Arf-GAP domain-containing protein

Overview
NameArf-GAP domain-containing protein
Smed IDSMED30031852
Length (bp)1913
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Arf-GAP domain-containing protein (SMED30031852) t-SNE clustered cells

Violin plots show distribution of expression levels for Arf-GAP domain-containing protein (SMED30031852) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Arf-GAP domain-containing protein (SMED30031852) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Arf-GAP domain-containing protein (SMED30031852) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031852

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30031852SMESG000048247.1 dd_Smed_v4_2542_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30031852SMESG000048247.1 dd_Smed_v4_2542_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30031852SMESG000048247.1 dd_Smed_v4_2542_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30031852SMESG000048247.1 dd_Smed_v4_2542_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30031852SMESG000048247.1 dd_Smed_v4_2542_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Arf-GAP domain-containing protein vs. Ensembl Human
Match: SMAP2 (small ArfGAP2 [Source:HGNC Symbol;Acc:HGNC:25082])

HSP 1 Score: 160.229 bits (404), Expect = 2.057e-42
Identity = 63/98 (64.29%), Postives = 79/98 (80.61%), Query Frame = 2
Query:  170 YCVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDNFRRPQTDSSLEQFIRGKYEHKRYI 463
            +C DC SKGPRWASW +G+F+CIRCAGIHRNLGVH+SRVKSVNLD WT +Q+  M+E+GN +   +YEA L + FRRPQ D ++E FIR KYE K+Y+
Sbjct:   27 FCADCQSKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVNLDQWTQEQIQCMQEMGNGKANRLYEAYLPETFRRPQIDPAVEGFIRDKYEKKKYM 124          
BLAST of Arf-GAP domain-containing protein vs. Ensembl Human
Match: SMAP1 (small ArfGAP 1 [Source:HGNC Symbol;Acc:HGNC:19651])

HSP 1 Score: 158.688 bits (400), Expect = 8.255e-42
Identity = 61/89 (68.54%), Postives = 78/89 (87.64%), Query Frame = 2
Query:  170 YCVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDNFRRPQTDSSLEQFIR 436
            YC DC++KGPRWASW +G+F+CIRCAGIHRNLGVH+SRVKSVNLD WT +Q+  M+++GN++ R +YEANL +NFRRPQTD ++E FIR
Sbjct:   32 YCADCEAKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVNLDQWTAEQIQCMQDMGNTKARLLYEANLPENFRRPQTDQAVEFFIR 120          
BLAST of Arf-GAP domain-containing protein vs. Ensembl Human
Match: SMAP1 (small ArfGAP 1 [Source:HGNC Symbol;Acc:HGNC:19651])

HSP 1 Score: 159.073 bits (401), Expect = 8.949e-42
Identity = 61/89 (68.54%), Postives = 78/89 (87.64%), Query Frame = 2
Query:  170 YCVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDNFRRPQTDSSLEQFIR 436
            YC DC++KGPRWASW +G+F+CIRCAGIHRNLGVH+SRVKSVNLD WT +Q+  M+++GN++ R +YEANL +NFRRPQTD ++E FIR
Sbjct:   32 YCADCEAKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVNLDQWTAEQIQCMQDMGNTKARLLYEANLPENFRRPQTDQAVEFFIR 120          
BLAST of Arf-GAP domain-containing protein vs. Ensembl Human
Match: SMAP1 (small ArfGAP 1 [Source:HGNC Symbol;Acc:HGNC:19651])

HSP 1 Score: 157.532 bits (397), Expect = 2.266e-41
Identity = 61/89 (68.54%), Postives = 78/89 (87.64%), Query Frame = 2
Query:  170 YCVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDNFRRPQTDSSLEQFIR 436
            YC DC++KGPRWASW +G+F+CIRCAGIHRNLGVH+SRVKSVNLD WT +Q+  M+++GN++ R +YEANL +NFRRPQTD ++E FIR
Sbjct:   32 YCADCEAKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVNLDQWTAEQIQCMQDMGNTKARLLYEANLPENFRRPQTDQAVEFFIR 120          
BLAST of Arf-GAP domain-containing protein vs. Ensembl Human
Match: SMAP2 (small ArfGAP2 [Source:HGNC Symbol;Acc:HGNC:25082])

HSP 1 Score: 141.739 bits (356), Expect = 1.544e-38
Identity = 59/95 (62.11%), Postives = 75/95 (78.95%), Query Frame = 2
Query:  179 DCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDNFRRPQTDSSLEQFIRGKYEHKRYI 463
            D +  GPRWASW +G+F+CIRCAGIHRNLGVH+SRVKSVNLD WT +Q+  M+E+GN +   +YEA L + FRRPQ D ++E FIR KYE K+Y+
Sbjct:   14 DFEIYGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVNLDQWTQEQIQCMQEMGNGKANRLYEAYLPETFRRPQIDPAVEGFIRDKYEKKKYM 108          
BLAST of Arf-GAP domain-containing protein vs. Ensembl Celegans
Match: W09D10.1 (pep chromosome:WBcel235:III:10736919:10739786:-1 gene:WBGene00012359.1 transcript:W09D10.1.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:W09D10.1)

HSP 1 Score: 171.014 bits (432), Expect = 3.905e-46
Identity = 71/125 (56.80%), Postives = 93/125 (74.40%), Query Frame = 2
Query:  170 YCVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDNFRRPQTDSSLEQFIRGKYEHKRYIAKEWIPPTPSVDSISEEIRKLEQNQNR 544
            YC DC +K PRWA+W LG+F+CIRCAGIHRNLGVH+S+V+SVNLDSWTP+QV  M+ +GN + R +YE +L   FRRP  D  +EQFIR KYE KRYI ++++   P VD+ S+  + L Q Q +
Sbjct:   31 YCADCQAKTPRWAAWNLGVFICIRCAGIHRNLGVHISKVRSVNLDSWTPEQVQTMRVMGNEKARQVYEHDLPAQFRRPTNDQQMEQFIRSKYEQKRYILRDFV--YPRVDA-SQLPKSLSQAQKK 152          
BLAST of Arf-GAP domain-containing protein vs. Ensembl Celegans
Match: W09D10.1 (pep chromosome:WBcel235:III:10736919:10739792:-1 gene:WBGene00012359.1 transcript:W09D10.1.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:W09D10.1)

HSP 1 Score: 171.014 bits (432), Expect = 3.905e-46
Identity = 71/125 (56.80%), Postives = 93/125 (74.40%), Query Frame = 2
Query:  170 YCVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDNFRRPQTDSSLEQFIRGKYEHKRYIAKEWIPPTPSVDSISEEIRKLEQNQNR 544
            YC DC +K PRWA+W LG+F+CIRCAGIHRNLGVH+S+V+SVNLDSWTP+QV  M+ +GN + R +YE +L   FRRP  D  +EQFIR KYE KRYI ++++   P VD+ S+  + L Q Q +
Sbjct:   31 YCADCQAKTPRWAAWNLGVFICIRCAGIHRNLGVHISKVRSVNLDSWTPEQVQTMRVMGNEKARQVYEHDLPAQFRRPTNDQQMEQFIRSKYEQKRYILRDFV--YPRVDA-SQLPKSLSQAQKK 152          
BLAST of Arf-GAP domain-containing protein vs. Ensembl Celegans
Match: W09D10.1 (pep chromosome:WBcel235:III:10736893:10739824:-1 gene:WBGene00012359.1 transcript:W09D10.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:W09D10.1)

HSP 1 Score: 171.014 bits (432), Expect = 3.905e-46
Identity = 71/125 (56.80%), Postives = 93/125 (74.40%), Query Frame = 2
Query:  170 YCVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDNFRRPQTDSSLEQFIRGKYEHKRYIAKEWIPPTPSVDSISEEIRKLEQNQNR 544
            YC DC +K PRWA+W LG+F+CIRCAGIHRNLGVH+S+V+SVNLDSWTP+QV  M+ +GN + R +YE +L   FRRP  D  +EQFIR KYE KRYI ++++   P VD+ S+  + L Q Q +
Sbjct:   31 YCADCQAKTPRWAAWNLGVFICIRCAGIHRNLGVHISKVRSVNLDSWTPEQVQTMRVMGNEKARQVYEHDLPAQFRRPTNDQQMEQFIRSKYEQKRYILRDFV--YPRVDA-SQLPKSLSQAQKK 152          
BLAST of Arf-GAP domain-containing protein vs. Ensembl Celegans
Match: cnt-2 (Arf-GAP with ANK repeat and PH domain-containing protein cnt-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XX14])

HSP 1 Score: 98.5969 bits (244), Expect = 3.017e-21
Identity = 41/115 (35.65%), Postives = 72/115 (62.61%), Query Frame = 2
Query:  173 CVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDNFRRPQTDSSLEQFIRGKYEHKRYIAKEWIPPTPSVDSISEEI 517
            C DC +    WAS  LGI +CI C+GIHRNLG H+S+V+ + LD W  + +A+M+ IGN +   ++E  L +  R+P  +SS E+  + ++  ++Y+ K ++ P  S + ++ ++
Sbjct:  396 CADCGNPSSEWASINLGIIICIECSGIHRNLGSHISKVRGLELDQWPVEHLAVMQAIGNDKANEMWEFGLLNGERKPTPESSREE--KERFIDRKYVQKAFLKPIASGEPVTSQL 508          
BLAST of Arf-GAP domain-containing protein vs. Ensembl Celegans
Match: cnt-2 (Arf-GAP with ANK repeat and PH domain-containing protein cnt-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XX14])

HSP 1 Score: 98.5969 bits (244), Expect = 3.803e-21
Identity = 41/115 (35.65%), Postives = 72/115 (62.61%), Query Frame = 2
Query:  173 CVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDNFRRPQTDSSLEQFIRGKYEHKRYIAKEWIPPTPSVDSISEEI 517
            C DC +    WAS  LGI +CI C+GIHRNLG H+S+V+ + LD W  + +A+M+ IGN +   ++E  L +  R+P  +SS E+  + ++  ++Y+ K ++ P  S + ++ ++
Sbjct:  472 CADCGNPSSEWASINLGIIICIECSGIHRNLGSHISKVRGLELDQWPVEHLAVMQAIGNDKANEMWEFGLLNGERKPTPESSREE--KERFIDRKYVQKAFLKPIASGEPVTSQL 584          
BLAST of Arf-GAP domain-containing protein vs. Ensembl Fly
Match: CG8243 (gene:FBgn0033349 transcript:FBtr0088652)

HSP 1 Score: 213.001 bits (541), Expect = 3.239e-61
Identity = 86/127 (67.72%), Postives = 108/127 (85.04%), Query Frame = 2
Query:  170 YCVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDNFRRPQTDSSLEQFIRGKYEHKRYIAKEWIPPTPSVDSISEEIRKLEQNQNRKR 550
            YCVDCD+KGPRWASW LG+FLCIRCAGIHRNLGVH+SRVKSVNLD+WTP+QV  ++++GNSR RA+YEA L D FRRPQTD++LE FIR KYEHK+Y+A+EW+PP+P     ++EI +  + Q RK+
Sbjct:   32 YCVDCDAKGPRWASWNLGMFLCIRCAGIHRNLGVHISRVKSVNLDTWTPEQVISLQQMGNSRARAVYEAQLPDGFRRPQTDTALENFIRAKYEHKKYLAREWVPPSPPKVDWAKEIDEELERQKRKK 158          
BLAST of Arf-GAP domain-containing protein vs. Ensembl Fly
Match: CenB1A (gene:FBgn0039056 transcript:FBtr0084369)

