            +++LQLWDTAGQ RF+SLT +FFRDAMGF + FD+TDE SF+N+R WM +L+ ++Y  +PD+VL GNK+DL+ +R +  + AL LA E+ +PY+ETSA++GENV +A + L+E VM R+ 
Sbjct:   16 KIHLQLWDTAGQRRFRSLTNAFFRDAMGFFVFFDITDEQSFVNVRHWMVVLQHHAYCPSPDVVLCGNKADLTEQRAVGEDDALSLASEYGMPYVETSAATGENVARAVELLLERVMRRVQ 135          
BLAST of ras-related protein Rab-27A vs. Ensembl Sea Lamprey
Match: rab1aa (RAB1A, member RAS oncogene family a [Source:ZFIN;Acc:ZDB-GENE-090312-110])

HSP 1 Score: 122.094 bits (305), Expect = 3.732e-40
Identity = 54/120 (45.00%), Postives = 88/120 (73.33%), Query Frame = 2
Query:  296 LNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSY-SENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERIN 652
            + LQ+WDTAGQERF+++T S++R A G ++V+D+TD+ SF N++ W++  +I+ Y SEN + +LVGNK DL++++V+ + TA E A    +P+LETSA +  NVE+AF T+   + +R+ 
Sbjct:   60 IKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQ--EIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLEIPFLETSAKNATNVEQAFMTMAAEIKKRMG 177          

HSP 2 Score: 60.077 bits (144), Expect = 3.732e-40
Identity = 26/49 (53.06%), Postives = 37/49 (75.51%), Query Frame = 1
Query:  100 NDDYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRV 246
            N +YDYL KLL +GDS VGK+C+L R+ D+ YT  + +T+GVDFK + +
Sbjct:    5 NPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTI 53          
BLAST of ras-related protein Rab-27A vs. Ensembl Sea Lamprey
Match: rab3c (RAB3C, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-040718-263])

HSP 1 Score: 118.242 bits (295), Expect = 2.102e-38
Identity = 50/129 (38.76%), Postives = 89/129 (68.99%), Query Frame = 2
Query:  275 IIEKEARLNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERINKVL 661
            +   E R+ LQ+WDTAGQER++++T +++R AMGF+L++D+T+E+SF  + DW   +K  S+ +N  +VLVGNK D+   R++  E   +LA++    + ETSA    NV++ F+ L++++ E++++ L
Sbjct:   71 VYRNEKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEDSFNAVSDWSTQIKTYSW-DNAQVVLVGNKCDMEDDRMVPTEQGRQLAEQLGFEFFETSAKDNINVKQTFERLVDVICEKMSESL 198          

HSP 2 Score: 57.7658 bits (138), Expect = 2.102e-38
Identity = 29/59 (49.15%), Postives = 40/59 (67.80%), Query Frame = 1
Query:   94 AGNDDYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRVIYTPKKHK 270
            A + ++DY+ KLL +G+SSVGKT  L RY D ++T  F +TVG+DFK K V    K+ K
Sbjct:   21 AADQNFDYMFKLLIIGNSSVGKTSFLFRYADESFTSAFVSTVGIDFKVKTVYRNEKRIK 79          
BLAST of ras-related protein Rab-27A vs. Ensembl Sea Lamprey
Match: rab8a (RAB8A, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-070424-36])

HSP 1 Score: 114.005 bits (284), Expect = 9.111e-37
Identity = 50/124 (40.32%), Postives = 92/124 (74.19%), Query Frame = 2
Query:  293 RLNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERINKVLD 664
            ++ LQ+WDTAGQERF+++T +++R AMG +LV+D+T+E SF NI++W+R ++ ++ S + + +++GNK D++ RR ++ E   +LA E+ + ++ETSA +  NVE+AF TL   +  ++++ L+
Sbjct:   56 KIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFENIKNWIRNIEEHA-SADVEKMILGNKCDMNERRQVTRERGEKLAIEYGIKFMETSAKASINVEEAFFTLARDIKAKMDRKLE 178          

HSP 2 Score: 56.6102 bits (135), Expect = 9.111e-37
Identity = 27/54 (50.00%), Postives = 38/54 (70.37%), Query Frame = 1
Query:  109 YDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRVIYTPKKHK 270
            YDYL KLL +GDS VGKTC+L R+ ++A+   F +T+G+DFK + +    KK K
Sbjct:    5 YDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIDLDGKKIK 58          
BLAST of ras-related protein Rab-27A vs. Ensembl Yeast
Match: SEC4 (Rab family GTPase; essential for vesicle-mediated exocytic secretion and autophagy; associates with the exocyst component Sec15p and may regulate polarized delivery of transport vesicles to the exocyst at the plasma membrane [Source:SGD;Acc:S000001889])

HSP 1 Score: 118.242 bits (295), Expect = 3.889e-38
Identity = 53/120 (44.17%), Postives = 88/120 (73.33%), Query Frame = 2
Query:  293 RLNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERIN 652
            ++ LQLWDTAGQERF+++T +++R AMG +LV+D+TDE +F NI+ W + +  ++  E   ++LVGNKSD+ + RV++ +    LAKE  +P++E+SA + +NV + F TL +L+ E+I+
Sbjct:   68 KVKLQLWDTAGQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHANDE-AQLLLVGNKSDMET-RVVTADQGEALAKELGIPFIESSAKNDDNVNEIFFTLAKLIQEKID 185          

