ADP-ribosylation factor

Overview
NameADP-ribosylation factor
Smed IDSMED30031844
Length (bp)667
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ADP-ribosylation factor (SMED30031844) t-SNE clustered cells

Violin plots show distribution of expression levels for ADP-ribosylation factor (SMED30031844) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ADP-ribosylation factor (SMED30031844) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ADP-ribosylation factor (SMED30031844) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031844

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermal cellSMED30031844SMESG000052735.1 dd_Smed_v4_6927_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30031844SMESG000052735.1 dd_Smed_v4_6927_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30031844SMESG000052735.1 dd_Smed_v4_6927_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the whole animalSMED30031844SMESG000052735.1 dd_Smed_v4_6927_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ADP-ribosylation factor vs. Ensembl Human
Match: ARF3 (ADP ribosylation factor 3 [Source:HGNC Symbol;Acc:HGNC:654])

HSP 1 Score: 192.586 bits (488), Expect = 7.370e-62
Identity = 91/163 (55.83%), Postives = 122/163 (74.85%), Query Frame = 3
Query:   99 SKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAMTAVA 587
             K+  RILM+GLDAAGKT+I+Y+LKLGE V+TIPTIGFNVE V+  K + FT+WDVGGQDKIR LWRHY++N++ LI+V+DSND ER+  A+ EL  +   D+++   ++V ANKQDLPNAM+  EI + L L +L     W++Q  CA SGDGL+E +  +A
Sbjct:   14 GKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRH-RNWYIQATCATSGDGLYEGLDWLA 174          
BLAST of ADP-ribosylation factor vs. Ensembl Human
Match: ARF3 (ADP ribosylation factor 3 [Source:HGNC Symbol;Acc:HGNC:654])

HSP 1 Score: 192.586 bits (488), Expect = 7.370e-62
Identity = 91/163 (55.83%), Postives = 122/163 (74.85%), Query Frame = 3
Query:   99 SKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAMTAVA 587
             K+  RILM+GLDAAGKT+I+Y+LKLGE V+TIPTIGFNVE V+  K + FT+WDVGGQDKIR LWRHY++N++ LI+V+DSND ER+  A+ EL  +   D+++   ++V ANKQDLPNAM+  EI + L L +L     W++Q  CA SGDGL+E +  +A
Sbjct:   14 GKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRH-RNWYIQATCATSGDGLYEGLDWLA 174          
BLAST of ADP-ribosylation factor vs. Ensembl Human
Match: ARF6 (ADP ribosylation factor 6 [Source:HGNC Symbol;Acc:HGNC:659])

HSP 1 Score: 192.2 bits (487), Expect = 7.481e-62
Identity = 95/178 (53.37%), Postives = 125/178 (70.22%), Query Frame = 3
Query:   78 MGSKVSK--SKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAMTAVAKLSSEY 605
            MG  +SK    +  RILMLGLDAAGKT+I+Y+LKLG+ V+TIPT+GFNVE V   K ++F +WDVGGQDKIR LWRHYY  ++ LI+V+D  D +R+  A+ EL  I    +M+   +++ ANKQDLP+AM P EIQE L L  +  D  W++QP CA SGDGL+E +T    L+S Y
Sbjct:    1 MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTY-KNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIR-DRNWYVQPSCATSGDGLYEGLTW---LTSNY 173          
BLAST of ADP-ribosylation factor vs. Ensembl Human
Match: ARF1 (ADP ribosylation factor 1 [Source:HGNC Symbol;Acc:HGNC:652])

HSP 1 Score: 191.815 bits (486), Expect = 1.357e-61
Identity = 90/159 (56.60%), Postives = 120/159 (75.47%), Query Frame = 3
Query:   99 SKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAM 575
             K+  RILM+GLDAAGKT+I+Y+LKLGE V+TIPTIGFNVE V+  K + FT+WDVGGQDKIR LWRHY++N++ LI+V+DSND ER+  A+ EL  +   D+++   ++V ANKQDLPNAM+  EI + L L +L     W++Q  CA SGDGL+E +
Sbjct:   14 GKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRH-RNWYIQATCATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Human
Match: ARF1 (ADP ribosylation factor 1 [Source:HGNC Symbol;Acc:HGNC:652])

HSP 1 Score: 191.815 bits (486), Expect = 1.357e-61
Identity = 90/159 (56.60%), Postives = 120/159 (75.47%), Query Frame = 3
Query:   99 SKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAM 575
             K+  RILM+GLDAAGKT+I+Y+LKLGE V+TIPTIGFNVE V+  K + FT+WDVGGQDKIR LWRHY++N++ LI+V+DSND ER+  A+ EL  +   D+++   ++V ANKQDLPNAM+  EI + L L +L     W++Q  CA SGDGL+E +
Sbjct:   14 GKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRH-RNWYIQATCATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Celegans
Match: arf-6 (ADP-Ribosylation Factor related [Source:UniProtKB/TrEMBL;Acc:Q9U2S4])

HSP 1 Score: 192.586 bits (488), Expect = 1.971e-62
Identity = 94/173 (54.34%), Postives = 126/173 (72.83%), Query Frame = 3
Query:   78 MGSKVSK--SKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAMTAVAK 590
            MG  +SK   K+  RILMLGLDAAGKT+I+Y+LKLG+ V+TIPT+GFNVE V   K ++F +WDVGGQDKIR LWRHYY  ++ALI+V+D+ D +R+  A+ EL  I    +MK   ++V ANKQDL +AM P EIQ+ L L  +  D  W++QP CA +GDGLHE +T +++
Sbjct:    1 MGKFLSKIFGKKELRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTY-KNIKFNVWDVGGQDKIRPLWRHYYTGTQALIFVMDAADRDRVDEARMELHRIINDREMKEAIILVFANKQDLADAMKPHEIQDKLGLTRIR-DRNWYVQPSCASTGDGLHEGLTWLSQ 171          
BLAST of ADP-ribosylation factor vs. Ensembl Celegans
Match: arf-1.2 (ADP-ribosylation factor 1-like 2 [Source:UniProtKB/Swiss-Prot;Acc:Q10943])

HSP 1 Score: 191.815 bits (486), Expect = 6.303e-62
Identity = 89/159 (55.97%), Postives = 120/159 (75.47%), Query Frame = 3
Query:   99 SKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAM 575
             KR  RILM+GLDAAGKT+I+Y+LKLGE V+TIPTIGFNVE V+  K + FT+WDVGGQDKIR LWRHY++N++ LI+V+DSND ER+  A+ EL  +   D+++   ++V ANKQDLP AM+  E+ + L L +L  +  W++Q  CA SGDGL+E +
Sbjct:   14 GKREMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVGEAREELMRMLAEDELRDAVLLVFANKQDLPQAMNAAEVTDKLGLHSLR-NRSWYIQATCATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Celegans
Match: arf-1.2 (ADP-ribosylation factor 1-like 2 [Source:UniProtKB/Swiss-Prot;Acc:Q10943])

HSP 1 Score: 191.815 bits (486), Expect = 6.303e-62
Identity = 89/159 (55.97%), Postives = 120/159 (75.47%), Query Frame = 3
Query:   99 SKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAM 575
             KR  RILM+GLDAAGKT+I+Y+LKLGE V+TIPTIGFNVE V+  K + FT+WDVGGQDKIR LWRHY++N++ LI+V+DSND ER+  A+ EL  +   D+++   ++V ANKQDLP AM+  E+ + L L +L  +  W++Q  CA SGDGL+E +
Sbjct:   14 GKREMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVGEAREELMRMLAEDELRDAVLLVFANKQDLPQAMNAAEVTDKLGLHSLR-NRSWYIQATCATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Celegans
Match: arf-1.2 (ADP-ribosylation factor 1-like 2 [Source:UniProtKB/Swiss-Prot;Acc:Q10943])

HSP 1 Score: 191.815 bits (486), Expect = 6.303e-62
Identity = 89/159 (55.97%), Postives = 120/159 (75.47%), Query Frame = 3
Query:   99 SKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAM 575
             KR  RILM+GLDAAGKT+I+Y+LKLGE V+TIPTIGFNVE V+  K + FT+WDVGGQDKIR LWRHY++N++ LI+V+DSND ER+  A+ EL  +   D+++   ++V ANKQDLP AM+  E+ + L L +L  +  W++Q  CA SGDGL+E +
Sbjct:   14 GKREMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVGEAREELMRMLAEDELRDAVLLVFANKQDLPQAMNAAEVTDKLGLHSLR-NRSWYIQATCATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Celegans
Match: arf-3 (ADP-Ribosylation Factor related; ADP-ribosylation factor related (20.5 kD) (Arf-3) [Source:UniProtKB/TrEMBL;Acc:G5EFK4])

HSP 1 Score: 191.045 bits (484), Expect = 1.053e-61
Identity = 88/158 (55.70%), Postives = 119/158 (75.32%), Query Frame = 3
Query:  102 KRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAM 575
            KR  RILM+GLDAAGKT+I+Y+LKLGE V+TIPTIGFNVE V+  K + FT+WDVGGQDKIR LWRHY++N++ LI+V+DSND ER+  ++ EL  +   D+++   ++V ANKQDLPNAM+  E+ + L L NL    +W++Q  CA  G GL+E +
Sbjct:   15 KRQVRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDKERIEESREELHKMLNEDELRDATLLVFANKQDLPNAMTAAELTDKLGLHNLRS-RQWYIQATCATQGHGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Fly
Match: Arf79F (gene:FBgn0010348 transcript:FBtr0332054)