HSP 1 Score: 102.449 bits (254), Expect = 1.997e-22
Identity = 46/104 (44.23%), Postives = 66/104 (63.46%), Query Frame = 2
Query:  170 YCVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDN--FRRPQTDSSL---EQFIRGKYEHKRYIA 466
            YC DC S  PRWAS  LGI LCI C+G+HR+LGVH S+V+S+ LD+W  + V +M E+GN     IYEA + D+   ++P     +   E +I+ KY  +R++ 
Sbjct:  165 YCCDCRSPEPRWASINLGITLCIECSGVHRSLGVHYSKVRSLTLDAWESENVKVMMELGNEVVNRIYEARIGDDCGLKKPTEQCEIGVREAWIKAKYVERRFVC 268          
BLAST of Arf-GAP domain-containing protein vs. Ensembl Fly
Match: CenB1A (gene:FBgn0039056 transcript:FBtr0084368)

HSP 1 Score: 102.449 bits (254), Expect = 2.960e-22
Identity = 46/104 (44.23%), Postives = 66/104 (63.46%), Query Frame = 2
Query:  170 YCVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDN--FRRPQTDSSL---EQFIRGKYEHKRYIA 466
            YC DC S  PRWAS  LGI LCI C+G+HR+LGVH S+V+S+ LD+W  + V +M E+GN     IYEA + D+   ++P     +   E +I+ KY  +R++ 
Sbjct:  395 YCCDCRSPEPRWASINLGITLCIECSGVHRSLGVHYSKVRSLTLDAWESENVKVMMELGNEVVNRIYEARIGDDCGLKKPTEQCEIGVREAWIKAKYVERRFVC 498          
BLAST of Arf-GAP domain-containing protein vs. Ensembl Fly
Match: CenG1A (gene:FBgn0028509 transcript:FBtr0080548)

HSP 1 Score: 99.3673 bits (246), Expect = 2.892e-21
Identity = 41/101 (40.59%), Postives = 66/101 (65.35%), Query Frame = 2
Query:  170 YCVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDNFRRPQTDSSL---EQFIRGKYEHKRYI 463
            +CVDC +  P WAS  LG+ +CI C+G+HRNLG H+S+V+S+ LD W    +++M  IGNS   +++E+N      +P + +S    E+++R KYE K ++
Sbjct:  484 FCVDCGAPNPEWASLNLGVLMCIECSGVHRNLGSHISKVRSLGLDDWPSPHLSVMLAIGNSLANSVWESNTRQRV-KPTSQASREDKERWVRSKYEAKEFL 583          
BLAST of Arf-GAP domain-containing protein vs. Ensembl Fly
Match: CenG1A (gene:FBgn0028509 transcript:FBtr0080547)

HSP 1 Score: 98.9821 bits (245), Expect = 4.085e-21
Identity = 41/101 (40.59%), Postives = 66/101 (65.35%), Query Frame = 2
Query:  170 YCVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDNFRRPQTDSSL---EQFIRGKYEHKRYI 463
            +CVDC +  P WAS  LG+ +CI C+G+HRNLG H+S+V+S+ LD W    +++M  IGNS   +++E+N      +P + +S    E+++R KYE K ++
Sbjct:  648 FCVDCGAPNPEWASLNLGVLMCIECSGVHRNLGSHISKVRSLGLDDWPSPHLSVMLAIGNSLANSVWESNTRQRV-KPTSQASREDKERWVRSKYEAKEFL 747          
BLAST of Arf-GAP domain-containing protein vs. Ensembl Zebrafish
Match: smap1 (small ArfGAP 1 [Source:ZFIN;Acc:ZDB-GENE-060920-2])

HSP 1 Score: 171.014 bits (432), Expect = 5.182e-46
Identity = 67/100 (67.00%), Postives = 85/100 (85.00%), Query Frame = 2
Query:  170 YCVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDNFRRPQTDSSLEQFIRGKYEHKRYIAK 469
            YC DC++KGPRWASW LG+F+CIRCAGIHRNLGVH+SRVKSVNLD WTP+Q+  ++ +GN++ R +YEA+L +NFRRPQTD ++E FIR KYE K+Y  K
Sbjct:   32 YCADCEAKGPRWASWNLGVFICIRCAGIHRNLGVHISRVKSVNLDQWTPEQIQSVQSMGNTKARQLYEAHLPENFRRPQTDQAVEFFIRDKYERKKYYDK 131          
BLAST of Arf-GAP domain-containing protein vs. Ensembl Zebrafish
Match: smap1 (small ArfGAP 1 [Source:ZFIN;Acc:ZDB-GENE-060920-2])

HSP 1 Score: 170.244 bits (430), Expect = 5.964e-46
Identity = 67/100 (67.00%), Postives = 85/100 (85.00%), Query Frame = 2
Query:  170 YCVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDNFRRPQTDSSLEQFIRGKYEHKRYIAK 469
            YC DC++KGPRWASW LG+F+CIRCAGIHRNLGVH+SRVKSVNLD WTP+Q+  ++ +GN++ R +YEA+L +NFRRPQTD ++E FIR KYE K+Y  K
Sbjct:   32 YCADCEAKGPRWASWNLGVFICIRCAGIHRNLGVHISRVKSVNLDQWTPEQIQSVQSMGNTKARQLYEAHLPENFRRPQTDQAVEFFIRDKYERKKYYDK 131          
BLAST of Arf-GAP domain-containing protein vs. Ensembl Zebrafish
Match: smap2 (small ArfGAP2 [Source:ZFIN;Acc:ZDB-GENE-060503-374])

HSP 1 Score: 145.206 bits (365), Expect = 2.189e-37
Identity = 58/89 (65.17%), Postives = 74/89 (83.15%), Query Frame = 2
Query:  170 YCVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDNFRRPQTDSSLEQFIR 436
            +C DC +KGPRWASW LGIF+CIRCAGIHRNLGVH+SRVKSVNLD WT +Q+  ++E+GN++ R +YEA L + F+RP+TD + E FIR
Sbjct:   27 FCADCYAKGPRWASWNLGIFICIRCAGIHRNLGVHISRVKSVNLDQWTQEQIQSVQEMGNAKARRLYEAFLPECFQRPETDQAAEIFIR 115          
BLAST of Arf-GAP domain-containing protein vs. Ensembl Zebrafish
Match: zgc:162872 (zgc:162872 [Source:ZFIN;Acc:ZDB-GENE-081022-1])

HSP 1 Score: 113.235 bits (282), Expect = 9.336e-26
Identity = 53/121 (43.80%), Postives = 73/121 (60.33%), Query Frame = 2
Query:  170 YCVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDNFRRPQTDS---SLEQFIRGKYEHKRYIAKEWIPPTPSVDSISEEIRK 523
            +C DC    PRWAS  LGI +CI C+GIHR+LGVHLS+V+S+ LDSW P+Q+ ++  +GN     IYE    D  ++P   S     EQ+IR KY  KR++A+      P  D++    RK
Sbjct:  402 HCCDCGEAEPRWASVNLGITMCIECSGIHRSLGVHLSKVRSLTLDSWEPEQLKLLCVLGNEVINGIYEREAADGLQKPSAGSPRQDKEQWIRSKYVEKRFVARHL--DGPDADALKLRARK 520          
BLAST of Arf-GAP domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-168b3.1 (si:ch211-168b3.1 [Source:ZFIN;Acc:ZDB-GENE-081104-34])

HSP 1 Score: 108.997 bits (271), Expect = 3.661e-24
Identity = 56/133 (42.11%), Postives = 79/133 (59.40%), Query Frame = 2
Query:  170 YCVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDN-FRRPQTDS---SLEQFIRGKYEHKRYIAKEWIPPTPSVDSISEEIRKLEQNQNRKRVN 556
            +C DC    PRWAS  L I LCI C+GIHR+LGVH S+V+S+ LD+W P+ + +M E+GN     IYEA+ E+N  ++PQ       +E FIR KY  KR++ K      P+     E+I  L ++  R + N
Sbjct:  416 FCCDCGQSDPRWASINLCITLCIECSGIHRSLGVHNSKVRSLTLDTWEPELLKLMCELGNDVINQIYEAHREENGGKKPQPGDPRREIEAFIRAKYVDKRFVLK------PTEQEQMEKIMTLRKHDKRMQGN 542          
BLAST of Arf-GAP domain-containing protein vs. Ensembl Xenopus
Match: ammecr1l (AMMECR1 like [Source:Xenbase;Acc:XB-GENE-5787907])

HSP 1 Score: 175.252 bits (443), Expect = 8.243e-49
Identity = 70/100 (70.00%), Postives = 86/100 (86.00%), Query Frame = 2
Query:  170 YCVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDNFRRPQTDSSLEQFIRGKYEHKRYIAK 469
            YC DC++KGPRWASW LG+F+CIRCAGIHRNLGVH+SRVKSVNLD WTP+Q+  M+++GN++ R +YEANL +NFRRPQTD S+E FIR KYE K+Y  K
Sbjct:   32 YCADCEAKGPRWASWNLGVFICIRCAGIHRNLGVHISRVKSVNLDQWTPEQMQCMQDMGNTKARQMYEANLPENFRRPQTDQSVEFFIRDKYERKKYYDK 131          
BLAST of Arf-GAP domain-containing protein vs. Ensembl Xenopus
Match: ammecr1l (AMMECR1 like [Source:Xenbase;Acc:XB-GENE-5787907])

HSP 1 Score: 175.637 bits (444), Expect = 3.699e-48
Identity = 70/100 (70.00%), Postives = 86/100 (86.00%), Query Frame = 2
Query:  170 YCVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDNFRRPQTDSSLEQFIRGKYEHKRYIAK 469
            YC DC++KGPRWASW LG+F+CIRCAGIHRNLGVH+SRVKSVNLD WTP+Q+  M+++GN++ R +YEANL +NFRRPQTD S+E FIR KYE K+Y  K
Sbjct:   32 YCADCEAKGPRWASWNLGVFICIRCAGIHRNLGVHISRVKSVNLDQWTPEQMQCMQDMGNTKARQMYEANLPENFRRPQTDQSVEFFIRDKYERKKYYDK 131          
BLAST of Arf-GAP domain-containing protein vs. Ensembl Xenopus
Match: ammecr1l (AMMECR1 like [Source:Xenbase;Acc:XB-GENE-5787907])

HSP 1 Score: 176.792 bits (447), Expect = 4.270e-48
Identity = 73/117 (62.39%), Postives = 93/117 (79.49%), Query Frame = 2
Query:  170 YCVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDNFRRPQTDSSLEQFIRGKYEHKRYIAKEWIPPTPSVDSISEEIR 520
            YC DC++KGPRWASW LG+F+CIRCAGIHRNLGVH+SRVKSVNLD WTP+Q+  M+++GN++ R +YEANL +NFRRPQTD S+E FIR KYE K+Y  K      P + S S+ ++
Sbjct:   32 YCADCEAKGPRWASWNLGVFICIRCAGIHRNLGVHISRVKSVNLDQWTPEQMQCMQDMGNTKARQMYEANLPENFRRPQTDQSVEFFIRDKYERKKYYDKNAT--VPGITSSSDAVQ 146          
BLAST of Arf-GAP domain-containing protein vs. Ensembl Xenopus
Match: ammecr1l (AMMECR1 like [Source:Xenbase;Acc:XB-GENE-5787907])