HSP 2 Score: 56.225 bits (134), Expect = 3.889e-38
Identity = 28/68 (41.18%), Postives = 45/68 (66.18%), Query Frame = 1
Query:   70 SIMTNSSTAGND-DYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRVIYTPKKHK 270
             + T S+++GN   YD ++K+L +GDS VGK+C+L R++++ +   F  T+G+DFK K V    KK K
Sbjct:    3 GLRTVSASSGNGKSYDSIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVK 70          
BLAST of ras-related protein Rab-27A vs. Ensembl Yeast
Match: YPT1 (Rab family GTPase; involved in the ER-to-Golgi step of the secretory pathway; complex formation with the Rab escort protein Mrs6p is required for prenylation of Ypt1p by type II protein geranylgeranyltransferase (Bet2p-Bet4p); binds to unspliced HAC1 mRNA; regulates the unfolded protein response (UPR) by promoting the decay of HAC1 RNA; localizes to the early Golgi, the transitional Golgi and ER membranes, pre-autophagosomal structures, and cytoplasmic vesicles [Source:SGD;Acc:S000001856])

HSP 1 Score: 104.76 bits (260), Expect = 2.589e-35
Identity = 49/121 (40.50%), Postives = 83/121 (68.60%), Query Frame = 2
Query:  296 LNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDI-VLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERINK 655
            + LQ+WDTAGQERF+++T S++R + G ++V+D+TD+ SF  ++ W++  +I+ Y+ +  + +LVGNK DL  +RV+ ++ A E A    +P+LETSA    NVE AF T+   + E +++
Sbjct:   57 VKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQ--EIDRYATSTVLKLLVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMSQ 175          

HSP 2 Score: 60.4622 bits (145), Expect = 2.589e-35
Identity = 28/49 (57.14%), Postives = 38/49 (77.55%), Query Frame = 1
Query:  100 NDDYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRV 246
            N +YDYL KLL +G+S VGK+C+L R+ D+ YT D+ +T+GVDFK K V
Sbjct:    2 NSEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTV 50          
BLAST of ras-related protein Rab-27A vs. Ensembl Yeast
Match: YPT31 (Rab family GTPase; involved in the exocytic pathway; mediates intra-Golgi traffic or the budding of post-Golgi vesicles from the trans-Golgi; YPT31 has a paralog, YPT32, that arose from the whole genome duplication; localizes to the transitional and late Golgi [Source:SGD;Acc:S000000833])

HSP 1 Score: 103.605 bits (257), Expect = 2.204e-30
Identity = 47/121 (38.84%), Postives = 83/121 (68.60%), Query Frame = 2
Query:  293 RLNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERINK 655
            R+  Q+WDTAGQER++++T +++R A+G L+V+D++  +S+ N   W+  L+ N+  +N  + L+GNKSDL+  R +  E +   A+E  + + ETSA + ENV+KAF+ LI  + ++++K
Sbjct:   61 RIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLSELRENA-DDNVAVGLIGNKSDLAHLRAVPTEESKTFAQENQLLFTETSALNSENVDKAFEELINTIYQKVSK 180          

HSP 2 Score: 45.0542 bits (105), Expect = 2.204e-30
Identity = 21/55 (38.18%), Postives = 34/55 (61.82%), Query Frame = 1
Query:  106 DYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRVIYTPKKHK 270
            DYD L K++ +GDS VGK+ +L R+  N +  D  +T+GV+F  + +    K+ K
Sbjct:    9 DYDLLFKIVLIGDSGVGKSNLLSRFTKNEFNMDSKSTIGVEFATRTLEIDGKRIK 63          
BLAST of ras-related protein Rab-27A vs. Ensembl Yeast
Match: YPT32 (Rab family GTPase involved in the exocytic pathway; mediates intra-Golgi traffic or the budding of post-Golgi vesicles from the trans-Golgi; protein abundance increases in response to DNA replication stress; YPT32 has a paralog, YPT31, that arose from the whole genome duplication [Source:SGD;Acc:S000003178])

HSP 1 Score: 97.0561 bits (240), Expect = 1.711e-28
Identity = 45/121 (37.19%), Postives = 81/121 (66.94%), Query Frame = 2
Query:  293 RLNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERINK 655
            ++  Q+WDTAGQER++++T +++R A+G L+V+D++  +S+ N   W+  L+ N+  +N  + L+GNKSDL+  R +  + A   A E  + + ETSA + +NV+KAF+ LI  + + ++K
Sbjct:   61 KIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENA-DDNVAVGLIGNKSDLAHLRAVPTDEAKNFAMENQMLFTETSALNSDNVDKAFRELIVAIFQMVSK 180          

HSP 2 Score: 45.4394 bits (106), Expect = 1.711e-28
Identity = 21/55 (38.18%), Postives = 35/55 (63.64%), Query Frame = 1
Query:  106 DYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRVIYTPKKHK 270
            DYDYL K++ +GDS VGK+ +L R+  + +  +  +T+GV+F  + +    KK K
Sbjct:    9 DYDYLFKIVLIGDSGVGKSNLLSRFTTDEFNIESKSTIGVEFATRTIEVENKKIK 63          
BLAST of ras-related protein Rab-27A vs. Ensembl Yeast
Match: YPT7 (Rab family GTPase; GTP-binding protein of the rab family; required for homotypic fusion event in vacuole inheritance, for endosome-endosome fusion; localizes to sites of contact between the vacuole and mitochondria (vCLAMPs); interacts with the cargo selection/retromer complex for retrograde sorting; similar to mammalian Rab7 [Source:SGD;Acc:S000004460])