HSP 1 Score: 192.971 bits (489), Expect = 2.208e-62
Identity = 89/159 (55.97%), Postives = 121/159 (76.10%), Query Frame = 3
Query:   99 SKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAM 575
             K+  RILM+GLDAAGKT+I+Y+LKLGE V+TIPTIGFNVE V+  K + FT+WDVGGQDKIR LWRHY++N++ LI+V+DSND ER+  A+ EL  +   D+++   +++ ANKQDLPNAM+  EI + L L +L  +  W++Q  CA SGDGL+E +
Sbjct:   14 GKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFANKQDLPNAMNAAEITDKLGLHSLR-NRNWYIQATCATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Fly
Match: Arf79F (gene:FBgn0010348 transcript:FBtr0078573)

HSP 1 Score: 192.971 bits (489), Expect = 2.208e-62
Identity = 89/159 (55.97%), Postives = 121/159 (76.10%), Query Frame = 3
Query:   99 SKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAM 575
             K+  RILM+GLDAAGKT+I+Y+LKLGE V+TIPTIGFNVE V+  K + FT+WDVGGQDKIR LWRHY++N++ LI+V+DSND ER+  A+ EL  +   D+++   +++ ANKQDLPNAM+  EI + L L +L  +  W++Q  CA SGDGL+E +
Sbjct:   14 GKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFANKQDLPNAMNAAEITDKLGLHSLR-NRNWYIQATCATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Fly
Match: Arf79F (gene:FBgn0010348 transcript:FBtr0299906)

HSP 1 Score: 192.971 bits (489), Expect = 2.208e-62
Identity = 89/159 (55.97%), Postives = 121/159 (76.10%), Query Frame = 3
Query:   99 SKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAM 575
             K+  RILM+GLDAAGKT+I+Y+LKLGE V+TIPTIGFNVE V+  K + FT+WDVGGQDKIR LWRHY++N++ LI+V+DSND ER+  A+ EL  +   D+++   +++ ANKQDLPNAM+  EI + L L +L  +  W++Q  CA SGDGL+E +
Sbjct:   14 GKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFANKQDLPNAMNAAEITDKLGLHSLR-NRNWYIQATCATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Fly
Match: Arf79F (gene:FBgn0010348 transcript:FBtr0299907)

HSP 1 Score: 192.971 bits (489), Expect = 2.208e-62
Identity = 89/159 (55.97%), Postives = 121/159 (76.10%), Query Frame = 3
Query:   99 SKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAM 575
             K+  RILM+GLDAAGKT+I+Y+LKLGE V+TIPTIGFNVE V+  K + FT+WDVGGQDKIR LWRHY++N++ LI+V+DSND ER+  A+ EL  +   D+++   +++ ANKQDLPNAM+  EI + L L +L  +  W++Q  CA SGDGL+E +
Sbjct:   14 GKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFANKQDLPNAMNAAEITDKLGLHSLR-NRNWYIQATCATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Fly
Match: Arf79F (gene:FBgn0010348 transcript:FBtr0078571)

HSP 1 Score: 192.971 bits (489), Expect = 2.208e-62
Identity = 89/159 (55.97%), Postives = 121/159 (76.10%), Query Frame = 3
Query:   99 SKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAM 575
             K+  RILM+GLDAAGKT+I+Y+LKLGE V+TIPTIGFNVE V+  K + FT+WDVGGQDKIR LWRHY++N++ LI+V+DSND ER+  A+ EL  +   D+++   +++ ANKQDLPNAM+  EI + L L +L  +  W++Q  CA SGDGL+E +
Sbjct:   14 GKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFANKQDLPNAMNAAEITDKLGLHSLR-NRNWYIQATCATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Zebrafish
Match: arf3b (ADP-ribosylation factor 3b [Source:ZFIN;Acc:ZDB-GENE-030616-356])

HSP 1 Score: 192.586 bits (488), Expect = 4.689e-62
Identity = 91/163 (55.83%), Postives = 122/163 (74.85%), Query Frame = 3
Query:   99 SKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAMTAVA 587
             K+  RILM+GLDAAGKT+I+Y+LKLGE V+TIPTIGFNVE V+  K + FT+WDVGGQDKIR LWRHY++N++ LI+V+DSND ER+  A+ EL  +   D+++   ++V ANKQDLPNAM+  EI + L L +L     W++Q  CA SGDGL+E +  +A
Sbjct:   14 GKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRH-RNWYIQATCATSGDGLYEGLDWLA 174          
BLAST of ADP-ribosylation factor vs. Ensembl Zebrafish
Match: arf3b (ADP-ribosylation factor 3b [Source:ZFIN;Acc:ZDB-GENE-030616-356])

HSP 1 Score: 192.586 bits (488), Expect = 4.689e-62
Identity = 91/163 (55.83%), Postives = 122/163 (74.85%), Query Frame = 3
Query:   99 SKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAMTAVA 587
             K+  RILM+GLDAAGKT+I+Y+LKLGE V+TIPTIGFNVE V+  K + FT+WDVGGQDKIR LWRHY++N++ LI+V+DSND ER+  A+ EL  +   D+++   ++V ANKQDLPNAM+  EI + L L +L     W++Q  CA SGDGL+E +  +A
Sbjct:   14 GKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRH-RNWYIQATCATSGDGLYEGLDWLA 174          
BLAST of ADP-ribosylation factor vs. Ensembl Zebrafish
Match: arf1 (ADP-ribosylation factor 1 [Source:ZFIN;Acc:ZDB-GENE-010724-5])

HSP 1 Score: 192.2 bits (487), Expect = 5.526e-62
Identity = 90/159 (56.60%), Postives = 120/159 (75.47%), Query Frame = 3
Query:   99 SKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAM 575
             K+  RILM+GLDAAGKT+I+Y+LKLGE V+TIPTIGFNVE V+  K + FT+WDVGGQDKIR LWRHY++N++ LI+V+DSND ER+  A+ EL  +   D+++   ++V ANKQDLPNAM+  EI + L L +L     W++Q  CA SGDGL+E +
Sbjct:   13 GKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELREAVLLVFANKQDLPNAMNAAEITDKLGLHSLRH-RNWYIQATCATSGDGLYEGL 169          
BLAST of ADP-ribosylation factor vs. Ensembl Zebrafish
Match: arf6a (ADP-ribosylation factor 6a [Source:ZFIN;Acc:ZDB-GENE-030131-8007])

HSP 1 Score: 191.815 bits (486), Expect = 6.821e-62
Identity = 94/178 (52.81%), Postives = 125/178 (70.22%), Query Frame = 3
Query:   78 MGSKVSK--SKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAMTAVAKLSSEY 605
            MG  +SK    +  RILMLGLDAAGKT+I+Y+LKLG+ V+TIPT+GFNVE V   K ++F +WDVGGQDKIR LWRHYY  ++ LI+V+D  D +R+  A+ EL  I    +M+   +++ ANKQDLP+AM P EIQE L L  +  D  W++QP CA +GDGL+E +T    L+S Y
Sbjct:    1 MGKMLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTY-KNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIR-DRNWYVQPSCATTGDGLYEGLTW---LTSNY 173          
BLAST of ADP-ribosylation factor vs. Ensembl Zebrafish
Match: arf6b (ADP-ribosylation factor 6b [Source:ZFIN;Acc:ZDB-GENE-030131-9056])

HSP 1 Score: 191.815 bits (486), Expect = 6.821e-62
Identity = 94/178 (52.81%), Postives = 125/178 (70.22%), Query Frame = 3
Query:   78 MGSKVSK--SKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAMTAVAKLSSEY 605
            MG  +SK    +  RILMLGLDAAGKT+I+Y+LKLG+ V+TIPT+GFNVE V   K ++F +WDVGGQDKIR LWRHYY  ++ LI+V+D  D +R+  A+ EL  I    +M+   +++ ANKQDLP+AM P EIQE L L  +  D  W++QP CA +GDGL+E +T    L+S Y
Sbjct:    1 MGKMLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTY-KNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIR-DRNWYVQPSCATTGDGLYEGLTW---LTSNY 173          
BLAST of ADP-ribosylation factor vs. Ensembl Xenopus
Match: arf3 (ADP ribosylation factor 3 [Source:NCBI gene;Acc:100145191])

HSP 1 Score: 192.586 bits (488), Expect = 6.681e-62
Identity = 91/163 (55.83%), Postives = 122/163 (74.85%), Query Frame = 3
Query:   99 SKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAMTAVA 587
             K+  RILM+GLDAAGKT+I+Y+LKLGE V+TIPTIGFNVE V+  K + FT+WDVGGQDKIR LWRHY++N++ LI+V+DSND ER+  A+ EL  +   D+++   ++V ANKQDLPNAM+  EI + L L +L     W++Q  CA SGDGL+E +  +A
Sbjct:   14 GKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRH-RNWYIQATCATSGDGLYEGLDWLA 174          
BLAST of ADP-ribosylation factor vs. Ensembl Xenopus
Match: arf5 (ADP ribosylation factor 5 [Source:NCBI gene;Acc:394614])

HSP 1 Score: 191.815 bits (486), Expect = 1.418e-61
Identity = 90/159 (56.60%), Postives = 120/159 (75.47%), Query Frame = 3
Query:   99 SKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAM 575
             K+  RILM+GLDAAGKT+I+Y+LKLGE V+TIPTIGFNVE V+  K + FT+WDVGGQDKIR LWRHY++N++ LI+V+DSND ER+  A+ EL  +   D+++   ++V ANKQDLPNAM+  EI + L L +L     W++Q  CA SGDGL+E +
Sbjct:   14 GKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRH-RNWYIQATCATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Xenopus
Match: fibp (fibroblast growth factor (acidic) intracellular binding protein [Source:Xenbase;Acc:XB-GENE-481175])