HSP 1 Score: 175.637 bits (444), Expect = 6.660e-48
Identity = 70/100 (70.00%), Postives = 86/100 (86.00%), Query Frame = 2
Query:  170 YCVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDNFRRPQTDSSLEQFIRGKYEHKRYIAK 469
            YC DC++KGPRWASW LG+F+CIRCAGIHRNLGVH+SRVKSVNLD WTP+Q+  M+++GN++ R +YEANL +NFRRPQTD S+E FIR KYE K+Y  K
Sbjct:   32 YCADCEAKGPRWASWNLGVFICIRCAGIHRNLGVHISRVKSVNLDQWTPEQMQCMQDMGNTKARQMYEANLPENFRRPQTDQSVEFFIRDKYERKKYYDK 131          
BLAST of Arf-GAP domain-containing protein vs. Ensembl Xenopus
Match: foxn3 (forkhead box N3 [Source:Xenbase;Acc:XB-GENE-483117])

HSP 1 Score: 160.229 bits (404), Expect = 7.809e-43
Identity = 69/126 (54.76%), Postives = 92/126 (73.02%), Query Frame = 2
Query:  170 YCVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDNFRRPQTDSSLEQFIRGKYEHKRYIAKEWIPPTPSVDSISEEIRKLEQNQNRK 547
            +C DC +KGPRWASW +G+F+CIRCAG+HRNLGVH+SRVKSVNLD WT +Q+  M+E+GN + + +YEA L DNF RPQTD ++E FIR KYE K+Y+ +       SVD  +   +K ++ Q  K
Sbjct:   27 FCADCLAKGPRWASWNIGVFVCIRCAGVHRNLGVHISRVKSVNLDQWTQEQIQCMEEMGNGKAKRLYEAFLPDNFIRPQTDQAVEVFIRDKYEKKKYMDR-------SVDLSAFRPQKKDETQQLK 145          
BLAST of Arf-GAP domain-containing protein vs. Ensembl Mouse
Match: Smap1 (small ArfGAP 1 [Source:MGI Symbol;Acc:MGI:2138261])

HSP 1 Score: 162.155 bits (409), Expect = 3.182e-43
Identity = 62/89 (69.66%), Postives = 79/89 (88.76%), Query Frame = 2
Query:  170 YCVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDNFRRPQTDSSLEQFIR 436
            YC DC++KGPRWASW +G+F+CIRCAGIHRNLGVH+SRVKSVNLD WTP+Q+  M+++GN++ R +YEANL +NFRRPQTD ++E FIR
Sbjct:   32 YCADCEAKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVNLDQWTPEQIQCMQDMGNTKARLLYEANLPENFRRPQTDQAVEFFIR 120          
BLAST of Arf-GAP domain-containing protein vs. Ensembl Mouse
Match: Smap2 (small ArfGAP 2 [Source:MGI Symbol;Acc:MGI:1917030])

HSP 1 Score: 160.614 bits (405), Expect = 1.070e-42
Identity = 63/98 (64.29%), Postives = 79/98 (80.61%), Query Frame = 2
Query:  170 YCVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDNFRRPQTDSSLEQFIRGKYEHKRYI 463
            +C DC SKGPRWASW +G+F+CIRCAGIHRNLGVH+SRVKSVNLD WT +Q+  M+E+GN +   +YEA L + FRRPQ D ++E FIR KYE K+Y+
Sbjct:   27 FCADCQSKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVNLDQWTQEQIQCMQEMGNGKANRLYEAYLPETFRRPQIDPAVEGFIRDKYEKKKYM 124          
BLAST of Arf-GAP domain-containing protein vs. Ensembl Mouse
Match: Agap3 (ArfGAP with GTPase domain, ankyrin repeat and PH domain 3 [Source:MGI Symbol;Acc:MGI:2183446])

HSP 1 Score: 107.071 bits (266), Expect = 3.809e-24
Identity = 48/112 (42.86%), Postives = 73/112 (65.18%), Query Frame = 2
Query:  173 CVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDNFRRPQTDSSLEQ---FIRGKYEHKRYIAKEWIPPTPSVD 499
            C+DC++  P WAS  LG  +CI C+GIHR+LG HLSRV+S++LD W P+ +A+M  +GN+   +++E  L D + +P  ++  E+   +IR KYE K ++A     P PS D
Sbjct:  211 CIDCEAPNPDWASLNLGALMCIECSGIHRHLGAHLSRVRSLDLDDWPPELLAVMTAMGNALANSVWEGAL-DGYSKPGPEACREEKERWIRAKYEQKLFLA-----PLPSSD 316          
BLAST of Arf-GAP domain-containing protein vs. Ensembl Mouse
Match: Agap3 (ArfGAP with GTPase domain, ankyrin repeat and PH domain 3 [Source:MGI Symbol;Acc:MGI:2183446])

HSP 1 Score: 107.842 bits (268), Expect = 9.726e-24
Identity = 48/112 (42.86%), Postives = 73/112 (65.18%), Query Frame = 2
Query:  173 CVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDNFRRPQTDSSLEQ---FIRGKYEHKRYIAKEWIPPTPSVD 499
            C+DC++  P WAS  LG  +CI C+GIHR+LG HLSRV+S++LD W P+ +A+M  +GN+   +++E  L D + +P  ++  E+   +IR KYE K ++A     P PS D
Sbjct:  676 CIDCEAPNPDWASLNLGALMCIECSGIHRHLGAHLSRVRSLDLDDWPPELLAVMTAMGNALANSVWEGAL-DGYSKPGPEACREEKERWIRAKYEQKLFLA-----PLPSSD 781          
BLAST of Arf-GAP domain-containing protein vs. Ensembl Mouse
Match: Acap2 (ArfGAP with coiled-coil, ankyrin repeat and PH domains 2 [Source:MGI Symbol;Acc:MGI:1925868])

HSP 1 Score: 105.916 bits (263), Expect = 2.912e-23
Identity = 49/110 (44.55%), Postives = 69/110 (62.73%), Query Frame = 2
Query:  173 CVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLED-NFRRPQTDSSLEQ--FIRGKYEHKRYIAKEWIPPTPS 493
            C DC    PRWAS  LGI LCI C+GIHR+LGVH S+V+S+ LD+W P+ + +M E+GN     +YEA LE    ++PQ     E+  +IR KY  ++++ K     +PS
Sbjct:  414 CCDCGLADPRWASINLGITLCIECSGIHRSLGVHFSKVRSLTLDTWEPELLKLMCELGNDVINRVYEAKLEKMGVKKPQPGQRQEKEAYIRAKYVERKFVDKYSALLSPS 523          
BLAST of Arf-GAP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5F413|SMAP2_CHICK (Stromal membrane-associated protein 2 OS=Gallus gallus OX=9031 GN=SMAP2 PE=2 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 7.120e-44
Identity = 104/314 (33.12%), Postives = 154/314 (49.04%), Query Frame = 2
Query:  170 YCVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDNFRRPQTDSSLEQFIRGKYEHKRYIAKEWIPPTPSVDSISEEIRKLEQNQNRKRVNYXXXXXXXXXXXXXRREIIDNSVST--KKDEVDEKQQTVVNNK---VDLLGLENDIVSSNIDDTFGDFVFASEPPISTNQVITNSVCKPVTVSSAVDDL--MGLNLGNSNTIASLSGFNMAPNISASSPALPNTAGK--------LDKSSILALYNNSNTSGSVMGQM---TSQSMWPNATTSAY 1057
            YC DC +KGPRWASW +G+F+CIRCAGIHRNLGVH+SRVKSVNLD WT +Q+  M+E+GN +   +YEA L +NFRRPQTD ++E FIR KYE K+Y+                  R ++ N  RK  +     ++          I+   V    KK+E  + +++   +    +DLLGL+  + S+                      +TN   +P ++   +D    +GLN  +     S+     A ++  +    P   GK        L K SIL+LY +        G M    +Q  +P A  +++
Sbjct:   27 YCADCQAKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVNLDQWTQEQIQCMQEMGNGKANRLYEAFLPENFRRPQTDQAVEGFIRDKYEKKKYMD-----------------RSIDINTFRKEKDDKWKKSNEPVSERKLEPIVFEKVKMPQKKEETQQSRKSSPKSTEPVIDLLGLDAPVPST----------------------LTNG--RPCSLEKDLDLFASVGLNSDSRKVSGSMPTSGSAGSVPENLNLFPEPGGKGEEAGKKQLSKDSILSLYGSQTPQLPAQGAMFMAPAQMAYPAAAYTSF 299          
BLAST of Arf-GAP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q91VZ6|SMAP1_MOUSE (Stromal membrane-associated protein 1 OS=Mus musculus OX=10090 GN=Smap1 PE=1 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 2.226e-42
Identity = 62/89 (69.66%), Postives = 79/89 (88.76%), Query Frame = 2
Query:  170 YCVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDNFRRPQTDSSLEQFIR 436
            YC DC++KGPRWASW +G+F+CIRCAGIHRNLGVH+SRVKSVNLD WTP+Q+  M+++GN++ R +YEANL +NFRRPQTD ++E FIR
Sbjct:   32 YCADCEAKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVNLDQWTPEQIQCMQDMGNTKARLLYEANLPENFRRPQTDQAVEFFIR 120          
BLAST of Arf-GAP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q7TN29|SMAP2_MOUSE (Stromal membrane-associated protein 2 OS=Mus musculus OX=10090 GN=Smap2 PE=1 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 7.483e-42
Identity = 63/98 (64.29%), Postives = 79/98 (80.61%), Query Frame = 2
Query:  170 YCVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDNFRRPQTDSSLEQFIRGKYEHKRYI 463
            +C DC SKGPRWASW +G+F+CIRCAGIHRNLGVH+SRVKSVNLD WT +Q+  M+E+GN +   +YEA L + FRRPQ D ++E FIR KYE K+Y+
Sbjct:   27 FCADCQSKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVNLDQWTQEQIQCMQEMGNGKANRLYEAYLPETFRRPQIDPAVEGFIRDKYEKKKYM 124          
BLAST of Arf-GAP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5EA00|SMAP2_BOVIN (Stromal membrane-associated protein 2 OS=Bos taurus OX=9913 GN=SMAP2 PE=2 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 9.306e-42
Identity = 63/98 (64.29%), Postives = 79/98 (80.61%), Query Frame = 2
Query:  170 YCVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDNFRRPQTDSSLEQFIRGKYEHKRYI 463
            +C DC SKGPRWASW +G+F+CIRCAGIHRNLGVH+SRVKSVNLD WT +Q+  M+E+GN +   +YEA L + FRRPQ D ++E FIR KYE K+Y+
Sbjct:   27 FCADCQSKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVNLDQWTQEQIQCMQEMGNGKANRLYEAYLPETFRRPQIDHAVEGFIRDKYEKKKYM 124          
BLAST of Arf-GAP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8WU79|SMAP2_HUMAN (Stromal membrane-associated protein 2 OS=Homo sapiens OX=9606 GN=SMAP2 PE=1 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 9.876e-42
Identity = 63/98 (64.29%), Postives = 79/98 (80.61%), Query Frame = 2
Query:  170 YCVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDNFRRPQTDSSLEQFIRGKYEHKRYI 463
            +C DC SKGPRWASW +G+F+CIRCAGIHRNLGVH+SRVKSVNLD WT +Q+  M+E+GN +   +YEA L + FRRPQ D ++E FIR KYE K+Y+
Sbjct:   27 FCADCQSKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVNLDQWTQEQIQCMQEMGNGKANRLYEAYLPETFRRPQIDPAVEGFIRDKYEKKKYM 124          
BLAST of Arf-GAP domain-containing protein vs. TrEMBL
Match: G4VST0 (Putative smap1 OS=Schistosoma mansoni OX=6183 GN=Smp_142850 PE=4 SV=1)