HSP 1 Score: 88.5817 bits (218), Expect = 2.647e-26
Identity = 46/120 (38.33%), Postives = 79/120 (65.83%), Query Frame = 2
Query:  302 LQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDI---VLVGNKSDL-SSRRVISHETALELAKEF-NVPYLETSASSGENVEKAFQTLIELVMER 646
            +Q+WDTAGQERF+SL V+F+R A   +LV+D+T+ +SF NI+ W     +++   +P+    V++GNK D   S++++S ++A ELAK   ++P   TSA +  NV+ AF+ +    +++
Sbjct:   60 MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVNSPETFPFVILGNKIDAEESKKIVSEKSAQELAKSLGDIPLFLTSAKNAINVDTAFEEIARSALQQ 179          

HSP 2 Score: 46.2098 bits (108), Expect = 2.647e-26
Identity = 18/43 (41.86%), Postives = 31/43 (72.09%), Query Frame = 1
Query:  118 LIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRV 246
            ++K++ LGDS VGKT ++ RY+++ Y++ +  T+G DF  K V
Sbjct:    8 ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEV 50          
BLAST of ras-related protein Rab-27A vs. Ensembl Nematostella
Match: EDO49958 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RER3])

HSP 1 Score: 156.377 bits (394), Expect = 3.996e-53
Identity = 71/124 (57.26%), Postives = 94/124 (75.81%), Query Frame = 2
Query:  293 RLNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERINKVLD 664
            R++LQLWDTAGQERF+SLT +FFRDAMGFLLVFDLT E SF+NIR+W+  L+ ++Y ENPDIVL+GNK+DL   RV+    A  LA    + Y ETSA++G+NV K+ + L++ VM R+   +D
Sbjct:   70 RIHLQLWDTAGQERFRSLTTAFFRDAMGFLLVFDLTHEQSFVNIRNWLSQLQTHAYCENPDIVLLGNKADLEDDRVVDEAEARALADNLGLKYFETSAATGQNVTKSVEALLDQVMVRMENCVD 193          

HSP 2 Score: 69.707 bits (169), Expect = 3.996e-53
Identity = 31/51 (60.78%), Postives = 40/51 (78.43%), Query Frame = 1
Query:  106 DYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRVIYTP 258
            DYDYLIK LALGDS VGKT IL +Y D ++   F +TVG+DF++KRV++ P
Sbjct:    7 DYDYLIKFLALGDSGVGKTSILYQYTDESFNPKFISTVGIDFREKRVVHHP 57          
BLAST of ras-related protein Rab-27A vs. Ensembl Nematostella
Match: EDO28309 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6U5])

HSP 1 Score: 149.828 bits (377), Expect = 4.007e-51
Identity = 68/115 (59.13%), Postives = 89/115 (77.39%), Query Frame = 2
Query:  293 RLNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELV 637
            R++LQLWDTAGQERF+SLT +FFRDAMGFLLVFDLT E SF+NIR+W+  L+ ++Y ENPDIVL+GNK+DL   RV+    A  LA    + Y ETSA++G+NV K+ + L++ V
Sbjct:   70 RIHLQLWDTAGQERFRSLTTAFFRDAMGFLLVFDLTHEQSFVNIRNWLSQLQTHAYCENPDIVLLGNKADLEDDRVVDEAEARALADNLGLKYFETSAATGQNVTKSVEALLDQV 184          

HSP 2 Score: 69.707 bits (169), Expect = 4.007e-51
Identity = 31/51 (60.78%), Postives = 40/51 (78.43%), Query Frame = 1
Query:  106 DYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRVIYTP 258
            DYDYLIK LALGDS VGKT IL +Y D ++   F +TVG+DF++KRV++ P
Sbjct:    7 DYDYLIKFLALGDSGVGKTSILYQYTDESFNPKFISTVGIDFREKRVVHHP 57          
BLAST of ras-related protein Rab-27A vs. Ensembl Nematostella
Match: EDO34944 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMW8])

HSP 1 Score: 123.635 bits (309), Expect = 1.499e-39
Identity = 50/130 (38.46%), Postives = 92/130 (70.77%), Query Frame = 2
Query:  275 IIEKEARLNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERINKVLD 664
            +   + R+ LQ+WDTAGQER++++T +++R AMGF+L++D+T+E SF  ++DW   +K  S++ N  ++LVGNK D+   RV+S++   +LA +  + + ETSA    NV+K F+ L++++ +++++ LD
Sbjct:   63 VFRNDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFQAVQDWSTQVKTYSWA-NAQVILVGNKCDMEEERVVSYDRGKQLADQLGLEFYETSAKDNTNVKKVFERLVDIICDKMSQSLD 191          

HSP 2 Score: 56.9954 bits (136), Expect = 1.499e-39
Identity = 28/59 (47.46%), Postives = 41/59 (69.49%), Query Frame = 1
Query:   94 AGNDDYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRVIYTPKKHK 270
            A + ++DY+ KLL +G+S+VGKT  L RY D+++T  F +TVG+DFK K V    K+ K
Sbjct:   13 AADQNFDYMFKLLIIGNSAVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRNDKRVK 71          
BLAST of ras-related protein Rab-27A vs. Ensembl Nematostella
Match: EDO40167 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S806])