HSP 1 Score: 191.43 bits (485), Expect = 2.054e-61
Identity = 90/159 (56.60%), Postives = 120/159 (75.47%), Query Frame = 3
Query:   99 SKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAM 575
             K+  RILM+GLDAAGKT+I+Y+LKLGE V+TIPTIGFNVE V+  K + FT+WDVGGQDKIR LWRHY++N++ LI+V+DSND ER+  A+ EL  +   D+++   ++V ANKQDLPNAM+  EI + L L +L     W++Q  CA SGDGL+E +
Sbjct:   14 GKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELTRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRH-RNWYIQATCATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Xenopus
Match: arf4 (ADP ribosylation factor 4 [Source:NCBI gene;Acc:595036])

HSP 1 Score: 189.889 bits (481), Expect = 6.250e-61
Identity = 89/159 (55.97%), Postives = 120/159 (75.47%), Query Frame = 3
Query:   99 SKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAM 575
             K+  RILM+GLDAAGKT+I+Y+LKLGE V+TIPTIGFNVE V+  K + FT+WDVGGQDKIR LWRHY++N++ LI+V+DSND ER+  A  EL  + + D+++   ++V ANKQDLPNAM+  E+ + L LQNL  +  W++Q  CA  G GL+E +
Sbjct:   14 GKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIQEAAEELQKMLQEDELRDAVLLVFANKQDLPNAMAISEMTDKLGLQNLR-NRTWYVQATCATQGTGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Xenopus
Match: dcaf7 (DDB1 and CUL4 associated factor 7 [Source:Xenbase;Acc:XB-GENE-973762])

HSP 1 Score: 189.504 bits (480), Expect = 1.194e-60
Identity = 83/164 (50.61%), Postives = 118/164 (71.95%), Query Frame = 3
Query:  114 RILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAMTAVAKLSSEY 605
            RI+MLGLDAAGKT+++Y+LK  E ++TIPTIGFNVE V+  + + FT+WDVGGQ +IR LW+HY+ N+  L++V+DS D ER   A+ EL +I ++++M+ +P VV+ANKQDLP A  P E+ E L L  ++  H WH+Q CCA +GDGL E +     L  ++
Sbjct:   21 RIIMLGLDAAGKTTVLYKLKFNETITTIPTIGFNVETVEPMRNVSFTVWDVGGQGRIRALWKHYFTNTDGLVFVVDSADCERFQEARLELEAILDAEEMRGVPFVVMANKQDLPGARRPMEVAEELGLPKIQ-GHPWHVQGCCAATGDGLVEGLEVFTNLVKQF 183          
BLAST of ADP-ribosylation factor vs. Ensembl Mouse
Match: Arf3 (ADP-ribosylation factor 3 [Source:MGI Symbol;Acc:MGI:99432])

HSP 1 Score: 192.586 bits (488), Expect = 5.060e-62
Identity = 91/163 (55.83%), Postives = 122/163 (74.85%), Query Frame = 3
Query:   99 SKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAMTAVA 587
             K+  RILM+GLDAAGKT+I+Y+LKLGE V+TIPTIGFNVE V+  K + FT+WDVGGQDKIR LWRHY++N++ LI+V+DSND ER+  A+ EL  +   D+++   ++V ANKQDLPNAM+  EI + L L +L     W++Q  CA SGDGL+E +  +A
Sbjct:   14 GKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRH-RNWYIQATCATSGDGLYEGLDWLA 174          
BLAST of ADP-ribosylation factor vs. Ensembl Mouse
Match: Arf6 (ADP-ribosylation factor 6 [Source:MGI Symbol;Acc:MGI:99435])

HSP 1 Score: 192.2 bits (487), Expect = 5.136e-62
Identity = 95/178 (53.37%), Postives = 125/178 (70.22%), Query Frame = 3
Query:   78 MGSKVSK--SKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAMTAVAKLSSEY 605
            MG  +SK    +  RILMLGLDAAGKT+I+Y+LKLG+ V+TIPT+GFNVE V   K ++F +WDVGGQDKIR LWRHYY  ++ LI+V+D  D +R+  A+ EL  I    +M+   +++ ANKQDLP+AM P EIQE L L  +  D  W++QP CA SGDGL+E +T    L+S Y
Sbjct:    1 MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTY-KNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIR-DRNWYVQPSCATSGDGLYEGLTW---LTSNY 173          
BLAST of ADP-ribosylation factor vs. Ensembl Mouse
Match: Arf1 (ADP-ribosylation factor 1 [Source:MGI Symbol;Acc:MGI:99431])

HSP 1 Score: 191.815 bits (486), Expect = 9.318e-62
Identity = 90/159 (56.60%), Postives = 120/159 (75.47%), Query Frame = 3
Query:   99 SKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAM 575
             K+  RILM+GLDAAGKT+I+Y+LKLGE V+TIPTIGFNVE V+  K + FT+WDVGGQDKIR LWRHY++N++ LI+V+DSND ER+  A+ EL  +   D+++   ++V ANKQDLPNAM+  EI + L L +L     W++Q  CA SGDGL+E +
Sbjct:   14 GKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRH-RNWYIQATCATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Mouse
Match: Arf1 (ADP-ribosylation factor 1 [Source:MGI Symbol;Acc:MGI:99431])

HSP 1 Score: 191.815 bits (486), Expect = 9.318e-62
Identity = 90/159 (56.60%), Postives = 120/159 (75.47%), Query Frame = 3
Query:   99 SKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAM 575
             K+  RILM+GLDAAGKT+I+Y+LKLGE V+TIPTIGFNVE V+  K + FT+WDVGGQDKIR LWRHY++N++ LI+V+DSND ER+  A+ EL  +   D+++   ++V ANKQDLPNAM+  EI + L L +L     W++Q  CA SGDGL+E +
Sbjct:   14 GKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRH-RNWYIQATCATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Mouse
Match: Arf2 (ADP-ribosylation factor 2 [Source:MGI Symbol;Acc:MGI:99595])

HSP 1 Score: 190.274 bits (482), Expect = 3.485e-61
Identity = 89/159 (55.97%), Postives = 119/159 (74.84%), Query Frame = 3
Query:   99 SKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAM 575
             K+  RILM+GLDAAGKT+I+Y+LKLGE V+TIPTIGFNVE V+  K + FT+WDVGGQDKIR LWRHY++N++ LI+V+DSND ER+  A+ EL  +   D+++   ++V  NKQDLPNAM+  EI + L L +L     W++Q  CA SGDGL+E +
Sbjct:   14 GKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELTRMLAEDELRDAVLLVFVNKQDLPNAMNAAEITDKLGLHSLRQ-RNWYIQATCATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. UniProt/SwissProt
Match: sp|P91924|ARF_DUGJA (ADP-ribosylation factor OS=Dugesia japonica OX=6161 PE=2 SV=3)

HSP 1 Score: 196.052 bits (497), Expect = 1.840e-62
Identity = 91/159 (57.23%), Postives = 122/159 (76.73%), Query Frame = 3
Query:   99 SKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAM 575
             K+  RILM+GLDAAGKT+I+Y+LKLGE V+TIPTIGFNVE V+  K + FT+WDVGGQDKIR LWRHY++N++ LI+V+DSND ER+  A+ EL  +   D+++   ++V ANKQDLPNAM+P EI + L L +L  +  W++Q  CA SGDGL+E +
Sbjct:   14 GKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLR-NRSWYIQATCATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. UniProt/SwissProt
Match: sp|P34727|ARF_AJECA (ADP-ribosylation factor OS=Ajellomyces capsulatus OX=5037 GN=ARF PE=1 SV=3)

HSP 1 Score: 195.282 bits (495), Expect = 3.352e-62
Identity = 95/176 (53.98%), Postives = 129/176 (73.30%), Query Frame = 3
Query:   78 MGSKVSK------SKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAMTAVA 587
            MG   SK       K+  RILM+GLDAAGKT+I+Y+LKLGE V+TIPTIGFNVE V+  K ++FT+WDVGGQDKIR LWRHY++N++ +I+V+DSND +R+  A+ EL  +   D+++   ++V ANKQDLPNAMSP EI + L LQ+L     W++Q  CA +GDGL+E +  +A
Sbjct:    1 MGMAFSKLFDRIWGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNIQFTVWDVGGQDKIRPLWRHYFQNTQGIIFVVDSNDRDRVVEAREELQRMLNEDELRDALLLVFANKQDLPNAMSPAEITQQLGLQSL-TRRAWYIQSTCATTGDGLYEGLEWLA 174          
BLAST of ADP-ribosylation factor vs. UniProt/SwissProt
Match: sp|P51823|ARF2_ORYSJ (ADP-ribosylation factor 2 OS=Oryza sativa subsp. japonica OX=39947 GN=ARF PE=2 SV=2)

HSP 1 Score: 193.356 bits (490), Expect = 1.986e-61
Identity = 90/159 (56.60%), Postives = 122/159 (76.73%), Query Frame = 3
Query:   99 SKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAM 575
            +K+  RILM+GLDAAGKT+I+Y+LKLGE V+TIPTIGFNVE V+  K + FT+WDVGGQDKIR LWRHY++N++ LI+V+DSND ER+  A+ EL  +   D+++   ++V ANKQDLPNAM+  EI + L L +L   H W++Q  CA SG+GL+E +
Sbjct:   14 AKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRH-WYIQSTCATSGEGLYEGL 170          
BLAST of ADP-ribosylation factor vs. UniProt/SwissProt
Match: sp|Q06396|ARF1_ORYSJ (ADP-ribosylation factor 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os01g0813400 PE=2 SV=3)