HSP 1 Score: 243.047 bits (619), Expect = 1.526e-70
Identity = 134/294 (45.58%), Postives = 178/294 (60.54%), Query Frame = 2
Query:  170 YCVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDNFRRPQTDSSLEQFIRGKYEHKRYIAKEWIPPTPSVDSISEEIRKLEQNQNRKRVNYXXXXXXXXXXXXXRREIIDNSVSTKKDEVDEKQQTVVNNKVDLLGLENDIVSSNIDDTF-----GDFVFAS--------EPPISTNQVITNSVCKPV-TVSSAVDDLMGLNLGNSNTIASLSGFNMAPNISASSPALPNTAGKLDKSSILALYNNSNTSGSVMG 1009
            YC DCD+KGPRWASW +GIFLCIRCAGIHRNLGVH+S+VKSVNLD+WTP Q+A+M+E+GNSR RA+YEANL DNFRRPQTDS+LE FIR KYE KRYIA+E+ P  P V+S+ +E+++LE +Q +K    +       +  I  R   +  V++   E +   +T  NN  DLLGL+N     N ++ F         F S        + P+S+    T  + KP  T SS   DL+GL+ G +N +        A N +        +  K+ K SILALY  S +  S +G
Sbjct:   33 YCADCDAKGPRWASWNIGIFLCIRCAGIHRNLGVHISKVKSVNLDTWTPMQLAVMREMGNSRARAVYEANLPDNFRRPQTDSALETFIRAKYEQKRYIAQEYTPSKPDVESLMKELQRLELSQKKKSPTVSLGAHLQHSTGIMHRPTKELPVTSS--ETNNINRT--NNDFDLLGLDNASGPENKNNLFDHGGPSQATFGSQQKQSTVGQQPVSSLVDTTKHIQKPKDTASSLTSDLLGLDFGCTNLVGE-----RATNAANDGQLSSGSTSKITKDSILALYQQSASQPSSLG 317          
BLAST of Arf-GAP domain-containing protein vs. TrEMBL
Match: A0A5K4EPN2 (Putative smap1 OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 243.432 bits (620), Expect = 2.791e-69
Identity = 134/294 (45.58%), Postives = 178/294 (60.54%), Query Frame = 2
Query:  170 YCVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDNFRRPQTDSSLEQFIRGKYEHKRYIAKEWIPPTPSVDSISEEIRKLEQNQNRKRVNYXXXXXXXXXXXXXRREIIDNSVSTKKDEVDEKQQTVVNNKVDLLGLENDIVSSNIDDTF-----GDFVFAS--------EPPISTNQVITNSVCKPV-TVSSAVDDLMGLNLGNSNTIASLSGFNMAPNISASSPALPNTAGKLDKSSILALYNNSNTSGSVMG 1009
            YC DCD+KGPRWASW +GIFLCIRCAGIHRNLGVH+S+VKSVNLD+WTP Q+A+M+E+GNSR RA+YEANL DNFRRPQTDS+LE FIR KYE KRYIA+E+ P  P V+S+ +E+++LE +Q +K    +       +  I  R   +  V++   E +   +T  NN  DLLGL+N     N ++ F         F S        + P+S+    T  + KP  T SS   DL+GL+ G +N +        A N +        +  K+ K SILALY  S +  S +G
Sbjct:   33 YCADCDAKGPRWASWNIGIFLCIRCAGIHRNLGVHISKVKSVNLDTWTPMQLAVMREMGNSRARAVYEANLPDNFRRPQTDSALETFIRAKYEQKRYIAQEYTPSKPDVESLMKELQRLELSQKKKSPTVSLGAHLQHSTGIMHRPTKELPVTS--SETNNINRT--NNDFDLLGLDNASGPENKNNLFDHGGPSQATFGSQQKQSTVGQQPVSSLVDTTKHIQKPKDTASSLTSDLLGLDFGCTNLVGE-----RATNAANDGQLSSGSTSKITKDSILALYQQSASQPSSLG 317          
BLAST of Arf-GAP domain-containing protein vs. TrEMBL
Match: A0A3Q0KNL1 (Putative smap1 OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 243.432 bits (620), Expect = 3.249e-69
Identity = 134/294 (45.58%), Postives = 178/294 (60.54%), Query Frame = 2
Query:  170 YCVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDNFRRPQTDSSLEQFIRGKYEHKRYIAKEWIPPTPSVDSISEEIRKLEQNQNRKRVNYXXXXXXXXXXXXXRREIIDNSVSTKKDEVDEKQQTVVNNKVDLLGLENDIVSSNIDDTF-----GDFVFAS--------EPPISTNQVITNSVCKPV-TVSSAVDDLMGLNLGNSNTIASLSGFNMAPNISASSPALPNTAGKLDKSSILALYNNSNTSGSVMG 1009
            YC DCD+KGPRWASW +GIFLCIRCAGIHRNLGVH+S+VKSVNLD+WTP Q+A+M+E+GNSR RA+YEANL DNFRRPQTDS+LE FIR KYE KRYIA+E+ P  P V+S+ +E+++LE +Q +K    +       +  I  R   +  V++   E +   +T  NN  DLLGL+N     N ++ F         F S        + P+S+    T  + KP  T SS   DL+GL+ G +N +        A N +        +  K+ K SILALY  S +  S +G
Sbjct:   33 YCADCDAKGPRWASWNIGIFLCIRCAGIHRNLGVHISKVKSVNLDTWTPMQLAVMREMGNSRARAVYEANLPDNFRRPQTDSALETFIRAKYEQKRYIAQEYTPSKPDVESLMKELQRLELSQKKKSPTVSLGAHLQHSTGIMHRPTKELPVTS--SETNNINRT--NNDFDLLGLDNASGPENKNNLFDHGGPSQATFGSQQKQSTVGQQPVSSLVDTTKHIQKPKDTASSLTSDLLGLDFGCTNLVGE-----RATNAANDGQLSSGSTSKITKDSILALYQQSASQPSSLG 317          
BLAST of Arf-GAP domain-containing protein vs. TrEMBL
Match: A0A430QRD4 (Stromal membrane-associated protein OS=Schistosoma bovis OX=6184 GN=DC041_0002234 PE=4 SV=1)

HSP 1 Score: 243.047 bits (619), Expect = 3.914e-69
Identity = 133/286 (46.50%), Postives = 178/286 (62.24%), Query Frame = 2
Query:  170 YCVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDNFRRPQTDSSLEQFIRGKYEHKRYIAKEWIPPTPSVDSISEEIRKLEQNQNRKRVNYXXXXXXXXXXXXXRREIIDNSVSTKKDEVDEKQQTVVNNKVDLLGLENDIVSSNIDDTFGDFVF-------------ASEPPISTNQVITNSVCKPV-TVSSAVDDLMGLNLGNSNTIASLSGFNMAPNISASSPALPNTAGKLDKSSILALYNNS 985
            YC DCD+KGPRWASW +GIFLCIRCAGIHRNLGVH+S+VKSVNLD+WTP Q+A+M+E+GNSR RA+YEANL DNFRRPQTD++LE FIR KYE KRYIA+E+ P  P V+S+ +E+++LE +Q +K    +         S + R   +  V++   E D   +T  NN  DLLGL++     N ++ F    F             A + P+S+    T  + KP  T SS   DL+GL+ G +N +   +  N+A +   SS     +  K+ K SILALY  S
Sbjct:   33 YCADCDAKGPRWASWNIGIFLCIRCAGIHRNLGVHISKVKSVNLDTWTPMQLAVMREMGNSRARAVYEANLPDNFRRPQTDAALETFIRAKYEQKRYIAQEYTPSKPDVESLMKELQRLELSQKKKSPTVSLGAHLQQPTSRTHRPSKELPVTSS--ETDNVNRT--NNDFDLLGLDSASSPENKNNLFDHGGFSQATFGNQQKQSTAGQQPVSSLVDTTQHIQKPKDTASSLTSDLLGLDFGCTNLVGEKTT-NVANDGQVSS----GSTSKITKDSILALYQQS 309          
BLAST of Arf-GAP domain-containing protein vs. TrEMBL
Match: A0A095AMQ1 (Stromal membrane-associated protein 1 OS=Schistosoma haematobium OX=6185 GN=MS3_03726 PE=4 SV=1)

HSP 1 Score: 239.195 bits (609), Expect = 2.012e-67
Identity = 135/301 (44.85%), Postives = 179/301 (59.47%), Query Frame = 2
Query:  170 YCVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDNFRRPQTDSSLEQFIRGKYEHKRYIAKEWIPPTPSVDSISEEIRKLEQNQNRKRVNYXXXXXXXXXXXXXRRE--------------IIDNSVST-KKDEVDEKQQTVVNNKVDLLGLENDIVSSNIDDTFGDFVF-------------ASEPPISTNQVITNSVCKPV-TVSSAVDDLMGLNLGNSNTIASLSGFNMAPNISASSPALPNTAGKLDKSSILALYNNS 985
            YC DCD+KGPRWASW +GIFLCIRCAGIHRNLGVH+S+VKSVNLD+WTP Q+A+M+E+GNSR RA+YEANL DNFRRPQTD++LE FIR KYE KRYIA+E+ P  P V+S+ +E+++LE +Q +K    +         S + R               I+ +  S  K  E D   +T  NN  DLLGL++     N ++ F    F             A + P+S+    T  + KP  T SS   DL+GL+ G +N +   +  N+A +   SS     +  K+ K SILALY  S
Sbjct:   33 YCADCDAKGPRWASWNIGIFLCIRCAGIHRNLGVHISKVKSVNLDTWTPMQLAVMREMGNSRARAVYEANLPDNFRRPQTDAALETFIRAKYEQKRYIAQEYTPSKPDVESLMKELQRLELSQKKKSPTVSLGAHLQQPTSRTHRPSKELPVTYAYWLALILRHGFSLFKSSETDNVNRT--NNDFDLLGLDSASSPENKNNLFDHGGFSQATFGNQQKQSTAGQQPVSSLVDTTQHIQKPKDTASSLTSDLLGLDFGCTNLVGEKTT-NVANDGQVSS----GSTSKITKDSILALYQQS 326          
BLAST of Arf-GAP domain-containing protein vs. Ensembl Cavefish
Match: smap1 (small ArfGAP 1 [Source:NCBI gene;Acc:103038877])