HSP 1 Score: 119.783 bits (299), Expect = 2.506e-39
Identity = 54/120 (45.00%), Postives = 87/120 (72.50%), Query Frame = 2
Query:  296 LNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYS-ENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERIN 652
            + LQ+WDTAGQERF+++T S++R A G ++V+D+TD+ SF N++ W++  +I+ Y+ EN + +LVGNK DL++++V+   TA E A+   VP+LETSA +  NVE+AF T+   +  R+ 
Sbjct:   60 IKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQ--EIDRYACENVNKLLVGNKCDLTTKKVVDFTTAKEYAESLGVPFLETSAKNATNVEQAFMTMAAEIKNRMG 177          

HSP 2 Score: 60.077 bits (144), Expect = 2.506e-39
Identity = 26/49 (53.06%), Postives = 37/49 (75.51%), Query Frame = 1
Query:  100 NDDYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRV 246
            N +YDYL KLL +GDS VGK+C+L R+ D+ YT  + +T+GVDFK + +
Sbjct:    5 NPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTI 53          
BLAST of ras-related protein Rab-27A vs. Ensembl Nematostella
Match: EDO47471 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMA6])

HSP 1 Score: 116.316 bits (290), Expect = 4.635e-38
Identity = 49/118 (41.53%), Postives = 87/118 (73.73%), Query Frame = 2
Query:  293 RLNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMER 646
            ++ LQ+WDTAGQERF ++T S++R AMG +LV+D+T E +F NI  W+R ++ ++ +E+ + +++GNK D+  RR++S E   ++A+E  + +LETSA +  N+E+AFQ L + ++++
Sbjct:   57 KIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITQEKTFDNISKWLRNIEEHA-NEDVEKMILGNKCDMDDRRIVSRERGEQIAREHGIRFLETSAKTNINIEQAFQYLAQDILKK 173          

HSP 2 Score: 59.3066 bits (142), Expect = 4.635e-38
Identity = 30/54 (55.56%), Postives = 38/54 (70.37%), Query Frame = 1
Query:  109 YDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRVIYTPKKHK 270
            YDYL KLL +GDS VGKTCIL R+ D+A+   F +T+G+DFK K +    KK K
Sbjct:    6 YDYLFKLLLIGDSGVGKTCILFRFSDDAFNTTFISTIGIDFKIKTIEMQGKKIK 59          
BLAST of ras-related protein Rab-27A vs. Ensembl Medaka
Match: rab27b (RAB27B, member RAS oncogene family [Source:NCBI gene;Acc:101161176])

HSP 1 Score: 170.244 bits (430), Expect = 1.539e-57
Identity = 77/137 (56.20%), Postives = 105/137 (76.64%), Query Frame = 2
Query:  254 PQKNTNGIIEKEARLNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERINKVLD 664
            P   T G   K  +++LQLWDTAGQERF+SLT +FFRDAMGFLL+FDLT + SF+N+R+WM  L+ N+Y ENPDIVLVGNK DL+ +R +  + A ELA ++ +PY ETSA++G  V+KA  TL++LVM+R+ + +D
Sbjct:   58 PNGTTTG---KTFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLVGNKVDLADQREVQEKQAKELADKYGIPYFETSAATGAEVDKAVITLLDLVMKRMEQCVD 191          

HSP 2 Score: 72.0182 bits (175), Expect = 1.539e-57
Identity = 34/50 (68.00%), Postives = 39/50 (78.00%), Query Frame = 1
Query:  106 DYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRVIYT 255
            DYDYLIKLLALGDS VGKT  L RY DN +   F  TVG+DF++KRV+YT
Sbjct:    5 DYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYT 54          
BLAST of ras-related protein Rab-27A vs. Ensembl Medaka
Match: ENSORLT00000000515.2 (ras-related protein Rab-27B [Source:NCBI gene;Acc:101172416])

HSP 1 Score: 160.999 bits (406), Expect = 1.677e-55
Identity = 70/131 (53.44%), Postives = 99/131 (75.57%), Query Frame = 2
Query:  263 NTNGIIEKEARLNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERINK 655
              +G  E+  R++LQLWDTAGQERF+SLT +FFRDAMGFLL+FDLT++ SF+N+R+WM  L+ N+Y ++PD+VLVG K+DL   R +    A ELA+ + +PY ETSA +G  V++A  TL+ LVM+R+ +
Sbjct:  309 GADGASERSFRVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTNQQSFVNVRNWMSQLQANAYCDSPDVVLVGTKADLKDMRNVHARQARELAERYGIPYFETSALTGAGVDQAVTTLLNLVMKRMEQ 439          

HSP 2 Score: 74.7146 bits (182), Expect = 1.677e-55
Identity = 33/49 (67.35%), Postives = 38/49 (77.55%), Query Frame = 1
Query:  106 DYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRVIY 252
            DYDYLIKLLALGDS  GKT  L RY DN + R F  TVG+DF++KRV+Y
Sbjct:  257 DYDYLIKLLALGDSGAGKTTFLHRYTDNKFHRRFTTTVGIDFREKRVVY 305          
BLAST of ras-related protein Rab-27A vs. Ensembl Medaka
Match: rab27a (RAB27A, member RAS oncogene family [Source:NCBI gene;Acc:101164788])