HSP 1 Score: 193.356 bits (490), Expect = 1.986e-61
Identity = 90/159 (56.60%), Postives = 122/159 (76.73%), Query Frame = 3
Query:   99 SKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAM 575
            +K+  RILM+GLDAAGKT+I+Y+LKLGE V+TIPTIGFNVE V+  K + FT+WDVGGQDKIR LWRHY++N++ LI+V+DSND ER+  A+ EL  +   D+++   ++V ANKQDLPNAM+  EI + L L +L   H W++Q  CA SG+GL+E +
Sbjct:   14 AKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRH-WYIQSTCATSGEGLYEGL 170          
BLAST of ADP-ribosylation factor vs. UniProt/SwissProt
Match: sp|P61210|ARF1_LOCMI (ADP-ribosylation factor 1 OS=Locusta migratoria OX=7004 GN=ARF1 PE=2 SV=2)

HSP 1 Score: 192.971 bits (489), Expect = 2.213e-61
Identity = 89/159 (55.97%), Postives = 121/159 (76.10%), Query Frame = 3
Query:   99 SKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAM 575
             K+  RILM+GLDAAGKT+I+Y+LKLGE V+TIPTIGFNVE V+  K + FT+WDVGGQDKIR LWRHY++N++ LI+V+DSND ER+  A+ EL  +   D+++   +++ ANKQDLPNAM+  EI + L L +L  +  W++Q  CA SGDGL+E +
Sbjct:   14 GKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFANKQDLPNAMNAAEITDKLGLHSLR-NRNWYIQATCATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. TrEMBL
Match: A0A1S3I8S2 (ADP-ribosylation factor OS=Lingula unguis OX=7574 GN=LOC106161789 PE=3 SV=1)

HSP 1 Score: 219.935 bits (559), Expect = 2.472e-69
Identity = 100/166 (60.24%), Postives = 130/166 (78.31%), Query Frame = 3
Query:  108 PRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAMTAVAKLSSEY 605
            P RILMLGLDAAGKT+I+Y++KL E VSTIPTIGFNVE V   KGL FT+WDVGGQDKIR LWRHYY+N+  LIYV+DS+D ER+  +  ELF I ES +MK +PVVV+ANKQDLP A+S  ++ + L+L+ L  ++KWH+Q  CA + DG++EAM  +A+L  ++
Sbjct:   22 PARILMLGLDAAGKTTILYKVKLNENVSTIPTIGFNVETVSPCKGLSFTVWDVGGQDKIRPLWRHYYQNTEGLIYVVDSSDRERLAESSEELFGIMESPEMKGVPVVVIANKQDLPGALSAAQVIDKLQLRKLPRENKWHVQAACATTADGIYEAMDELARLVKDF 187          
BLAST of ADP-ribosylation factor vs. TrEMBL
Match: K1PJY7 (ADP-ribosylation factor 1 OS=Crassostrea gigas OX=29159 GN=CGI_10008027 PE=3 SV=1)

HSP 1 Score: 214.542 bits (545), Expect = 3.052e-67
Identity = 98/169 (57.99%), Postives = 129/169 (76.33%), Query Frame = 3
Query:   99 SKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAMTAVAKLSSEY 605
            S+ P RILMLGLDAAGKTSI+Y++KL E V TIPTIGFNVE V+  KG+ FT+WDVGGQDKIR LWR YY+N+  LIYV+DS+D ER+  ++ ELF I +SD+ + +PVVV+ANKQDLPNA+ P E+ + + L+ L    KW +Q  CA +G+G+ EAM+ +A +  EY
Sbjct:   17 SETPARILMLGLDAAGKTSILYKVKLNENVHTIPTIGFNVETVEPVKGVSFTVWDVGGQDKIRPLWRFYYQNTEGLIYVVDSSDRERIAESREELFGILDSDETREVPVVVIANKQDLPNALKPSEVADLMTLRKL-TSRKWFIQAACATTGEGIFEAMSEMANMVKEY 184          
BLAST of ADP-ribosylation factor vs. TrEMBL
Match: A0A210QTV1 (ADP-ribosylation factor 3 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT10271 PE=3 SV=1)

HSP 1 Score: 213.772 bits (543), Expect = 5.326e-67
Identity = 98/168 (58.33%), Postives = 130/168 (77.38%), Query Frame = 3
Query:   99 SKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAMTAVAKLSSE 602
            S    RILMLGLDAAGKT+++Y++KL E VSTIPTIGFNVEEV   KG+ FT+WDVGGQDKIR LWRHY++++  L+YV+DSND ER+  A+ ELF I E+D+M+ +PVVVLANKQDLP+AM+  E+ + + L  L    KW +Q  CA++GDG++E M  +A+L+ E
Sbjct:   17 SGSTTRILMLGLDAAGKTTVLYKIKLNENVSTIPTIGFNVEEVSPCKGVSFTVWDVGGQDKIRPLWRHYFQDTEGLVYVVDSNDRERISEAREELFGILENDEMRGVPVVVLANKQDLPHAMNTAEVADRMCLMKL-TGRKWFVQGACAMNGDGIYEGMKEMARLTKE 183          
BLAST of ADP-ribosylation factor vs. TrEMBL
Match: A0A210QTY7 (ADP-ribosylation factor 3 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT10272 PE=3 SV=1)

HSP 1 Score: 213.001 bits (541), Expect = 1.347e-66
Identity = 96/168 (57.14%), Postives = 129/168 (76.79%), Query Frame = 3
Query:   99 SKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAMTAVAKLSSE 602
            S  P RILMLGLDAAGKT+++Y++KL E V TIPTIGFNVEEV   KG+ FT+WDVGGQ+KIR LWRHY++N+  L++V+DSND ER+  A+ ELF I ++D+M+ +PVVVLANKQDLP AM+  +I E + L  L    KW +Q  CA++G+G++E M  +A+L+ E
Sbjct:   17 SGSPSRILMLGLDAAGKTTVLYKIKLNENVCTIPTIGFNVEEVSPCKGVSFTVWDVGGQEKIRALWRHYFQNTEGLVFVVDSNDRERINEAREELFGILDNDEMRGVPVVVLANKQDLPYAMNTSDIAEKMCLTKL-TGRKWFVQGACAMTGEGIYEGMKEMARLTKE 183          
BLAST of ADP-ribosylation factor vs. TrEMBL
Match: R7VJ46 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_101983 PE=3 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 1.455e-66
Identity = 96/168 (57.14%), Postives = 129/168 (76.79%), Query Frame = 3
Query:   99 SKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAMTAVAKLSSE 602
            S  P RILMLGLDAAGKT+I+Y++KL E V TIPTIGFNVE V   KGL FT+WDVGGQ+KIR LW+HYY+N+  LI+V+DSND ER+P  + ELF I  SD+M  +PV++LANKQDLP A+ P ++ E + +++ +  HKWH+Q  CA +G+G++E M A+A++  E
Sbjct:   13 SSSPARILMLGLDAAGKTTILYKVKLNETVCTIPTIGFNVETVTPCKGLSFTVWDVGGQEKIRQLWKHYYQNTDGLIFVVDSNDPERIPEVREELFKILASDEMHAVPVLILANKQDLPKALPPYKLIEEMGMRDCK-GHKWHVQATCATNGEGIYEGMDALARMVKE 179          
BLAST of ADP-ribosylation factor vs. Ensembl Cavefish
Match: arf1 (ADP-ribosylation factor 1 [Source:NCBI gene;Acc:103038497])

HSP 1 Score: 192.2 bits (487), Expect = 4.386e-62
Identity = 90/159 (56.60%), Postives = 120/159 (75.47%), Query Frame = 3
Query:   99 SKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAM 575
             K+  RILM+GLDAAGKT+I+Y+LKLGE V+TIPTIGFNVE V+  K + FT+WDVGGQDKIR LWRHY++N++ LI+V+DSND ER+  A+ EL  +   D+++   ++V ANKQDLPNAM+  EI + L L +L     W++Q  CA SGDGL+E +
Sbjct:   13 GKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELREAVLLVFANKQDLPNAMNAAEITDKLGLHSLRH-RNWYIQATCATSGDGLYEGL 169          
BLAST of ADP-ribosylation factor vs. Ensembl Cavefish
Match: arf2a (ADP-ribosylation factor 1-like [Source:NCBI gene;Acc:103045652])

HSP 1 Score: 191.43 bits (485), Expect = 1.222e-61
Identity = 90/159 (56.60%), Postives = 120/159 (75.47%), Query Frame = 3
Query:   99 SKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAM 575
             K+  RILM+GLDAAGKT+I+Y+LKLGE V+TIPTIGFNVE V+  K + FT+WDVGGQDKIR LWRHY++N++ LI+V+DSND ER+  A+ EL  +   D+++   ++V ANKQDLPNAM+  EI + L L +L     W++Q  CA SGDGL+E +
Sbjct:   14 GKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELTRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRH-RNWYIQATCATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Cavefish
Match: arf3a (ADP-ribosylation factor 3a [Source:ZFIN;Acc:ZDB-GENE-040801-176])