HSP 1 Score: 159.844 bits (403), Expect = 3.080e-42
Identity = 62/89 (69.66%), Postives = 78/89 (87.64%), Query Frame = 2
Query:  170 YCVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDNFRRPQTDSSLEQFIR 436
            YC DC++KGPRWASW LG+F+CIRCAGIHRNLGVH+SRVKSVNLD WTP+Q+  ++ +GN++ R +YEA+L DNFRRPQTD ++E FIR
Sbjct:   32 YCADCEAKGPRWASWNLGVFICIRCAGIHRNLGVHISRVKSVNLDQWTPEQIQSVQSMGNTKARQLYEAHLPDNFRRPQTDQAVEFFIR 120          
BLAST of Arf-GAP domain-containing protein vs. Ensembl Cavefish
Match: smap1 (small ArfGAP 1 [Source:NCBI gene;Acc:103038877])

HSP 1 Score: 159.844 bits (403), Expect = 3.099e-42
Identity = 62/89 (69.66%), Postives = 78/89 (87.64%), Query Frame = 2
Query:  170 YCVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDNFRRPQTDSSLEQFIR 436
            YC DC++KGPRWASW LG+F+CIRCAGIHRNLGVH+SRVKSVNLD WTP+Q+  ++ +GN++ R +YEA+L DNFRRPQTD ++E FIR
Sbjct:   32 YCADCEAKGPRWASWNLGVFICIRCAGIHRNLGVHISRVKSVNLDQWTPEQIQSVQSMGNTKARQLYEAHLPDNFRRPQTDQAVEFFIR 120          
BLAST of Arf-GAP domain-containing protein vs. Ensembl Cavefish
Match: smap1 (small ArfGAP 1 [Source:NCBI gene;Acc:103038877])

HSP 1 Score: 160.229 bits (404), Expect = 3.870e-42
Identity = 62/89 (69.66%), Postives = 78/89 (87.64%), Query Frame = 2
Query:  170 YCVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDNFRRPQTDSSLEQFIR 436
            YC DC++KGPRWASW LG+F+CIRCAGIHRNLGVH+SRVKSVNLD WTP+Q+  ++ +GN++ R +YEA+L DNFRRPQTD ++E FIR
Sbjct:   32 YCADCEAKGPRWASWNLGVFICIRCAGIHRNLGVHISRVKSVNLDQWTPEQIQSVQSMGNTKARQLYEAHLPDNFRRPQTDQAVEFFIR 120          
BLAST of Arf-GAP domain-containing protein vs. Ensembl Cavefish
Match: smap1 (small ArfGAP 1 [Source:NCBI gene;Acc:103038877])

HSP 1 Score: 159.844 bits (403), Expect = 4.164e-42
Identity = 62/89 (69.66%), Postives = 78/89 (87.64%), Query Frame = 2
Query:  170 YCVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDNFRRPQTDSSLEQFIR 436
            YC DC++KGPRWASW LG+F+CIRCAGIHRNLGVH+SRVKSVNLD WTP+Q+  ++ +GN++ R +YEA+L DNFRRPQTD ++E FIR
Sbjct:   32 YCADCEAKGPRWASWNLGVFICIRCAGIHRNLGVHISRVKSVNLDQWTPEQIQSVQSMGNTKARQLYEAHLPDNFRRPQTDQAVEFFIR 120          
BLAST of Arf-GAP domain-containing protein vs. Ensembl Cavefish
Match: smap2 (small ArfGAP2 [Source:ZFIN;Acc:ZDB-GENE-060503-374])

HSP 1 Score: 108.997 bits (271), Expect = 3.916e-25
Identity = 50/100 (50.00%), Postives = 64/100 (64.00%), Query Frame = 2
Query:  170 YCVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDNFRRPQTDSSLEQFIRGKYEHKRYIAK 469
            +C DC                  R  GIHRNLGVH+SRVKSVNLD WT +Q+  ++E+GN++ R +YEA L + F+RP+TD S E FIR KYE K+YI K
Sbjct:   27 FCADC------------------RAKGIHRNLGVHISRVKSVNLDQWTQEQIQCVQEMGNAKARRLYEAFLPECFQRPETDQSAELFIRDKYEKKKYIDK 108          
BLAST of Arf-GAP domain-containing protein vs. Ensembl Sea Lamprey
Match: smap1 (small ArfGAP 1 [Source:ZFIN;Acc:ZDB-GENE-060920-2])

HSP 1 Score: 172.555 bits (436), Expect = 3.094e-47
Identity = 114/317 (35.96%), Postives = 162/317 (51.10%), Query Frame = 2
Query:  170 YCVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDNFRRPQTDSSLEQFIRGKYEHKRYIAKEW------IPPTPSVDSISE------EIRKLEQNQNRKRVNYXXXXXXXXXXXXXRREIID--NSVSTKKDEVDEKQQ-------------TVVNNKVDLLGLEN-------------------DIVSSNIDDTFGDFVFASEP-PISTNQVITNSVCKPVTVSSAVDDLMGLNLGNSNTIASLSGFNMAPNISASSPALPNTAGKLDKSSILALYN 979
            YC DC++KGPRWASW LG+F+CIRCAGIHRNLGVH+SRVKSVNLD WTP+Q+  ++E+GN + R +YEANL D+FRRPQ+D ++E FIR KYE K+Y+ K        +  T S   +S        ++K E+ +  +RV       +          + D   +V+ +  +  E+QQ                   VDLLGLE+                     + S++ D FG  V  S P P+ST+QV  +S   P + S+        + G+SN ++  S        +A  P        L K SI++LY 
Sbjct:   32 YCADCEAKGPRWASWNLGVFVCIRCAGIHRNLGVHISRVKSVNLDQWTPEQIQNIQEMGNRKARRLYEANLPDSFRRPQSDHAVEIFIREKYEKKKYMDKSLDINALKVSNTNSAMVMSTGKQATVAVKKHEKKEKDRRVEEKKKEKAVPFSKPKAVSLGDTVKAVTLEDQKSPEQQQQRPPIPLAKAAPPKPAVPPVDLLGLEDGNNAQGWHSDGSAVPNGTGGGMGSDL-DIFGPMV--SNPLPVSTSQVCQDSTGMPASESA--------DSGSSNDLSLFSEAAAKAEDAAKKP--------LTKDSIMSLYG 329          
BLAST of Arf-GAP domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000548.1 (pep scaffold:Pmarinus_7.0:GL476772:99521:119783:-1 gene:ENSPMAG00000000494.1 transcript:ENSPMAT00000000548.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 135.961 bits (341), Expect = 3.155e-38
Identity = 55/93 (59.14%), Postives = 74/93 (79.57%), Query Frame = 2
Query:  194 GPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDNFRRPQTDSSLEQFIRGKYEHKRYIAKE 472
            GPRWASW LG+F+CIRCAGIHRNLGVH++RVKSVNLD WT +Q+  M+++GN + + +YE  L  +FRRP +D + E FIR KY+ KRY+ ++
Sbjct:    1 GPRWASWNLGVFICIRCAGIHRNLGVHIARVKSVNLDQWTSEQIQHMQDMGNGKAKKLYEGFLPKDFRRPVSDQAAEAFIRDKYDKKRYMDRD 93          
BLAST of Arf-GAP domain-containing protein vs. Ensembl Sea Lamprey
Match: acap3b (ArfGAP with coiled-coil, ankyrin repeat and PH domains 3b [Source:ZFIN;Acc:ZDB-GENE-070209-274])

HSP 1 Score: 100.523 bits (249), Expect = 4.992e-23
Identity = 51/118 (43.22%), Postives = 73/118 (61.86%), Query Frame = 2
Query:  173 CVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLED-NFRRPQTDSSL---EQFIRGKYEHKRYIAKEWIPPTPSVDSISEE 514
            C DC    PRWAS  LGI LCI C+GIHR+LGVH S+V+S+ LDSW P+ + +M E+GN     IYEA+ +D   ++P   SS    E +IR K     Y+ ++++ P P    +++E
Sbjct:   82 CCDCGQPDPRWASINLGIALCIECSGIHRSLGVHCSKVRSLTLDSWEPELLKLMCELGNHVINDIYEASADDVGGKKPTPSSSRQEKEMWIRAK-----YVDRKFLRPFPEAARLAQE 194          
BLAST of Arf-GAP domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006444.1 (pep scaffold:Pmarinus_7.0:GL477103:5377:54062:-1 gene:ENSPMAG00000005792.1 transcript:ENSPMAT00000006444.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 97.4413 bits (241), Expect = 2.049e-21
Identity = 41/82 (50.00%), Postives = 56/82 (68.29%), Query Frame = 2
Query:  170 YCVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDNFRRPQTDS 415
            +CVDCD+  P WAS  LG  +CI C+GIHRNLG HLSRV+S++LD W  +  A+M  IGN+    ++EA+ +    +PQ DS
Sbjct:  576 FCVDCDAPSPDWASLNLGALMCIECSGIHRNLGTHLSRVRSLDLDDWPLELAAVMLAIGNATANGVWEADTQ-GLGKPQPDS 656          
BLAST of Arf-GAP domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000824.1 (pep scaffold:Pmarinus_7.0:GL477349:152854:172297:-1 gene:ENSPMAG00000000731.1 transcript:ENSPMAT00000000824.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 86.6557 bits (213), Expect = 1.096e-18
Identity = 40/92 (43.48%), Postives = 57/92 (61.96%), Query Frame = 2
Query:  197 PRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDNFRRPQTDSSL---EQFIRGKYEHKRYI 463
            P WAS+TLG+F+C+ C+GIHRN+   +SRVKS+ LD W  +QV  M   GN   + +YE  +   + RP  D      EQ+IR +YE + +I
Sbjct:    2 PDWASYTLGVFICLHCSGIHRNM-TEVSRVKSLRLDFWEDEQVEFMASKGNVAAKELYEQRIPPFYYRPTADDCQVLKEQWIRARYERREFI 92          
BLAST of Arf-GAP domain-containing protein vs. Ensembl Yeast
Match: AGE2 (ADP-ribosylation factor (ARF) GTPase activating protein (GAP) effector; involved in Trans-Golgi-Network (TGN) transport; contains C2C2H2 cysteine/histidine motif [Source:SGD;Acc:S000001306])

HSP 1 Score: 115.931 bits (289), Expect = 4.039e-29
Identity = 51/103 (49.51%), Postives = 75/103 (72.82%), Query Frame = 2
Query:  170 YCVDCDSK-GPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNS-RGRAIYEANLEDNFR-RPQTD-SSLEQFIRGKYEHKRYIA 466
            +C DC ++  PRWASW+LG+F+CI+CAGIHR+LG H+S+VKSV+LD+W  + +  + +  N+ R  + YEA L D  + R  TD SSL+ FI+ KYE+K++I 
Sbjct:   22 HCADCKAQLHPRWASWSLGVFICIKCAGIHRSLGTHISKVKSVDLDTWKEEHLVKLIQFKNNLRANSYYEATLADELKQRKITDTSSLQNFIKNKYEYKKWIG 124          
BLAST of Arf-GAP domain-containing protein vs. Ensembl Yeast
Match: GCS1 (ADP-ribosylation factor GTPase activating protein (ARF GAP); involved in ER-Golgi transport; required for prospore membrane formation; regulates phospholipase Spo14p; shares functional similarity with Glo3p; GCS1 has a paralog, SPS18, that arose from the whole genome duplication [Source:SGD;Acc:S000002385])