HSP 1 Score: 174.096 bits (440), Expect = 2.062e-55
Identity = 74/138 (53.62%), Postives = 106/138 (76.81%), Query Frame = 2
Query:  251 IPQKNTNGIIEKEARLNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERINKVLD 664
             P   + G   K  +++LQLWDTAGQERF+SLT +FFRDAMGFLL+FDLT+E SF+N+R+WM  L++++Y ENPD+VL GNK DL  +R IS + A ELA+++ +PY ETSA++G+NV +A + L++L+M R+   +D
Sbjct:   53 FPPTGSGGTSSKGQKIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWMSQLQMHAYCENPDVVLCGNKCDLMDQRAISEDEARELAEKYGIPYFETSAANGQNVTEAVRILLDLIMRRMEHCVD 190          

HSP 2 Score: 61.6178 bits (148), Expect = 2.062e-55
Identity = 28/51 (54.90%), Postives = 36/51 (70.59%), Query Frame = 1
Query:  106 DYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRVIYTP 258
            +YDYLIK LALGDS VGKT  L +Y D  +   F  TVG+DF++K V++ P
Sbjct:    5 EYDYLIKFLALGDSGVGKTSFLYQYTDGKFNSKFITTVGIDFREKTVLFPP 55          
BLAST of ras-related protein Rab-27A vs. Ensembl Medaka
Match: rab27a (RAB27A, member RAS oncogene family [Source:NCBI gene;Acc:101164788])

HSP 1 Score: 137.502 bits (345), Expect = 9.886e-45
Identity = 59/104 (56.73%), Postives = 80/104 (76.92%), Query Frame = 2
Query:  251 IPQKNTNGIIEKEARLNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFN 562
             P   + G   K  +++LQLWDTAGQERF+SLT +FFRDAMGFLL+FDLT+E SF+N+R+WM  L++++Y ENPD+VL GNK DL  +R IS + A ELA+++ 
Sbjct:   53 FPPTGSGGTSSKGQKIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWMSQLQMHAYCENPDVVLCGNKCDLMDQRAISEDEARELAEKYG 156          

HSP 2 Score: 62.003 bits (149), Expect = 9.886e-45
Identity = 28/53 (52.83%), Postives = 37/53 (69.81%), Query Frame = 1
Query:  100 NDDYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRVIYTP 258
            + +YDYLIK LALGDS VGKT  L +Y D  +   F  TVG+DF++K V++ P
Sbjct:    3 DGEYDYLIKFLALGDSGVGKTSFLYQYTDGKFNSKFITTVGIDFREKTVLFPP 55          
BLAST of ras-related protein Rab-27A vs. Ensembl Medaka
Match: rab27a (RAB27A, member RAS oncogene family [Source:NCBI gene;Acc:101164788])

HSP 1 Score: 142.51 bits (358), Expect = 7.316e-42
Identity = 60/110 (54.55%), Postives = 88/110 (80.00%), Query Frame = 2
Query:  335 FKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERINKVLD 664
            F+SLT +FFRDAMGFLL+FDLT+E SF+N+R+WM  L++++Y ENPD+VL GNK DL  +R IS + A ELA+++ +PY ETSA++G+NV +A + L++L+M R+   +D
Sbjct:    6 FRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWMSQLQMHAYCENPDVVLCGNKCDLMDQRAISEDEARELAEKYGIPYFETSAANGQNVTEAVRILLDLIMRRMEHCVD 115          
BLAST of ras-related protein Rab-27A vs. Planmine SMEST
Match: SMESG000044557.1 (SMESG000044557.1)

HSP 1 Score: 275.404 bits (703), Expect = 5.221e-107
Identity = 136/139 (97.84%), Postives = 137/139 (98.56%), Query Frame = 2
Query:  248 FIPQKNTNGIIEKEARLNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERINKVLD 664
            + P KNTNGIIEKEARLNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERINKVLD
Sbjct:   59 YTP-KNTNGIIEKEARLNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERINKVLD 196          

HSP 2 Score: 131.724 bits (330), Expect = 5.221e-107
Identity = 62/62 (100.00%), Postives = 62/62 (100.00%), Query Frame = 1
Query:   76 MTNSSTAGNDDYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRVIYTPK 261
            MTNSSTAGNDDYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRVIYTPK
Sbjct:    1 MTNSSTAGNDDYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRVIYTPK 62          
BLAST of ras-related protein Rab-27A vs. Planmine SMEST
Match: SMESG000014812.1 (SMESG000014812.1)

HSP 1 Score: 165.622 bits (418), Expect = 1.271e-57
Identity = 73/132 (55.30%), Postives = 105/132 (79.55%), Query Frame = 2
Query:  269 NGIIEKEARLNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERINKVLD 664
            NG++ K  +L LQLWDTAGQERF+SL+++FFRDAMGFLLVFD+T+E SF++IR+W+ +L+ ++Y + PD++LVGNK DL   R +S + A +LA+   +PY+ETSA S ENVEKAF  ++ +VM+RI + +D
Sbjct:   65 NGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSID 196          

HSP 2 Score: 76.6406 bits (187), Expect = 1.271e-57
Identity = 33/50 (66.00%), Postives = 43/50 (86.00%), Query Frame = 1
Query:  103 DDYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRVIY 252
            DDYDYL+KLLALGDS+VGKT +L RY D+ ++  F +TVGVDFKQKR+++
Sbjct:   10 DDYDYLLKLLALGDSAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVH 59          
BLAST of ras-related protein Rab-27A vs. Planmine SMEST
Match: SMESG000023446.1 (SMESG000023446.1)