HSP 1 Score: 192.586 bits (488), Expect = 1.882e-61
Identity = 91/163 (55.83%), Postives = 122/163 (74.85%), Query Frame = 3
Query:   99 SKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAMTAVA 587
             K+  RILM+GLDAAGKT+I+Y+LKLGE V+TIPTIGFNVE V+  K + FT+WDVGGQDKIR LWRHY++N++ LI+V+DSND ER+  A+ EL  +   D+++   ++V ANKQDLPNAM+  EI + L L +L     W++Q  CA SGDGL+E +  +A
Sbjct:   61 GKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRH-RNWYIQATCATSGDGLYEGLDWLA 221          
BLAST of ADP-ribosylation factor vs. Ensembl Cavefish
Match: arf2b (ADP-ribosylation factor 1 [Source:NCBI gene;Acc:103047326])

HSP 1 Score: 189.889 bits (481), Expect = 3.775e-61
Identity = 89/159 (55.97%), Postives = 119/159 (74.84%), Query Frame = 3
Query:   99 SKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAM 575
             K+  RILM+GLDAAGKT+I+Y+LKLGE V+TIPTIGFNVE V+  K + FT+WDVGGQDKIR LWRHY++N++ LI+V+DSND ER+  A+ EL  +   D+++   +++ ANKQDLPNAM+  EI + L L  L     W++Q  CA SGDGL+E +
Sbjct:    7 GKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELTRMLAEDELRDAVLLIFANKQDLPNAMNAAEITDKLGLHALRH-RNWYIQATCATSGDGLYEGL 163          
BLAST of ADP-ribosylation factor vs. Ensembl Cavefish
Match: arf2b (ADP-ribosylation factor 1 [Source:NCBI gene;Acc:103047326])

HSP 1 Score: 189.889 bits (481), Expect = 4.187e-61
Identity = 89/159 (55.97%), Postives = 119/159 (74.84%), Query Frame = 3
Query:   99 SKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAM 575
             K+  RILM+GLDAAGKT+I+Y+LKLGE V+TIPTIGFNVE V+  K + FT+WDVGGQDKIR LWRHY++N++ LI+V+DSND ER+  A+ EL  +   D+++   +++ ANKQDLPNAM+  EI + L L  L     W++Q  CA SGDGL+E +
Sbjct:   14 GKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELTRMLAEDELRDAVLLIFANKQDLPNAMNAAEITDKLGLHALRH-RNWYIQATCATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Sea Lamprey
Match: arf2a (ADP-ribosylation factor 2a [Source:ZFIN;Acc:ZDB-GENE-040122-4])

HSP 1 Score: 192.971 bits (489), Expect = 4.881e-63
Identity = 90/159 (56.60%), Postives = 121/159 (76.10%), Query Frame = 3
Query:   99 SKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAM 575
             K+  RILM+GLDAAGKT+I+Y+LKLGE V+TIPTIGFNVE V+  K + FT+WDVGGQDKIR LWRHY++N++ LI+V+DSND ER+  A+ EL  +   D++++  ++V ANKQDLPNAM+  EI + L L +L     W++Q  CA SGDGL+E +
Sbjct:   14 GKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRNAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQ-RNWYIQATCATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Sea Lamprey
Match: arf1 (ADP-ribosylation factor 1 [Source:ZFIN;Acc:ZDB-GENE-010724-5])

HSP 1 Score: 191.815 bits (486), Expect = 1.485e-62
Identity = 90/159 (56.60%), Postives = 120/159 (75.47%), Query Frame = 3
Query:   99 SKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAM 575
             K+  RILM+GLDAAGKT+I+Y+LKLGE V+TIPTIGFNVE V+  K + FT+WDVGGQDKIR LWRHY++N++ LI+V+DSND ER+  A+ EL  +   D+++   ++V ANKQDLPNAM+  EI + L L +L     W++Q  CA SGDGL+E +
Sbjct:   13 GKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRH-RNWYIQATCATSGDGLYEGL 169          
BLAST of ADP-ribosylation factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011118.1 (pep scaffold:Pmarinus_7.0:GL482736:15659:16189:-1 gene:ENSPMAG00000010091.1 transcript:ENSPMAT00000011118.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 188.348 bits (477), Expect = 3.190e-61
Identity = 94/178 (52.81%), Postives = 124/178 (69.66%), Query Frame = 3
Query:   78 MGSKVSK--SKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAMTAVAKLSSEY 605
            MG  +SK    +  RILMLGLDAAGKT+I+Y+LKLG+ V+TIPT+GFNVE V   K +RF +WDVGGQDKIR LWRHYY  ++ LI+V+D  D +R+  A+ EL  I    +M+   ++V ANKQDL +AM P E+QE L L  +  D  W++QP CA +GDGL+E +T    L+S Y
Sbjct:    2 MGKFLSKMFGNKEMRILMLGLDAAGKTTILYKLKLGQPVTTIPTVGFNVETVTY-KNVRFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRVDEARQELHRIINDREMRDAIILVFANKQDLTDAMRPHEVQEKLGLTRVR-DRNWYVQPACASTGDGLYEGLTW---LTSNY 174          
BLAST of ADP-ribosylation factor vs. Ensembl Sea Lamprey
Match: arf4a (ADP-ribosylation factor 4a [Source:ZFIN;Acc:ZDB-GENE-040801-109])

HSP 1 Score: 181.415 bits (459), Expect = 1.843e-58
Identity = 94/182 (51.65%), Postives = 126/182 (69.23%), Query Frame = 3
Query:   78 MGSKVSK------SKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAMTAVA-KLSSE 602
            MG  +S+        +  RILM+GLDAAGKT+I+Y+LKLGE V+TIPT  FNVE V+  K + FT+WDVGGQDKIR LWRHY++N++ LI+V+DSND ER+  A  EL  + + DD+K   ++VLANKQDLPNAM+  E+ E L L  L  +  W +Q  CA  G GL E +  ++ KL++E
Sbjct:    1 MGLAISRVLAALLGTKAMRILMVGLDAAGKTTILYKLKLGEIVTTIPTTRFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIQEAAEELQKMMQEDDLKDAALLVLANKQDLPNAMAIGELTEKLGLHGLR-NRAWFVQATCAPQGTGLCEGLDWLSNKLANE 180          
BLAST of ADP-ribosylation factor vs. Ensembl Sea Lamprey
Match: arf4a (ADP-ribosylation factor 4a [Source:ZFIN;Acc:ZDB-GENE-040801-109])

HSP 1 Score: 180.644 bits (457), Expect = 3.552e-58
Identity = 91/172 (52.91%), Postives = 119/172 (69.19%), Query Frame = 3
Query:   78 MGSKVSK------SKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAM 575
            MG  +S+        +  RILM+GLDAAGKT+I+Y+LKLGE V+TIPT  FNVE V+  K + FT+WDVGGQDKIR LWRHY++N++ LI+V+DSND ER+  A  EL  + + DD+K   ++VLANKQDLPNAM+  E+ E L L  L  +  W +Q  CA  G GL E +
Sbjct:    1 MGLAISRVLAALLGTKAMRILMVGLDAAGKTTILYKLKLGEIVTTIPTTRFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIQEAAEELQKMMQEDDLKDAALLVLANKQDLPNAMAIGELTEKLGLHGLR-NRAWFVQATCAPQGTGLCEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Yeast
Match: ARF1 (ADP-ribosylation factor; GTPase of the Ras superfamily involved in regulation of coated vesicle formation in intracellular trafficking within the Golgi; ARF1 has a paralog, ARF2, that arose from the whole genome duplication; arf1 arf2 double null mutation is complemented by human ARF1, ARF4, ARF5, or ARF6 [Source:SGD;Acc:S000002351])

HSP 1 Score: 180.259 bits (456), Expect = 3.821e-58
Identity = 82/154 (53.25%), Postives = 113/154 (73.38%), Query Frame = 3
Query:  114 RILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAM 575
            RILM+GLD AGKT+++Y+LKLGE ++TIPTIGFNVE V+  K + FT+WDVGGQD+IR LWRHYYRN+  +I+V+DSND  R+  A+  +  +   D++++   +V ANKQDLP AMS  EI E L L ++  +  W +Q  CA SG+GL+E +
Sbjct:   19 RILMVGLDGAGKTTVLYKLKLGEVITTIPTIGFNVETVQY-KNISFTVWDVGGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAREVMQRMLNEDELRNAAWLVFANKQDLPEAMSAAEITEKLGLHSIR-NRPWFIQATCATSGEGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Yeast
Match: ARF2 (ADP-ribosylation factor; GTPase of the Ras superfamily involved in regulation of coated formation vesicles in intracellular trafficking within the Golgi; ARF2 has a paralog, ARF1, that arose from the whole genome duplication; arf1 arf2 double null mutation is complemented by human ARF1, ARF4, ARF5, or ARF6 [Source:SGD;Acc:S000002296])

HSP 1 Score: 179.489 bits (454), Expect = 6.516e-58
Identity = 83/154 (53.90%), Postives = 113/154 (73.38%), Query Frame = 3
Query:  114 RILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAM 575
            RILM+GLD AGKT+++Y+LKLGE ++TIPTIGFNVE V+  K + FT+WDVGGQD+IR LWRHYYRN+  +I+VIDSND  R+  A+  +  +   D++++   +V ANKQDLP AMS  EI E L L ++  +  W +Q  CA SG+GL+E +
Sbjct:   19 RILMVGLDGAGKTTVLYKLKLGEVITTIPTIGFNVETVQY-KNISFTVWDVGGQDRIRSLWRHYYRNTEGVIFVIDSNDRSRIGEAREVMQRMLNEDELRNAVWLVFANKQDLPEAMSAAEITEKLGLHSIR-NRPWFIQSTCATSGEGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Yeast
Match: ARF3 (Glucose-repressible ADP-ribosylation factor; GTPase of Ras superfamily involved in regulating cell polarity and invasive growth; localizes to dynamic spots at plasma membrane and modulates PtdIns(4,5)P2 levels to facilitate endocytosis; required for localization of endocytic protein Lsb5p to correct cortical site in cells; also has mRNA binding activity; homolog of mammalian Arf6 [Source:SGD;Acc:S000005620])