HSP 1 Score: 76.6406 bits (187), Expect = 1.385e-15
Identity = 27/59 (45.76%), Postives = 43/59 (72.88%), Query Frame = 2
Query:  173 CVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGN 349
            C+DC +  P+WA+   G F+C+ CAGIHR LGVH+S V+S+ +D + P+++  M++ GN
Sbjct:   26 CMDCGAPNPQWATPKFGAFICLECAGIHRGLGVHISFVRSITMDQFKPEELLRMEKGGN 84          
BLAST of Arf-GAP domain-containing protein vs. Ensembl Yeast
Match: GLO3 (ADP-ribosylation factor GTPase activating protein (ARF GAP); involved in ER-Golgi transport; shares functional similarity with Gcs1p [Source:SGD;Acc:S000000924])

HSP 1 Score: 77.7962 bits (190), Expect = 1.529e-15
Identity = 30/69 (43.48%), Postives = 41/69 (59.42%), Query Frame = 2
Query:  173 CVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEAN 379
            C DC +K P W S   G+ LCI+C+ +HRN+GVH++ VKS  LD WT   +   K  GN + R  +  N
Sbjct:   31 CFDCGNKNPTWTSVPFGVMLCIQCSAVHRNMGVHITFVKSSTLDKWTINNLRRFKLGGNHKARDFFLKN 99          
BLAST of Arf-GAP domain-containing protein vs. Ensembl Yeast
Match: AGE1 (ADP-ribosylation factor (ARF) GTPase activating protein (GAP) effector; involved in the secretory and endocytic pathways; contains C2C2H2 cysteine/histidine motif [Source:SGD;Acc:S000002932])

HSP 1 Score: 68.9366 bits (167), Expect = 9.345e-13
Identity = 38/104 (36.54%), Postives = 62/104 (59.62%), Query Frame = 2
Query:  173 CVDCDSKGP-RWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKE--IGNSRGRAIYEANLEDNFRRPQT----DSSLEQFIRGKYEHKRYI 463
            C DC S     W S  L   LCI+C+G+HR+LG H+S+++S+ LD++T  ++  + +  + NS   AIYE+NL +   +  T    DS   +FI  KY+ K+++
Sbjct:  186 CCDCGSTATVEWVSINLLCILCIKCSGVHRSLGSHISKIRSLTLDNFTSLELMHLLQNNVSNSNVNAIYESNLRNFPVKKITANSDDSERSKFIIDKYQFKKFV 289          
BLAST of Arf-GAP domain-containing protein vs. Ensembl Yeast
Match: GTS1 (Protein involved in Arf3p regulation and in transcription regulation; localizes to the nucleus and to endocytic patches; contains an N-terminal Zn-finger and ArfGAP homology domain, a C-terminal glutamine-rich region, and a UBA (ubiquitin associated) domain; gts1 mutations affect budding, cell size, heat tolerance, sporulation, life span, ultradian rhythms, endocytosis; expression oscillates in a pattern similar to metabolic oscillations [Source:SGD;Acc:S000003149])

HSP 1 Score: 61.2326 bits (147), Expect = 1.784e-10
Identity = 35/110 (31.82%), Postives = 55/110 (50.00%), Query Frame = 2
Query:  173 CVDCDSKGPRWASWTLGIFLCIRCAGIHRN-LGVH----LSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIY--EANLEDNFRRPQTDSSLEQFIRGKYEHKRYIAKEWIP 481
            C +C +  P W S  LG+FLC RCA +HR   G       S VKS+++D WT + +  +  +G ++G A +    N+   F      + +E +IR KY   ++   E  P
Sbjct:   30 CGECGNFYPTWCSVNLGVFLCGRCASVHRKVFGSRDDDAFSNVKSLSMDRWTREDIDELVSLGGNKGNARFWNPKNVPFPFDGDDDKAIVEHYIRDKYILGKFRYDEIKP 139          
BLAST of Arf-GAP domain-containing protein vs. Ensembl Nematostella
Match: EDO33091 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST58])

HSP 1 Score: 155.992 bits (393), Expect = 5.712e-45
Identity = 65/101 (64.36%), Postives = 82/101 (81.19%), Query Frame = 2
Query:  170 YCVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDNFRRPQTDSSLEQFIRGKYEHKRYIAKE 472
            YC DC +KGPRWASW LG+F+CIRCAGIHRNLGVH+S+VKSVNLDSWT +Q+A ++  GN R    +E  L ++FRRPQTDS++E FIR KYE K++I K+
Sbjct:   31 YCADCAAKGPRWASWNLGVFICIRCAGIHRNLGVHISKVKSVNLDSWTEEQMASIQSWGNRRAGLYWECYLPEDFRRPQTDSAMEAFIRKKYEQKKFIKKD 131          
BLAST of Arf-GAP domain-containing protein vs. Ensembl Nematostella
Match: EDO47919 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKJ9])

HSP 1 Score: 105.145 bits (261), Expect = 1.777e-24
Identity = 49/100 (49.00%), Postives = 68/100 (68.00%), Query Frame = 2
Query:  173 CVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDNFRRPQ-TDSSL--EQFIRGKYEHKRYI 463
            C DC +K P WAS + GIF+CI C+G+HRNLG  +S VKS+ LD+WT +++  M E GN +  AI+  N+   +RRP+ TD  +  EQ+IR KYE K +I
Sbjct:   20 CADCGAKHPEWASASKGIFICITCSGVHRNLGTQISVVKSLRLDTWTDERLQFMIENGNEKSNAIWAKNVPICYRRPKCTDPHVLREQWIRAKYERKEFI 119          
BLAST of Arf-GAP domain-containing protein vs. Ensembl Nematostella
Match: EDO37809 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEL6])

HSP 1 Score: 102.834 bits (255), Expect = 4.552e-23
Identity = 43/100 (43.00%), Postives = 67/100 (67.00%), Query Frame = 2
Query:  173 CVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDNFRR---PQTDSSLEQFIRGKYEHKRYI 463
            C DC+   P+WAS  LG+ LCI C+GIHR+LGVH+S+V+S+ LD+W P+ + +M E+GNS   +IYEA +  + ++       S  E +I+ KY + R++
Sbjct:  420 CADCNHNDPKWASINLGVVLCIECSGIHRSLGVHVSKVRSLTLDAWEPEHLKLMSELGNSLINSIYEAKIAGDHKKINHLSNRSDREAWIKSKYIYHRFV 519          
BLAST of Arf-GAP domain-containing protein vs. Ensembl Nematostella
Match: EDO42956 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S052])

HSP 1 Score: 100.523 bits (249), Expect = 4.903e-22
Identity = 50/119 (42.02%), Postives = 75/119 (63.03%), Query Frame = 2
Query:  173 CVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDNFRRPQTDSSLEQ---FIRGKYEHKRYIAKEWIPPTPSVD-SISEEI 517
            CVDC +  P WAS  LG  +CI C+G+HRN+G H+SRV+S++LD W  +  A+M  IGNS   +I+E  +  N  +P   SS E+   +IR KYE+K ++++      PS D S+ E++
Sbjct:  564 CVDCGAPNPDWASLNLGALMCIECSGVHRNIGTHVSRVRSLDLDDWPSEVTAVMCSIGNSLANSIWEGRI-GNREKPTPSSSREEKERWIRSKYENKDFLSE-----LPSCDFSLGEQL 676          
BLAST of Arf-GAP domain-containing protein vs. Ensembl Nematostella
Match: EDO43007 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZU7])

HSP 1 Score: 94.7449 bits (234), Expect = 3.024e-20
Identity = 41/99 (41.41%), Postives = 61/99 (61.62%), Query Frame = 2
Query:  170 YCVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLED--NFRRPQTDSSLEQFIRGKYEHKRY 460
            YC DC +  P WAS  LGI +CI C+G+HR++GVH+S+V+S+ LD W    V  M+ +GN++   I+EANL D     R       + FI+ KY  +++
Sbjct:  523 YCADCSAPRPDWASINLGITVCIECSGVHRSMGVHVSKVRSLTLDKWDGDTVEFMEAMGNTKVNKIFEANLNDFPKLTRDSGKHDRQAFIKLKYVEQKF 621          
BLAST of Arf-GAP domain-containing protein vs. Ensembl Medaka
Match: smap1 (stromal membrane-associated protein 1 [Source:NCBI gene;Acc:101169097])

HSP 1 Score: 179.104 bits (453), Expect = 1.498e-49
Identity = 92/226 (40.71%), Postives = 120/226 (53.10%), Query Frame = 2
Query:  170 YCVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDNFRRPQTDSSLEQFIRGKYEHKRYIAKEWIPPTPSVDSISEEIRKLEQNQNRKRVNYXXXXXXXXXXXXXRREIIDNSVSTKKDEVDEKQQTVVNNKVDLLGLE--------NDIVSSNID--DTFGDFVFASEPPISTNQVITNSVCKPVTV 817
            YC DC++KGPRWASW LG+F+CIRCAGIHRNLGVH+SRVKSVNLD WTP+Q+  M ++GN+R + +YEA+L +NFRRPQTD ++E FIR KYE K+Y  KE     P                +R R                  E ++   +TK  E       +    VDLL L+        ++  +S  D  D FG  V     P    Q  ++S   P  V
Sbjct:   32 YCADCEAKGPRWASWNLGVFMCIRCAGIHRNLGVHISRVKSVNLDQWTPEQIQSMVDMGNTRAKHLYEAHLPENFRRPQTDQAVEVFIRDKYERKKYYNKEAAAAAPKTSEAVPSSTLPSSQADRSRPEEREKKKEEKKRETKDSEKVEKHNNTKHSECRSNAGKITEPTVDLLDLDAPGGEGNGSEQTASTADELDVFGPMVSNPLSPSKAQQGQSSSSPAPQQV 257          
BLAST of Arf-GAP domain-containing protein vs. Ensembl Medaka
Match: SMAP1 (stromal membrane-associated protein 1 [Source:NCBI gene;Acc:101160389])

HSP 1 Score: 157.147 bits (396), Expect = 2.104e-41
Identity = 61/89 (68.54%), Postives = 78/89 (87.64%), Query Frame = 2
Query:  170 YCVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDNFRRPQTDSSLEQFIR 436
            YC DC++KGPRWASW LG+F+CIRCAGIHRNLGVH+SRVKSVNLD WT +Q+  ++++GN++ R +YEANL D+FRRPQTD ++E FIR
Sbjct:   32 YCADCEAKGPRWASWNLGVFICIRCAGIHRNLGVHISRVKSVNLDQWTSEQIQSIQDMGNTKARRLYEANLPDSFRRPQTDQAVEFFIR 120          
BLAST of Arf-GAP domain-containing protein vs. Ensembl Medaka
Match: SMAP1 (stromal membrane-associated protein 1 [Source:NCBI gene;Acc:101160389])