HSP 1 Score: 164.081 bits (414), Expect = 2.771e-56
Identity = 72/132 (54.55%), Postives = 102/132 (77.27%), Query Frame = 2
Query:  260 KNTNGIIEKEARLNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERINK 655
            ++ +G++ +  +L+LQLWDTAGQERF+SL   F RDAMGFLLVFDLT+E S  N R+W+++L  ++Y E PD+VLVGNK+DL+++RV+S E A  +AKE  V Y+ETSA++G NVE     L+++VM+RI K
Sbjct:   68 RDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEK 199          

HSP 2 Score: 73.559 bits (179), Expect = 2.771e-56
Identity = 35/64 (54.69%), Postives = 47/64 (73.44%), Query Frame = 1
Query:   73 IMTNSSTAGNDDYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRVI-YTPK 261
            ++  S    NDDYDYLIKLLALGDS+VGKT +L +Y D  +   F +TVGVDF+QKR++  +P+
Sbjct:    5 MIQESDVPPNDDYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPR 68          
BLAST of ras-related protein Rab-27A vs. Planmine SMEST
Match: SMESG000077907.1 (SMESG000077907.1)

HSP 1 Score: 157.147 bits (396), Expect = 5.620e-52
Identity = 73/128 (57.03%), Postives = 99/128 (77.34%), Query Frame = 2
Query:  266 TNGIIEKEARLNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERI 649
            T+  + +E  L+LQLWDTAGQERF+SL   FFRDAMGF+L+FDLT+E S +NIR+WM +LK N+Y +NPDI+LVGNK+DL   R ++ E A ++A+EFN+PY+ETS  +G  VE+A   L+ +VM RI
Sbjct:   60 TDSCLGEEQILHLQLWDTAGQERFRSLCSIFFRDAMGFVLMFDLTNEESLLNIREWMNILKANAYCDNPDIILVGNKADLP--RTVTEEAAKKVAQEFNLPYIETSGLNGIRVEEAMDKLVNMVMTRI 185          

HSP 2 Score: 66.2402 bits (160), Expect = 5.620e-52
Identity = 31/53 (58.49%), Postives = 39/53 (73.58%), Query Frame = 1
Query:   94 AGNDDYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRVIY 252
            A ND+YDYLI+LLALGD  VGKT  L  Y D  +   F +T+GVDF+QKR+I+
Sbjct:    2 ARNDEYDYLIRLLALGDQDVGKTTFLYYYTDGKFDPGFTSTIGVDFRQKRIIH 54          
BLAST of ras-related protein Rab-27A vs. Planmine SMEST
Match: SMESG000026323.1 (SMESG000026323.1)

HSP 1 Score: 118.627 bits (296), Expect = 1.291e-38
Identity = 56/118 (47.46%), Postives = 85/118 (72.03%), Query Frame = 2
Query:  296 LNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYS-ENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMER 646
            + LQ+WDTAGQERF+++T S++R A G ++V+D+TD++SF N+++W  L +I+ Y+ EN + +LVGNK+DL S+RV+    A E A   N+P+LETSA    NVE+AF T+   +  R
Sbjct:   57 IKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQDSFNNVKNW--LSEIDRYANENVNKLLVGNKTDLISKRVVEASNAKEYADSLNIPFLETSAKDATNVEQAFLTMAGEIKSR 172          