HSP 1 Score: 157.918 bits (398), Expect = 2.084e-49
Identity = 79/176 (44.89%), Postives = 118/176 (67.05%), Query Frame = 3
Query:   78 MGSKVSK------SKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAMTAVA 587
            MG+ +SK        +  +ILMLGLD AGKT+I+Y+LKL +  ++ PT+GFNVE V   K ++F +WDVGGQ ++R LWRHY+  + ALI+VIDS+   RM  AK EL+SI    +M+++ ++V ANKQDL +AM P+E+ + LEL+    +  W +    A+SG GL E ++ ++
Sbjct:    1 MGNSISKVLGKLFGSKEMKILMLGLDKAGKTTILYKLKLNKIKTSTPTVGFNVETVTY-KNVKFNMWDVGGQQRLRPLWRHYFPATTALIFVIDSSARNRMEEAKEELYSIIGEKEMENVVLLVWANKQDLKDAMKPQEVSDFLELEKNLKNQPWCVIGSNALSGQGLVEGLSWIS 175          
BLAST of ADP-ribosylation factor vs. Ensembl Yeast
Match: ARL1 (Soluble GTPase with a role in regulation of membrane traffic; regulates potassium influx; role in membrane organization at trans-Golgi network; required for delivery of Atg9p to the phagophore assembly site during autophagy under high temperature stress; required with Ypt6p for starvation-induced autophagy; required for the CVT pathway under non-starvation conditions; G protein of the Ras superfamily, similar to ADP-ribosylation factor [Source:SGD;Acc:S000000368])

HSP 1 Score: 152.525 bits (384), Expect = 2.316e-47
Identity = 74/166 (44.58%), Postives = 108/166 (65.06%), Query Frame = 3
Query:   78 MGSKVSKSKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAM 575
            M  K+  S +  RIL+LGLD AGKT+I+YRL++GE V+T PTIGFNVE +   K L+  +WD+GGQ  IR  WR YY ++ A+I+V+DS D +RM  A  EL  + + ++++   ++V ANKQD P A+S  E+ + L L  L+ D  W +    AI G+G+ E +
Sbjct:    8 MFDKLWGSNKELRILILGLDGAGKTTILYRLQIGEVVTTKPTIGFNVETLSY-KNLKLNVWDLGGQTSIRPYWRCYYADTAAVIFVVDSTDKDRMSTASKELHLMLQEEELQDAALLVFANKQDQPGALSASEVSKELNLVELK-DRSWSIVASSAIKGEGITEGL 171          
BLAST of ADP-ribosylation factor vs. Ensembl Yeast
Match: SAR1 (ARF family GTPase; component of the COPII vesicle coat; required for transport vesicle formation during ER to Golgi protein transport; lowers membrane rigidity aiding vesicle formation; localizes to ER-mitochondrial contact sites where it enhances membrane curvature, thereby reducing contact size via its N-terminal amphipathic helix; regulates mitochondrial fission and fusion dynamics [Source:SGD;Acc:S000006139])

HSP 1 Score: 97.8265 bits (242), Expect = 4.823e-26
Identity = 54/165 (32.73%), Postives = 93/165 (56.36%), Query Frame = 3
Query:  114 RILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLEL------QNLEPDHKWHLQPCCAISGDGLHEAMTAVAK 590
            ++L LGLD AGKT++++ LK     +  PT     EE+ IG  ++FT +D+GG  + R LW+ Y+     +++++D+ D ER   A+ EL ++F   ++K +P V+L NK D PNA+S  E++ +L L      Q +E      +  C  +  +G  EA   +++
Sbjct:   25 KLLFLGLDNAGKTTLLHMLKNDRLATLQPTWHPTSEELAIGN-IKFTTFDLGGHIQARRLWKDYFPEVNGIVFLVDAADPERFDEARVELDALFNIAELKDVPFVILGNKIDAPNAVSEAELRSALGLLNTTGSQRIEGQRPVEVFMCSVVMRNGYLEAFQWLSQ 188          
BLAST of ADP-ribosylation factor vs. Ensembl Nematostella
Match: EDO48359 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJD9])

HSP 1 Score: 198.364 bits (503), Expect = 7.087e-65
Identity = 93/158 (58.86%), Postives = 123/158 (77.85%), Query Frame = 3
Query:  102 KRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAM 575
            K+  RILM+GLDAAGKT+I+Y+LKLGE V+TIPTIGFNVE V+  K + FT+WDVGGQDKIR LWRHY++N++ LIYV+DSND ER+  +K EL  + + D++K   V+V+ANKQDLPNA+S  EI E L LQ++  D +W++Q  CA  G GL+E +
Sbjct:   15 KKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVESVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIYVVDSNDRERVNESKEELNKMLQEDELKDAVVLVMANKQDLPNALSVSEITEKLGLQSIR-DRQWYIQAACATQGTGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Nematostella
Match: EDO48360 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJE1])

HSP 1 Score: 198.364 bits (503), Expect = 1.895e-64
Identity = 93/158 (58.86%), Postives = 123/158 (77.85%), Query Frame = 3
Query:  102 KRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAM 575
            K+  RILM+GLDAAGKT+I+Y+LKLGE V+TIPTIGFNVE V+  K + FT+WDVGGQDKIR LWRHY++N++ LIYV+DSND ER+  +K EL  + + D++K   V+V+ANKQDLPNA+S  EI E L LQ++  D +W++Q  CA  G GL+E +
Sbjct:   15 KKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVESVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIYVVDSNDRERVNESKEELNKMLQEDELKDAVVLVMANKQDLPNALSVSEITEKLGLQSIR-DRQWYIQAACATQGTGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Nematostella
Match: EDO42156 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S214])

HSP 1 Score: 192.971 bits (489), Expect = 9.797e-63
Identity = 90/159 (56.60%), Postives = 122/159 (76.73%), Query Frame = 3
Query:   99 SKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAM 575
             K+  RILM+GLDAAGKT+I+Y+LKLGE V+TIPTIGFNVE V+  K + FT+WDVGGQDKIR LWRHY++N++ LI+V+DSND ER+  A+ EL  +   D+++   ++V ANKQDLPNAM+  EI + L L +L  + +W++Q  CA SGDGL+E +
Sbjct:   14 GKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVGEAREELNRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLR-NRQWYIQATCATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Nematostella
Match: EDO40858 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S616])

HSP 1 Score: 189.119 bits (479), Expect = 2.564e-61
Identity = 91/169 (53.85%), Postives = 123/169 (72.78%), Query Frame = 3
Query:   78 MGSKVSK--SKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAMT 578
            MG+  +K    +  RILMLGLDAAGKT+I+Y+LKLG+ V+TIPT+GFNVE V   K ++F +WDVGGQDKIR LWRHYY  ++ LI+V+D  D +R+  A++EL  I    +MK   ++V ANKQDLP+A+ P EIQE L+L  L+ D  W++QP CA +GDGL E ++
Sbjct:    1 MGNVFAKLFGSKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKK-VKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARTELHRIINDREMKDSIILVFANKQDLPDALKPHEIQERLQLTRLK-DRNWYVQPSCATTGDGLCEGLS 167          
BLAST of ADP-ribosylation factor vs. Ensembl Nematostella
Match: EDO40902 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S615])

HSP 1 Score: 188.348 bits (477), Expect = 5.323e-61
Identity = 89/168 (52.98%), Postives = 121/168 (72.02%), Query Frame = 3
Query:   78 MGSKVSK--SKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAM 575
            MG  +SK    +  RILMLGLDAAGKT+I+Y+LKLG+ V+TIPT+GFNVE V   K ++F +WDVGGQDKIR LWRHY+  S+ LI+V+D  D +R+  A+ EL  I    +MK + +++ ANKQDLP+AM P EIQE + L  +  D  W++QP CA +GDGL++ +
Sbjct:    1 MGKLLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTFQK-VKFNVWDVGGQDKIRPLWRHYFAGSQGLIFVVDCADRDRIDEARKELQRIINDREMKDVIILIFANKQDLPDAMKPHEIQEKMGLTRIR-DRNWYVQPSCATTGDGLYDGL 166          
BLAST of ADP-ribosylation factor vs. Ensembl Medaka
Match: ENSORLT00000030860.1 (ADP-ribosylation factor 1 [Source:NCBI gene;Acc:101167961])

HSP 1 Score: 192.971 bits (489), Expect = 2.583e-62
Identity = 91/159 (57.23%), Postives = 120/159 (75.47%), Query Frame = 3
Query:   99 SKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAM 575
             K+  RILM+GLDAAGKT+I+Y+LKLGE V+TIPTIGFNVE V+  K + FT+WDVGGQDKIR LWRHY++N++ LI+V+DSND ER+  AK EL  +   D+++   ++V ANKQDLPNAM+  EI + L L +L     W++Q  CA SGDGL+E +
Sbjct:   13 GKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEF-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVGEAKEELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLCLHSLRH-RNWYIQATCATSGDGLYEGL 169          
BLAST of ADP-ribosylation factor vs. Ensembl Medaka
Match: ENSORLT00000042909.1 (ADP ribosylation factor 3 [Source:NCBI gene;Acc:101170343])