HSP 1 Score: 155.221 bits (391), Expect = 3.011e-41
Identity = 61/89 (68.54%), Postives = 78/89 (87.64%), Query Frame = 2
Query:  170 YCVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDNFRRPQTDSSLEQFIR 436
            YC DC++KGPRWASW LG+F+CIRCAGIHRNLGVH+SRVKSVNLD WT +Q+  ++++GN++ R +YEANL D+FRRPQTD ++E FIR
Sbjct:   32 YCADCEAKGPRWASWNLGVFICIRCAGIHRNLGVHISRVKSVNLDQWTSEQIQSIQDMGNTKARRLYEANLPDSFRRPQTDQAVEFFIR 120          
BLAST of Arf-GAP domain-containing protein vs. Ensembl Medaka
Match: smap2 (stromal membrane-associated protein 2 [Source:NCBI gene;Acc:101174757])

HSP 1 Score: 147.517 bits (371), Expect = 5.077e-38
Identity = 59/89 (66.29%), Postives = 75/89 (84.27%), Query Frame = 2
Query:  170 YCVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDNFRRPQTDSSLEQFIR 436
            +C DC+SKGPRWASW LGIF+CIRCAGIHRNLGVH+SRVKSVNLD WT +QV  ++E+GN++ + +YEA L + F+RP+TD + E FIR
Sbjct:   27 FCADCESKGPRWASWNLGIFICIRCAGIHRNLGVHISRVKSVNLDQWTQEQVQCVQEMGNAKAKRLYEAFLPECFQRPETDQAAEIFIR 115          
BLAST of Arf-GAP domain-containing protein vs. Ensembl Medaka
Match: agap3 (ArfGAP with GTPase domain, ankyrin repeat and PH domain 3 [Source:NCBI gene;Acc:101174700])

HSP 1 Score: 109.383 bits (272), Expect = 2.205e-24
Identity = 48/101 (47.52%), Postives = 69/101 (68.32%), Query Frame = 2
Query:  170 YCVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDNFRRPQTDSSLEQ---FIRGKYEHKRYI 463
            +CVDCD+  P WAS  LG  +CI C+GIHRNLG HLSRV+S++LDSW  +   +M  IGN+   +++E  LE  + +P +DS+ E+   +IR KYE K ++
Sbjct:  544 FCVDCDAPNPDWASLNLGALMCIECSGIHRNLGTHLSRVRSLDLDSWPVELSMVMTAIGNAMANSVWEGALE-GYAKPGSDSTREEKERWIRAKYEQKLFL 643          
BLAST of Arf-GAP domain-containing protein vs. Planmine SMEST
Match: SMESG000048247.1 (SMESG000048247.1)

HSP 1 Score: 749.584 bits (1934), Expect = 0.000e+0
Identity = 374/375 (99.73%), Postives = 374/375 (99.73%), Query Frame = 2
Query:  170 YCVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDNFRRPQTDSSLEQFIRGKYEHKRYIAKEWIPPTPSVDSISEEIRKLEQNQNRKRVNYXXXXXXXXXXXXXRREIIDNSVSTKKDEVDEKQQTVVNNKVDLLGLENDIVSSNIDDTFGDFVFASEPPISTNQVITNSVCKPVTVSSAVDDLMGLNLGNSNTIASLSGFNMAPNISASSPALPNTAGKLDKSSILALYNNSNTSGSVMGQMTSQSMWPNATTSAYQNSNAMHPDFQSQANYVVNGNNWAVSGQINNTSAFGVQHNPFYTNSVYPGQSVMPTISQPTFPTSVSGGHSQPPNPMLW 1294
            YCVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDNFRRPQTDSSLEQFIRGKYEHKRYIAKEWIPPTPSVDSISEEIRKLEQNQNRKRVNYNSNTTSNSTISISRREIIDN VSTKKDEVDEKQQTVVNNKVDLLGLENDIVSSNIDDTFGDFVFASEPPISTNQVITNSVCKPVTVSSAVDDLMGLNLGNSNTIASLSGFNMAPNISASSPALPNTAGKLDKSSILALYNNSNTSGSVMGQMTSQSMWPNATTSAYQNSNAMHPDFQSQANYVVNGNNWAVSGQINNTSAFGVQHNPFYTNSVYPGQSVMPTISQPTFPTSVSGGHSQPPNPMLW
Sbjct:   30 YCVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDNFRRPQTDSSLEQFIRGKYEHKRYIAKEWIPPTPSVDSISEEIRKLEQNQNRKRVNYNSNTTSNSTISISRREIIDNPVSTKKDEVDEKQQTVVNNKVDLLGLENDIVSSNIDDTFGDFVFASEPPISTNQVITNSVCKPVTVSSAVDDLMGLNLGNSNTIASLSGFNMAPNISASSPALPNTAGKLDKSSILALYNNSNTSGSVMGQMTSQSMWPNATTSAYQNSNAMHPDFQSQANYVVNGNNWAVSGQINNTSAFGVQHNPFYTNSVYPGQSVMPTISQPTFPTSVSGGHSQPPNPMLW 404          
BLAST of Arf-GAP domain-containing protein vs. Planmine SMEST
Match: SMESG000069155.1 (SMESG000069155.1)

HSP 1 Score: 150.599 bits (379), Expect = 3.099e-40
Identity = 67/124 (54.03%), Postives = 87/124 (70.16%), Query Frame = 2
Query:  173 CVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDNFRRPQTDSSLEQFIRGKYEHKRYIAKEWIPPTPSVDSISEEIRKLEQNQNR 544
            C DC ++G RWASW  GIFLCIRCAGIHRNLGVH+S+VKSV+LDSWT +Q+ +M+ +GN +   IYEA L  NF RPQT+ ++E+FIR KY++KRY      PP       +E+  K + N  R
Sbjct:   24 CADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTRPQTNYAIEEFIRSKYQYKRYCIS---PPKSDSSPTTEDNDKCKSNIAR 144          
BLAST of Arf-GAP domain-containing protein vs. Planmine SMEST
Match: SMESG000075717.1 (SMESG000075717.1)

HSP 1 Score: 109.383 bits (272), Expect = 1.960e-24
Identity = 49/114 (42.98%), Postives = 74/114 (64.91%), Query Frame = 2
Query:  173 CVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLE-DNFRRPQTDSSL---EQFIRGKYEHKRYIAKEWIPPTPSVDS 502
            C DC S  P WAS  LGI +CI C+G+HR LG HLSRV+S  LD W+ + +A+M+ IGN+   +++EA++   + ++P+ DSS    E ++R KYE K +     +PP P +D+
Sbjct:  617 CCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEKKMF-----LPPLPYLDA 725          
BLAST of Arf-GAP domain-containing protein vs. Planmine SMEST
Match: SMESG000075717.1 (SMESG000075717.1)

HSP 1 Score: 109.383 bits (272), Expect = 1.965e-24
Identity = 49/114 (42.98%), Postives = 74/114 (64.91%), Query Frame = 2
Query:  173 CVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLE-DNFRRPQTDSSL---EQFIRGKYEHKRYIAKEWIPPTPSVDS 502
            C DC S  P WAS  LGI +CI C+G+HR LG HLSRV+S  LD W+ + +A+M+ IGN+   +++EA++   + ++P+ DSS    E ++R KYE K +     +PP P +D+
Sbjct:  677 CCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEKKMF-----LPPLPYLDA 785          
BLAST of Arf-GAP domain-containing protein vs. Planmine SMEST
Match: SMESG000075717.1 (SMESG000075717.1)