HSP 2 Score: 60.077 bits (144), Expect = 1.291e-38
Identity = 26/49 (53.06%), Postives = 37/49 (75.51%), Query Frame = 1
Query:  100 NDDYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRV 246
            N +YDYL KLL +GDS VGK+C+L R+ D+ YT  + +T+GVDFK + +
Sbjct:    2 NPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTI 50          
The following BLAST results are available for this feature:
BLAST of ras-related protein Rab-27A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RAB27B3.901e-5855.56RAB27B, member RAS oncogene family [Source:HGNC Sy... [more]
RAB27A3.571e-5653.73RAB27A, member RAS oncogene family [Source:HGNC Sy... [more]
RAB27A3.571e-5653.73RAB27A, member RAS oncogene family [Source:HGNC Sy... [more]
RAB27A3.571e-5653.73RAB27A, member RAS oncogene family [Source:HGNC Sy... [more]
RAB27A3.571e-5653.73RAB27A, member RAS oncogene family [Source:HGNC Sy... [more]
back to top
BLAST of ras-related protein Rab-27A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aex-62.589e-5558.47Rab27 [Source:UniProtKB/TrEMBL;Acc:G5EBS5][more]
rab-32.477e-3940.77Ras-related protein Rab-3 [Source:UniProtKB/Swiss... [more]
rab-32.521e-3940.77Ras-related protein Rab-3 [Source:UniProtKB/Swiss... [more]
rab-16.011e-3942.62RAB family [Source:UniProtKB/TrEMBL;Acc:Q9UAQ6][more]
rab-83.947e-3543.24RAB family; Rab8 [Source:UniProtKB/TrEMBL;Acc:G5E... [more]
back to top
BLAST of ras-related protein Rab-27A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rab275.738e-5153.28gene:FBgn0025382 transcript:FBtr0070294[more]
Rab272.991e-4653.28gene:FBgn0025382 transcript:FBtr0070293[more]
Rab16.020e-4146.67gene:FBgn0285937 transcript:FBtr0084104[more]
Rab31.711e-3940.00gene:FBgn0005586 transcript:FBtr0473383[more]
Rab31.711e-3940.00gene:FBgn0005586 transcript:FBtr0088257[more]
back to top
BLAST of ras-related protein Rab-27A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab27b1.034e-5956.82RAB27B, member RAS oncogene family [Source:ZFIN;Ac... [more]
rab27b1.428e-5956.82RAB27B, member RAS oncogene family [Source:ZFIN;Ac... [more]
rab27a7.097e-5756.82RAB27A, member RAS oncogene family [Source:ZFIN;Ac... [more]
rab1bb1.612e-4045.38RAB1B, member RAS oncogene family b [Source:ZFIN;A... [more]
rab1bb1.612e-4045.38RAB1B, member RAS oncogene family b [Source:ZFIN;A... [more]
back to top
BLAST of ras-related protein Rab-27A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lemd37.718e-5955.97LEM domain containing 3 [Source:Xenbase;Acc:XB-GEN... [more]
lemd35.002e-5856.82LEM domain containing 3 [Source:Xenbase;Acc:XB-GEN... [more]
rab27a2.815e-5356.82RAB27A, member RAS oncogene family [Source:NCBI ge... [more]
rab27a2.092e-5257.25RAB27A, member RAS oncogene family [Source:NCBI ge... [more]
rab1a2.235e-3945.00RAB1A, member RAS oncogene family [Source:NCBI gen... [more]
back to top
BLAST of ras-related protein Rab-27A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rab27b2.501e-5854.81RAB27B, member RAS oncogene family [Source:MGI Sym... [more]
Rab27b2.501e-5854.81RAB27B, member RAS oncogene family [Source:MGI Sym... [more]
Rab27b2.501e-5854.81RAB27B, member RAS oncogene family [Source:MGI Sym... [more]
Rab27a3.765e-5654.55RAB27A, member RAS oncogene family [Source:MGI Sym... [more]
Rab27a3.765e-5654.55RAB27A, member RAS oncogene family [Source:MGI Sym... [more]
back to top
BLAST of ras-related protein Rab-27A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q99P58|RB27B_MOUSE1.478e-5754.81Ras-related protein Rab-27B OS=Mus musculus OX=100... [more]
sp|O00194|RB27B_HUMAN1.674e-5755.56Ras-related protein Rab-27B OS=Homo sapiens OX=960... [more]
sp|Q8HZJ5|RB27B_BOVIN1.960e-5754.81Ras-related protein Rab-27B OS=Bos taurus OX=9913 ... [more]
sp|Q99P74|RB27B_RAT5.477e-5754.81Ras-related protein Rab-27B OS=Rattus norvegicus O... [more]
sp|Q4LE85|RB27A_PIG1.013e-5556.82Ras-related protein Rab-27A OS=Sus scrofa OX=9823 ... [more]
back to top
BLAST of ras-related protein Rab-27A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0P7V1991.274e-5756.72Ras-related protein Rab-27B-like OS=Scleropages fo... [more]
A0A402FD923.655e-5755.56Uncharacterized protein OS=Paroedura picta OX=1436... [more]
A0A2D4KLG24.833e-5759.84Uncharacterized protein (Fragment) OS=Micrurus par... [more]
A0A2D4NQ515.199e-5759.84Uncharacterized protein (Fragment) OS=Micrurus sur... [more]
A0A5F8GU649.246e-5755.56RAB27B, member RAS oncogene family OS=Monodelphis ... [more]
back to top
BLAST of ras-related protein Rab-27A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab27b3.484e-5856.82RAB27B, member RAS oncogene family [Source:NCBI ge... [more]
rab27a1.785e-5654.48RAB27A, member RAS oncogene family [Source:NCBI ge... [more]
rab27a1.785e-5654.48RAB27A, member RAS oncogene family [Source:NCBI ge... [more]
rab1ab1.432e-3945.00ras-related protein Rab-1A [Source:NCBI gene;Acc:1... [more]
zgc:1719275.110e-3944.88ras-related protein ORAB-1-like [Source:NCBI gene;... [more]
back to top
BLAST of ras-related protein Rab-27A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab27a3.642e-5151.85RAB27A, member RAS oncogene family [Source:ZFIN;Ac... [more]
rab27a1.835e-4855.00RAB27A, member RAS oncogene family [Source:ZFIN;Ac... [more]
rab1aa3.732e-4045.00RAB1A, member RAS oncogene family a [Source:ZFIN;A... [more]
rab3c2.102e-3838.76RAB3C, member RAS oncogene family [Source:ZFIN;Acc... [more]
rab8a9.111e-3740.32RAB8A, member RAS oncogene family [Source:ZFIN;Acc... [more]
back to top
BLAST of ras-related protein Rab-27A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
SEC43.889e-3844.17Rab family GTPase; essential for vesicle-mediated ... [more]
YPT12.589e-3540.50Rab family GTPase; involved in the ER-to-Golgi ste... [more]
YPT312.204e-3038.84Rab family GTPase; involved in the exocytic pathwa... [more]
YPT321.711e-2837.19Rab family GTPase involved in the exocytic pathway... [more]
YPT72.647e-2638.33Rab family GTPase; GTP-binding protein of the rab ... [more]
back to top
BLAST of ras-related protein Rab-27A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO499583.996e-5357.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO283094.007e-5159.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO349441.499e-3938.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO401672.506e-3945.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO474714.635e-3841.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ras-related protein Rab-27A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab27b1.539e-5756.20RAB27B, member RAS oncogene family [Source:NCBI ge... [more]
ENSORLT00000000515.21.677e-5553.44ras-related protein Rab-27B [Source:NCBI gene;Acc:... [more]
rab27a2.062e-5553.62RAB27A, member RAS oncogene family [Source:NCBI ge... [more]
rab27a9.886e-4556.73RAB27A, member RAS oncogene family [Source:NCBI ge... [more]
rab27a7.316e-4254.55RAB27A, member RAS oncogene family [Source:NCBI ge... [more]
back to top
BLAST of ras-related protein Rab-27A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000044557.15.221e-10797.84SMESG000044557.1[more]
SMESG000014812.11.271e-5755.30SMESG000014812.1[more]
SMESG000023446.12.771e-5654.55SMESG000023446.1[more]
SMESG000077907.15.620e-5257.03SMESG000077907.1[more]
SMESG000026323.11.291e-3847.46SMESG000026323.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031862 ID=SMED30031862|Name=ras-related protein Rab-27A|organism=Schmidtea mediterranea sexual|type=transcript|length=919bp
CTTGAATTTTGTTTAAGTAGATTTTATTATACAATTAAATTCCAAAATTA
TTTCAATTTATCATTTATATCAATAATGACAAATAGTTCAACTGCAGGAA
ATGATGATTACGATTATTTGATCAAGTTATTAGCTTTAGGGGACAGTTCG
GTTGGGAAAACTTGTATATTGCAGAGGTATATTGACAACGCATATACTCG
TGACTTTGGCAACACTGTTGGCGTGGATTTTAAGCAAAAGCGAGTAATTT
ATACCCCAAAAAAACACAAATGGAATTATTGAAAAAGAGGCCCGATTAAA
TCTTCAGCTATGGGACACAGCCGGTCAAGAAAGATTTAAAAGCCTCACGG
TTTCATTTTTCCGCGATGCAATGGGATTCCTATTGGTGTTTGATTTGACC
GATGAAAACAGTTTCATCAATATCCGCGATTGGATGCGGTTACTCAAAAT
CAATTCCTACAGTGAAAATCCCGATATCGTTTTAGTGGGCAACAAATCCG
ATTTGAGCTCTCGGCGGGTTATCAGTCATGAGACAGCTTTGGAATTGGCA
AAAGAGTTCAACGTTCCGTATTTGGAGACAAGTGCATCAAGCGGAGAGAA
TGTTGAAAAAGCTTTCCAAACTCTCATTGAACTCGTCATGGAACGAATCA
ACAAAGTGCTAGACAAATCTCTGTTGCCCGTGAAAAAGAAAACCAAAAAA
ACCGAGTCCGGTGGAGAAAAAAGAAGCCAACAAGTGTTCCTGTTAGAAAT
GAGCTTTTTATCTTAAAATTATTGTGAACTCATAAAAACTATCGATTATA
ATAAAGTGCTACATTTAAATTTAATGAACAAAAAAATTGTTTTTGACTCA
GCTTTTGTGTGCTAAACCAATTTATCAACCGTAAGCACTCTAAAAAGGTT
TGCTTGTTTTTCAATTATC
back to top