HSP 1 Score: 192.586 bits (488), Expect = 3.949e-62
Identity = 91/163 (55.83%), Postives = 122/163 (74.85%), Query Frame = 3
Query:   99 SKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAMTAVA 587
             K+  RILM+GLDAAGKT+I+Y+LKLGE V+TIPTIGFNVE V+  K + FT+WDVGGQDKIR LWRHY++N++ LI+V+DSND ER+  A+ EL  +   D+++   ++V ANKQDLPNAM+  EI + L L +L     W++Q  CA SGDGL+E +  +A
Sbjct:   14 GKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRH-RNWYIQATCATSGDGLYEGLDWLA 174          
BLAST of ADP-ribosylation factor vs. Ensembl Medaka
Match: arf3b (ADP-ribosylation factor 3 [Source:NCBI gene;Acc:101174416])

HSP 1 Score: 192.586 bits (488), Expect = 3.949e-62
Identity = 91/163 (55.83%), Postives = 122/163 (74.85%), Query Frame = 3
Query:   99 SKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAMTAVA 587
             K+  RILM+GLDAAGKT+I+Y+LKLGE V+TIPTIGFNVE V+  K + FT+WDVGGQDKIR LWRHY++N++ LI+V+DSND ER+  A+ EL  +   D+++   ++V ANKQDLPNAM+  EI + L L +L     W++Q  CA SGDGL+E +  +A
Sbjct:   14 GKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRH-RNWYIQATCATSGDGLYEGLDWLA 174          
BLAST of ADP-ribosylation factor vs. Ensembl Medaka
Match: ENSORLT00000017697.2 (ADP ribosylation factor 1 [Source:NCBI gene;Acc:101175109])

HSP 1 Score: 191.045 bits (484), Expect = 1.261e-61
Identity = 88/159 (55.35%), Postives = 120/159 (75.47%), Query Frame = 3
Query:   99 SKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAM 575
             K+  RILM+GLDAAGKT+I+Y+LKLGE V+TIPTIGFNVE V+  K + FT+WDVGGQDKIR LWRHY++N++ LI+V+DSND ER   A+ EL  +   D+++   ++V ANKQDLPNAM+  E+ + L L +L  +  W++Q  CA +GDGL+E +
Sbjct:    8 GKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERCGEAREELLRMLAEDELRDAVLLVFANKQDLPNAMNAAELTDKLNLHSLR-NRNWYIQATCATTGDGLYEGL 164          
BLAST of ADP-ribosylation factor vs. Ensembl Medaka
Match: ENSORLT00000022012.2 (ADP ribosylation factor 1 [Source:NCBI gene;Acc:101175109])

HSP 1 Score: 191.43 bits (485), Expect = 1.277e-61
Identity = 88/159 (55.35%), Postives = 120/159 (75.47%), Query Frame = 3
Query:   99 SKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAM 575
             K+  RILM+GLDAAGKT+I+Y+LKLGE V+TIPTIGFNVE V+  K + FT+WDVGGQDKIR LWRHY++N++ LI+V+DSND ER   A+ EL  +   D+++   ++V ANKQDLPNAM+  E+ + L L +L  +  W++Q  CA +GDGL+E +
Sbjct:   13 GKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERCGEAREELLRMLAEDELRDAVLLVFANKQDLPNAMNAAELTDKLNLHSLR-NRNWYIQATCATTGDGLYEGL 169          
BLAST of ADP-ribosylation factor vs. Planmine SMEST
Match: SMESG000052735.1 (SMESG000052735.1)

HSP 1 Score: 367.081 bits (941), Expect = 3.941e-131
Identity = 176/176 (100.00%), Postives = 176/176 (100.00%), Query Frame = 3
Query:   78 MGSKVSKSKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAMTAVAKLSSEY 605
            MGSKVSKSKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAMTAVAKLSSEY
Sbjct:    1 MGSKVSKSKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAMTAVAKLSSEY 176          
BLAST of ADP-ribosylation factor vs. Planmine SMEST
Match: SMESG000052739.1 (SMESG000052739.1)

HSP 1 Score: 263.848 bits (673), Expect = 2.974e-90
Identity = 116/166 (69.88%), Postives = 143/166 (86.14%), Query Frame = 3
Query:  108 PRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAMTAVAKLSSEY 605
            P+RILMLGLDAAGKT+I+Y+LKL E V+TIPTIGFNVEEV IGKGL+FTIWDVGGQ+KIR+LW+HYY N   LIYV+DSND+ER+  ++ ELF+I E D+M+++P+VV+ANKQDLPNAMSP  I E LEL  L+P HKWH+Q CCA+SGDGL+EA+ A  KLS+EY
Sbjct:   20 PKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPSRIVEGLELSKLKPTHKWHIQACCAVSGDGLYEALEAAGKLSAEY 185          
BLAST of ADP-ribosylation factor vs. Planmine SMEST
Match: SMESG000052759.1 (SMESG000052759.1)

HSP 1 Score: 262.692 bits (670), Expect = 8.502e-90
Identity = 115/166 (69.28%), Postives = 144/166 (86.75%), Query Frame = 3
Query:  108 PRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAMTAVAKLSSEY 605
            P+RILMLGLDAAGKT+I+Y+LKL E V+TIPTIGFNVEEV IGKGL+FTIWDVGGQ+KIR+LW+HYY N   LIYV+DSND+ER+  ++ ELF+I E D+M+++P+VV+ANKQDLPNAMSP+ I E LEL  L+P HKW++Q CCA+SGDGL+EA+ A  KLS+EY
Sbjct:   20 PKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALEAAGKLSAEY 185          
BLAST of ADP-ribosylation factor vs. Planmine SMEST
Match: SMESG000052764.1 (SMESG000052764.1)

HSP 1 Score: 262.692 bits (670), Expect = 1.002e-89
Identity = 115/166 (69.28%), Postives = 144/166 (86.75%), Query Frame = 3
Query:  108 PRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAMTAVAKLSSEY 605
            P+RILMLGLDAAGKT+I+Y+LKL E V+TIPTIGFNVEEV IGKGL+FTIWDVGGQ+KIR+LW+HYY N   LIYV+DSND+ER+  ++ ELF+I E D+M+++P+VV+ANKQDLPNAMSP+ I E LEL  L+P HKW++Q CCA+SGDGL+EA+ A  KLS+EY
Sbjct:   20 PKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPDRIVEGLELSKLKPTHKWYIQACCAVSGDGLYEALEAAGKLSAEY 185          
BLAST of ADP-ribosylation factor vs. Planmine SMEST
Match: SMESG000052762.1 (SMESG000052762.1)