HSP 1 Score: 109.383 bits (272), Expect = 1.991e-24
Identity = 49/114 (42.98%), Postives = 74/114 (64.91%), Query Frame = 2
Query:  173 CVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLE-DNFRRPQTDSSL---EQFIRGKYEHKRYIAKEWIPPTPSVDS 502
            C DC S  P WAS  LGI +CI C+G+HR LG HLSRV+S  LD W+ + +A+M+ IGN+   +++EA++   + ++P+ DSS    E ++R KYE K +     +PP P +D+
Sbjct:  722 CCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEKKMF-----LPPLPYLDA 830          
The following BLAST results are available for this feature:
BLAST of Arf-GAP domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SMAP22.057e-4264.29small ArfGAP2 [Source:HGNC Symbol;Acc:HGNC:25082][more]
SMAP18.255e-4268.54small ArfGAP 1 [Source:HGNC Symbol;Acc:HGNC:19651][more]
SMAP18.949e-4268.54small ArfGAP 1 [Source:HGNC Symbol;Acc:HGNC:19651][more]
SMAP12.266e-4168.54small ArfGAP 1 [Source:HGNC Symbol;Acc:HGNC:19651][more]
SMAP21.544e-3862.11small ArfGAP2 [Source:HGNC Symbol;Acc:HGNC:25082][more]
back to top
BLAST of Arf-GAP domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
W09D10.13.905e-4656.80pep chromosome:WBcel235:III:10736919:10739786:-1 g... [more]
W09D10.13.905e-4656.80pep chromosome:WBcel235:III:10736919:10739792:-1 g... [more]
W09D10.13.905e-4656.80pep chromosome:WBcel235:III:10736893:10739824:-1 g... [more]
cnt-23.017e-2135.65Arf-GAP with ANK repeat and PH domain-containing p... [more]
cnt-23.803e-2135.65Arf-GAP with ANK repeat and PH domain-containing p... [more]
back to top
BLAST of Arf-GAP domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG82433.239e-6167.72gene:FBgn0033349 transcript:FBtr0088652[more]
CenB1A1.997e-2244.23gene:FBgn0039056 transcript:FBtr0084369[more]
CenB1A2.960e-2244.23gene:FBgn0039056 transcript:FBtr0084368[more]
CenG1A2.892e-2140.59gene:FBgn0028509 transcript:FBtr0080548[more]
CenG1A4.085e-2140.59gene:FBgn0028509 transcript:FBtr0080547[more]
back to top
BLAST of Arf-GAP domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smap15.182e-4667.00small ArfGAP 1 [Source:ZFIN;Acc:ZDB-GENE-060920-2][more]
smap15.964e-4667.00small ArfGAP 1 [Source:ZFIN;Acc:ZDB-GENE-060920-2][more]
smap22.189e-3765.17small ArfGAP2 [Source:ZFIN;Acc:ZDB-GENE-060503-374... [more]
zgc:1628729.336e-2643.80zgc:162872 [Source:ZFIN;Acc:ZDB-GENE-081022-1][more]
si:ch211-168b3.13.661e-2442.11si:ch211-168b3.1 [Source:ZFIN;Acc:ZDB-GENE-081104-... [more]
back to top
BLAST of Arf-GAP domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ammecr1l8.243e-4970.00AMMECR1 like [Source:Xenbase;Acc:XB-GENE-5787907][more]
ammecr1l3.699e-4870.00AMMECR1 like [Source:Xenbase;Acc:XB-GENE-5787907][more]
ammecr1l4.270e-4862.39AMMECR1 like [Source:Xenbase;Acc:XB-GENE-5787907][more]
ammecr1l6.660e-4870.00AMMECR1 like [Source:Xenbase;Acc:XB-GENE-5787907][more]
foxn37.809e-4354.76forkhead box N3 [Source:Xenbase;Acc:XB-GENE-483117... [more]
back to top
BLAST of Arf-GAP domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Smap13.182e-4369.66small ArfGAP 1 [Source:MGI Symbol;Acc:MGI:2138261][more]
Smap21.070e-4264.29small ArfGAP 2 [Source:MGI Symbol;Acc:MGI:1917030][more]
Agap33.809e-2442.86ArfGAP with GTPase domain, ankyrin repeat and PH d... [more]
Agap39.726e-2442.86ArfGAP with GTPase domain, ankyrin repeat and PH d... [more]
Acap22.912e-2344.55ArfGAP with coiled-coil, ankyrin repeat and PH dom... [more]
back to top
BLAST of Arf-GAP domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5F413|SMAP2_CHICK7.120e-4433.12Stromal membrane-associated protein 2 OS=Gallus ga... [more]
sp|Q91VZ6|SMAP1_MOUSE2.226e-4269.66Stromal membrane-associated protein 1 OS=Mus muscu... [more]
sp|Q7TN29|SMAP2_MOUSE7.483e-4264.29Stromal membrane-associated protein 2 OS=Mus muscu... [more]
sp|Q5EA00|SMAP2_BOVIN9.306e-4264.29Stromal membrane-associated protein 2 OS=Bos tauru... [more]
sp|Q8WU79|SMAP2_HUMAN9.876e-4264.29Stromal membrane-associated protein 2 OS=Homo sapi... [more]
back to top
BLAST of Arf-GAP domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G4VST01.526e-7045.58Putative smap1 OS=Schistosoma mansoni OX=6183 GN=S... [more]
A0A5K4EPN22.791e-6945.58Putative smap1 OS=Schistosoma mansoni OX=6183 PE=4... [more]
A0A3Q0KNL13.249e-6945.58Putative smap1 OS=Schistosoma mansoni OX=6183 PE=4... [more]
A0A430QRD43.914e-6946.50Stromal membrane-associated protein OS=Schistosoma... [more]
A0A095AMQ12.012e-6744.85Stromal membrane-associated protein 1 OS=Schistoso... [more]
back to top
BLAST of Arf-GAP domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smap13.080e-4269.66small ArfGAP 1 [Source:NCBI gene;Acc:103038877][more]
smap13.099e-4269.66small ArfGAP 1 [Source:NCBI gene;Acc:103038877][more]
smap13.870e-4269.66small ArfGAP 1 [Source:NCBI gene;Acc:103038877][more]
smap14.164e-4269.66small ArfGAP 1 [Source:NCBI gene;Acc:103038877][more]
smap23.916e-2550.00small ArfGAP2 [Source:ZFIN;Acc:ZDB-GENE-060503-374... [more]
back to top
BLAST of Arf-GAP domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smap13.094e-4735.96small ArfGAP 1 [Source:ZFIN;Acc:ZDB-GENE-060920-2][more]
ENSPMAT00000000548.13.155e-3859.14pep scaffold:Pmarinus_7.0:GL476772:99521:119783:-1... [more]
acap3b4.992e-2343.22ArfGAP with coiled-coil, ankyrin repeat and PH dom... [more]
ENSPMAT00000006444.12.049e-2150.00pep scaffold:Pmarinus_7.0:GL477103:5377:54062:-1 g... [more]
ENSPMAT00000000824.11.096e-1843.48pep scaffold:Pmarinus_7.0:GL477349:152854:172297:-... [more]
back to top
BLAST of Arf-GAP domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
AGE24.039e-2949.51ADP-ribosylation factor (ARF) GTPase activating pr... [more]
GCS11.385e-1545.76ADP-ribosylation factor GTPase activating protein ... [more]
GLO31.529e-1543.48ADP-ribosylation factor GTPase activating protein ... [more]
AGE19.345e-1336.54ADP-ribosylation factor (ARF) GTPase activating pr... [more]
GTS11.784e-1031.82Protein involved in Arf3p regulation and in transc... [more]
back to top
BLAST of Arf-GAP domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO330915.712e-4564.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479191.777e-2449.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO378094.552e-2343.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO429564.903e-2242.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO430073.024e-2041.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Arf-GAP domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smap11.498e-4940.71stromal membrane-associated protein 1 [Source:NCBI... [more]
SMAP12.104e-4168.54stromal membrane-associated protein 1 [Source:NCBI... [more]
SMAP13.011e-4168.54stromal membrane-associated protein 1 [Source:NCBI... [more]
smap25.077e-3866.29stromal membrane-associated protein 2 [Source:NCBI... [more]
agap32.205e-2447.52ArfGAP with GTPase domain, ankyrin repeat and PH d... [more]
back to top
BLAST of Arf-GAP domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000048247.10.000e+099.73SMESG000048247.1[more]
SMESG000069155.13.099e-4054.03SMESG000069155.1[more]
SMESG000075717.11.960e-2442.98SMESG000075717.1[more]
SMESG000075717.11.965e-2442.98SMESG000075717.1[more]
SMESG000075717.11.991e-2442.98SMESG000075717.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031852 ID=SMED30031852|Name=Arf-GAP domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1913bp
GTTTTATTGTTTTATTTGAATTTGTGTATTAGGTTAAAAATTTGTGTACA
TAGCAAATTAATAATTTTCTATTCAAAATTTTATGGCAAATAAAAAAGAA
AAGGAAAAGCAATTACAAGATAAATTGCAAATTATTCTTGCAGATCTTTT
AAAAGATGACGATAACAAATATTGTGTTGATTGTGATTCTAAAGGACCAA
GATGGGCTTCTTGGACATTAGGGATCTTTCTTTGCATTCGATGTGCAGGA
ATTCATCGAAATTTAGGCGTGCATTTATCTCGAGTAAAATCAGTAAATTT
AGATTCATGGACACCACAACAAGTTGCGATGATGAAAGAGATTGGTAATA
GTCGGGGTCGAGCGATTTATGAAGCAAACCTTGAGGATAATTTTCGTCGT
CCTCAAACCGATTCATCTTTGGAACAATTTATACGCGGGAAATATGAGCA
CAAACGGTACATTGCTAAAGAATGGATTCCACCAACTCCTTCGGTAGACT
CAATTTCTGAAGAAATTCGAAAATTAGAGCAAAATCAAAACAGGAAACGA
GTAAATTATAACTCTAATACAACAAGCAATTCGACTATATCGATATCAAG
ACGGGAAATTATTGATAATTCAGTTTCTACCAAAAAGGACGAGGTTGACG
AGAAACAACAAACAGTTGTCAACAACAAAGTTGATTTACTTGGCTTGGAA
AATGATATCGTATCAAGTAACATTGACGACACTTTCGGAGATTTTGTGTT
TGCTTCTGAACCACCGATATCTACTAACCAGGTTATCACAAATTCTGTTT
GCAAACCGGTTACCGTTTCATCGGCTGTGGACGATTTGATGGGGCTTAAT
TTGGGCAATTCGAATACCATTGCCAGTCTGTCTGGCTTCAACATGGCTCC
GAATATATCAGCATCTTCTCCAGCTTTACCGAATACTGCTGGGAAACTCG
ACAAAAGTTCTATTCTTGCTCTATATAACAACAGTAATACAAGTGGCAGT
GTCATGGGACAAATGACAAGCCAATCCATGTGGCCAAACGCCACAACATC
AGCATATCAAAACAGTAATGCAATGCATCCAGATTTCCAATCTCAAGCTA
ATTATGTTGTTAATGGCAATAACTGGGCGGTGTCGGGTCAAATTAATAAT
ACCAGTGCGTTCGGGGTTCAACACAATCCATTTTATACAAATTCTGTATA
TCCAGGTCAATCAGTGATGCCTACCATATCACAGCCAACATTTCCAACCA
GTGTTTCTGGCGGCCACAGCCAGCCTCCCAATCCAATGCTGTGGTAACGA
TGACGACGAATGGGTAATTGTTCCATGAAGAACAGTTTTCCTGAGAATTC
TAATATTAATAATGATGACGATGAGGAAAATAATAATTTGTTTGTCTTCA
TTTGCTTATTATTCGTATTATTGTTATTATTATTTTATATCAGATGTCTG
TTATTGTGATTTACTTGCTTATACAATGGAAACGCATAGTACTATCCCCA
CTCTACTTATTGAGCGCATCAAAAAATCAACAAGTATAAAAAGATAGAAT
ATTTGGAATAGTTGAATAAAAATTTATGCCATTGAACTGTGGCGAAGTGC
TATTTCAATTTTATTGATTGATCAATTAGTGTGGCCAATCGTTTATGATT
CTTCTCAGTTGGTAATTGTGCTGTGACGTATCTAGTGAGATTGTGATCAT
TTTTTTGGATCGCATTTACTGTCTGATGTGCTTTGTGAATATTATGGTTC
TTTTATTAATGATTTTTATCTTATTTTATTCGCTTAGCTGCTAATTTTGA
ACAATTAACTTTTTGATATATTTGTTTTATAGAAACAAATCATCTACATC
CGTAACTTTGAAATCAACTTGAAATTTTAATATAAATAGTGAATTGTGAG
AATTCGATGCAAG
back to top

protein sequence of SMED30031852-orf-1

>SMED30031852-orf-1 ID=SMED30031852-orf-1|Name=SMED30031852-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=405bp
MANKKEKEKQLQDKLQIILADLLKDDDNKYCVDCDSKGPRWASWTLGIFL
CIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANL
EDNFRRPQTDSSLEQFIRGKYEHKRYIAKEWIPPTPSVDSISEEIRKLEQ
NQNRKRVNYNSNTTSNSTISISRREIIDNSVSTKKDEVDEKQQTVVNNKV
DLLGLENDIVSSNIDDTFGDFVFASEPPISTNQVITNSVCKPVTVSSAVD
DLMGLNLGNSNTIASLSGFNMAPNISASSPALPNTAGKLDKSSILALYNN
SNTSGSVMGQMTSQSMWPNATTSAYQNSNAMHPDFQSQANYVVNGNNWAV
SGQINNTSAFGVQHNPFYTNSVYPGQSVMPTISQPTFPTSVSGGHSQPPN
PMLW*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0005096GTPase activator activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR038508ArfGAP_dom_sf
IPR037278ARFGAP/RecO
IPR001164ArfGAP_dom
Vocabulary: biological process
TermDefinition
GO:0043547positive regulation of GTPase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1..21
NoneNo IPR availableCOILSCoilCoilcoord: 138..158
NoneNo IPR availablePANTHERPTHR45705FAMILY NOT NAMEDcoord: 2..386
NoneNo IPR availableCDDcd08839ArfGap_SMAPcoord: 19..121
e-value: 8.41735E-74
score: 223.302
IPR001164Arf GTPase activating proteinPRINTSPR00405REVINTRACTNGcoord: 47..64
score: 61.49
coord: 68..89
score: 41.38
coord: 28..47
score: 46.38
IPR001164Arf GTPase activating proteinSMARTSM00105arf_gap_3coord: 17..134
e-value: 3.4E-44
score: 162.8
IPR001164Arf GTPase activating proteinPFAMPF01412ArfGapcoord: 19..129
e-value: 1.9E-40
score: 137.6
IPR001164Arf GTPase activating proteinPROSITEPS50115ARFGAPcoord: 16..134
score: 27.471
IPR038508ArfGAP domain superfamilyGENE3DG3DSA:3.30.40.160coord: 2..131
e-value: 6.3E-52
score: 176.9
IPR037278ARFGAP/RecO-like zinc fingerSUPERFAMILYSSF57863ArfGap/RecO-like zinc fingercoord: 18..128