protein sequence of SMED30031862-orf-1

>SMED30031862-orf-1 ID=SMED30031862-orf-1|Name=SMED30031862-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=132bp
MGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRV
ISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERINKVLDKS
LLPVKKKTKKTESGGEKRSQQVFLLEMSFLS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0002032epidermal cell
PLANA:0002118epithelium
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR001806Small_GTPase
IPR027417P-loop_NTPase
Vocabulary: molecular function
TermDefinition
GO:0005525GTP binding
GO:0000166nucleotide binding
GO:0003924GTPase activity
Vocabulary: biological process
TermDefinition
GO:0007264small GTPase mediated signal transduction
GO:0006810transport
GO:0006887exocytosis
GO:0007269neurotransmitter secretion
GO:0015031protein transport
GO:0016192vesicle-mediated transport
GO:0031630regulation of synaptic vesicle fusion to presynaptic active zone membrane
GO:0032482Rab protein signal transduction
GO:0048172regulation of short-term neuronal synaptic plasticity
GO:0048789cytoskeletal matrix organization at active zone
GO:0048790maintenance of presynaptic active zone structure
Vocabulary: cellular component
TermDefinition
GO:0008021synaptic vesicle
GO:0030054cell junction
GO:0031410cytoplasmic vesicle
GO:0031982vesicle
GO:0045202synapse
GO:0048786presynaptic active zone
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00449RASTRNSFRMNGcoord: 41..62
score: 43.99
coord: 64..80
score: 24.15
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 36..92
e-value: 8.7E-13
score: 50.0
NoneNo IPR availablePANTHERPTHR24073:SF853RAS-RELATED PROTEIN RAB-3coord: 28..86
NoneNo IPR availablePANTHERPTHR24073FAMILY NOT NAMEDcoord: 28..86
NoneNo IPR availablePROSITEPS51419RABcoord: 36..93
score: 10.803
IPR001806Small GTPasePFAMPF00071Rascoord: 42..87
e-value: 1.7E-10
score: 40.8
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 37..88