HSP 1 Score: 261.536 bits (667), Expect = 2.327e-89
Identity = 115/166 (69.28%), Postives = 142/166 (85.54%), Query Frame = 3
Query:  108 PRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEVKIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKSELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWHLQPCCAISGDGLHEAMTAVAKLSSEY 605
            P+RILMLGLDAAGKT+I+Y+LKL E V+TIPTIGFNVEEV IGKGL+FTIWDVGGQ +IR+LW+HYY N   LIYV+DSND+ER+  ++ ELF+I E D+M+++P+VV+ANKQDLPNAMSP  I E LEL  L+P HKWH+Q CCA+SGDGL+EA+ A  KLS+EY
Sbjct:   20 PKRILMLGLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQGRIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPSRIVEGLELSKLKPTHKWHIQACCAVSGDGLYEALEAAGKLSAEY 185          
The following BLAST results are available for this feature:
BLAST of ADP-ribosylation factor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ARF37.370e-6255.83ADP ribosylation factor 3 [Source:HGNC Symbol;Acc:... [more]
ARF37.370e-6255.83ADP ribosylation factor 3 [Source:HGNC Symbol;Acc:... [more]
ARF67.481e-6253.37ADP ribosylation factor 6 [Source:HGNC Symbol;Acc:... [more]
ARF11.357e-6156.60ADP ribosylation factor 1 [Source:HGNC Symbol;Acc:... [more]
ARF11.357e-6156.60ADP ribosylation factor 1 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of ADP-ribosylation factor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arf-61.971e-6254.34ADP-Ribosylation Factor related [Source:UniProtKB... [more]
arf-1.26.303e-6255.97ADP-ribosylation factor 1-like 2 [Source:UniProtK... [more]
arf-1.26.303e-6255.97ADP-ribosylation factor 1-like 2 [Source:UniProtK... [more]
arf-1.26.303e-6255.97ADP-ribosylation factor 1-like 2 [Source:UniProtK... [more]
arf-31.053e-6155.70ADP-Ribosylation Factor related; ADP-ribosylation ... [more]
back to top
BLAST of ADP-ribosylation factor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Arf79F2.208e-6255.97gene:FBgn0010348 transcript:FBtr0332054[more]
Arf79F2.208e-6255.97gene:FBgn0010348 transcript:FBtr0078573[more]
Arf79F2.208e-6255.97gene:FBgn0010348 transcript:FBtr0299906[more]
Arf79F2.208e-6255.97gene:FBgn0010348 transcript:FBtr0299907[more]
Arf79F2.208e-6255.97gene:FBgn0010348 transcript:FBtr0078571[more]
back to top
BLAST of ADP-ribosylation factor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arf3b4.689e-6255.83ADP-ribosylation factor 3b [Source:ZFIN;Acc:ZDB-GE... [more]
arf3b4.689e-6255.83ADP-ribosylation factor 3b [Source:ZFIN;Acc:ZDB-GE... [more]
arf15.526e-6256.60ADP-ribosylation factor 1 [Source:ZFIN;Acc:ZDB-GEN... [more]
arf6a6.821e-6252.81ADP-ribosylation factor 6a [Source:ZFIN;Acc:ZDB-GE... [more]
arf6b6.821e-6252.81ADP-ribosylation factor 6b [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of ADP-ribosylation factor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arf36.681e-6255.83ADP ribosylation factor 3 [Source:NCBI gene;Acc:10... [more]
arf51.418e-6156.60ADP ribosylation factor 5 [Source:NCBI gene;Acc:39... [more]
fibp2.054e-6156.60fibroblast growth factor (acidic) intracellular bi... [more]
arf46.250e-6155.97ADP ribosylation factor 4 [Source:NCBI gene;Acc:59... [more]
dcaf71.194e-6050.61DDB1 and CUL4 associated factor 7 [Source:Xenbase;... [more]
back to top
BLAST of ADP-ribosylation factor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Arf35.060e-6255.83ADP-ribosylation factor 3 [Source:MGI Symbol;Acc:M... [more]
Arf65.136e-6253.37ADP-ribosylation factor 6 [Source:MGI Symbol;Acc:M... [more]
Arf19.318e-6256.60ADP-ribosylation factor 1 [Source:MGI Symbol;Acc:M... [more]
Arf19.318e-6256.60ADP-ribosylation factor 1 [Source:MGI Symbol;Acc:M... [more]
Arf23.485e-6155.97ADP-ribosylation factor 2 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of ADP-ribosylation factor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P91924|ARF_DUGJA1.840e-6257.23ADP-ribosylation factor OS=Dugesia japonica OX=616... [more]
sp|P34727|ARF_AJECA3.352e-6253.98ADP-ribosylation factor OS=Ajellomyces capsulatus ... [more]
sp|P51823|ARF2_ORYSJ1.986e-6156.60ADP-ribosylation factor 2 OS=Oryza sativa subsp. j... [more]
sp|Q06396|ARF1_ORYSJ1.986e-6156.60ADP-ribosylation factor 1 OS=Oryza sativa subsp. j... [more]
sp|P61210|ARF1_LOCMI2.213e-6155.97ADP-ribosylation factor 1 OS=Locusta migratoria OX... [more]
back to top
BLAST of ADP-ribosylation factor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3I8S22.472e-6960.24ADP-ribosylation factor OS=Lingula unguis OX=7574 ... [more]
K1PJY73.052e-6757.99ADP-ribosylation factor 1 OS=Crassostrea gigas OX=... [more]
A0A210QTV15.326e-6758.33ADP-ribosylation factor 3 OS=Mizuhopecten yessoens... [more]
A0A210QTY71.347e-6657.14ADP-ribosylation factor 3 OS=Mizuhopecten yessoens... [more]
R7VJ461.455e-6657.14Uncharacterized protein OS=Capitella teleta OX=283... [more]
back to top
BLAST of ADP-ribosylation factor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arf14.386e-6256.60ADP-ribosylation factor 1 [Source:NCBI gene;Acc:10... [more]
arf2a1.222e-6156.60ADP-ribosylation factor 1-like [Source:NCBI gene;A... [more]
arf3a1.882e-6155.83ADP-ribosylation factor 3a [Source:ZFIN;Acc:ZDB-GE... [more]
arf2b3.775e-6155.97ADP-ribosylation factor 1 [Source:NCBI gene;Acc:10... [more]
arf2b4.187e-6155.97ADP-ribosylation factor 1 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of ADP-ribosylation factor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arf2a4.881e-6356.60ADP-ribosylation factor 2a [Source:ZFIN;Acc:ZDB-GE... [more]
arf11.485e-6256.60ADP-ribosylation factor 1 [Source:ZFIN;Acc:ZDB-GEN... [more]
ENSPMAT00000011118.13.190e-6152.81pep scaffold:Pmarinus_7.0:GL482736:15659:16189:-1 ... [more]
arf4a1.843e-5851.65ADP-ribosylation factor 4a [Source:ZFIN;Acc:ZDB-GE... [more]
arf4a3.552e-5852.91ADP-ribosylation factor 4a [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of ADP-ribosylation factor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
ARF13.821e-5853.25ADP-ribosylation factor; GTPase of the Ras superfa... [more]
ARF26.516e-5853.90ADP-ribosylation factor; GTPase of the Ras superfa... [more]
ARF32.084e-4944.89Glucose-repressible ADP-ribosylation factor; GTPas... [more]
ARL12.316e-4744.58Soluble GTPase with a role in regulation of membra... [more]
SAR14.823e-2632.73ARF family GTPase; component of the COPII vesicle ... [more]
back to top
BLAST of ADP-ribosylation factor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO483597.087e-6558.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO483601.895e-6458.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO421569.797e-6356.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO408582.564e-6153.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO409025.323e-6152.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ADP-ribosylation factor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000030860.12.583e-6257.23ADP-ribosylation factor 1 [Source:NCBI gene;Acc:10... [more]
ENSORLT00000042909.13.949e-6255.83ADP ribosylation factor 3 [Source:NCBI gene;Acc:10... [more]
arf3b3.949e-6255.83ADP-ribosylation factor 3 [Source:NCBI gene;Acc:10... [more]
ENSORLT00000017697.21.261e-6155.35ADP ribosylation factor 1 [Source:NCBI gene;Acc:10... [more]
ENSORLT00000022012.21.277e-6155.35ADP ribosylation factor 1 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of ADP-ribosylation factor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000052735.13.941e-131100.00SMESG000052735.1[more]
SMESG000052739.12.974e-9069.88SMESG000052739.1[more]
SMESG000052759.18.502e-9069.28SMESG000052759.1[more]
SMESG000052764.11.002e-8969.28SMESG000052764.1[more]
SMESG000052762.12.327e-8969.28SMESG000052762.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031844 ID=SMED30031844|Name=ADP-ribosylation factor|organism=Schmidtea mediterranea sexual|type=transcript|length=667bp
ATAATGTTTTATGGCATTCTATTGTTGATAAGTTTGCAATTACAAAAGGC
CAGTTCAAATCTATCTGTTAAAATTAGATGGGATCAAAGGTCAGCAAATC
AAAACGTCCCAGAAGAATTCTAATGCTAGGATTGGACGCCGCCGGAAAAA
CGTCAATTGTTTATAGGCTGAAATTGGGCGAACAAGTGTCAACAATTCCA
ACAATTGGATTCAATGTTGAGGAAGTAAAAATTGGAAAAGGTTTGAGATT
CACAATCTGGGATGTTGGCGGTCAAGACAAAATAAGGATGCTGTGGAGAC
ATTATTACCGAAATAGCAGAGCATTGATATATGTTATTGACAGTAATGAT
AGTGAAAGGATGCCAATTGCGAAAAGTGAATTGTTTTCGATTTTCGAATC
AGACGACATGAAACATATCCCTGTTGTTGTGCTAGCCAATAAACAGGACT
TACCAAATGCTATGTCTCCTGAAGAAATTCAAGAAAGTTTAGAATTACAA
AATCTTGAACCTGACCATAAATGGCATCTGCAACCCTGTTGTGCAATATC
TGGAGACGGGTTGCACGAGGCAATGACTGCGGTTGCCAAATTATCTTCTG
AATACATAAAAATTTTTAAAGATATGTGATAAAAAATCATTTTAATGAAA
TAAACTATTAATAAATC
back to top

protein sequence of SMED30031844-orf-1

>SMED30031844-orf-1 ID=SMED30031844-orf-1|Name=SMED30031844-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=184bp
MGSKVSKSKRPRRILMLGLDAAGKTSIVYRLKLGEQVSTIPTIGFNVEEV
KIGKGLRFTIWDVGGQDKIRMLWRHYYRNSRALIYVIDSNDSERMPIAKS
ELFSIFESDDMKHIPVVVLANKQDLPNAMSPEEIQESLELQNLEPDHKWH
LQPCCAISGDGLHEAMTAVAKLSSEYIKIFKDM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000141dorsal region of the whole animal
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR005225Small_GTP-bd_dom
IPR006689Small_GTPase_ARF/SAR
IPR027417P-loop_NTPase
IPR024156Small_GTPase_ARF
Vocabulary: molecular function
TermDefinition
GO:0005525GTP binding
GO:0000166nucleotide binding
Vocabulary: biological process
TermDefinition
GO:0007264small GTPase mediated signal transduction
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006689Small GTPase superfamily, ARF/SAR typePRINTSPR00328SAR1GTPBPcoord: 13..36
score: 48.04
coord: 69..94
score: 35.52
coord: 114..135
score: 41.98
IPR006689Small GTPase superfamily, ARF/SAR typePFAMPF00025Arfcoord: 4..170
e-value: 2.3E-65
score: 219.3
NoneNo IPR availableSMARTSM00177arf_sub_2coord: 1..180
e-value: 6.9E-68
score: 241.5
NoneNo IPR availableSMARTSM00178sar_sub_1coord: 1..177
e-value: 2.8E-18
score: 76.7
NoneNo IPR availableSMARTSM00175rab_sub_5coord: 13..182
e-value: 1.5E-4
score: -52.9
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 12..172
e-value: 1.0E-61
score: 209.4
NoneNo IPR availablePANTHERPTHR11711ADP RIBOSYLATION FACTOR-RELATEDcoord: 9..178
NoneNo IPR availablePANTHERPTHR11711:SF331coord: 9..178
NoneNo IPR availablePROSITEPS51417ARFcoord: 5..177
score: 22.065
NoneNo IPR availableCDDcd00878Arf_Arlcoord: 13..167
e-value: 7.79141E-87
score: 250.186
IPR005225Small GTP-binding protein domainTIGRFAMTIGR00231TIGR00231coord: 11..142
e-value: 3.0E-21
score: 73.8
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 8..173