Pre-mRNA cleavage complex 2 protein Pcf11

Overview
NamePre-mRNA cleavage complex 2 protein Pcf11
Smed IDSMED30031838
Length (bp)816
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Pre-mRNA cleavage complex 2 protein Pcf11 (SMED30031838) t-SNE clustered cells

Violin plots show distribution of expression levels for Pre-mRNA cleavage complex 2 protein Pcf11 (SMED30031838) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Pre-mRNA cleavage complex 2 protein Pcf11 (SMED30031838) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Pre-mRNA cleavage complex 2 protein Pcf11 (SMED30031838) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031838

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30031838h1SMcG0001671 SmedASXL_015941SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30031838h1SMcG0001671 SmedASXL_015941SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Pre-mRNA cleavage complex 2 protein Pcf11 vs. Ensembl Human
Match: PCF11 (PCF11 cleavage and polyadenylation factor subunit [Source:HGNC Symbol;Acc:HGNC:30097])

HSP 1 Score: 70.8626 bits (172), Expect = 3.425e-13
Identity = 52/185 (28.11%), Postives = 83/185 (44.86%), Query Frame = 2
Query:  260 VEELHKDYQCDICGIRFADKTSSRFVNHMDYHYLKNSIYSKTSSK--QRSYTKGSKSWI-----IDSNNRETT----TVAESKIVNVK--PEEKRFLILDEYPEH--EQCMVCFDKFDVVWDRDEDNYILANAVLVDDKAYHQNCTVDI--GKSFKVIDDDIKEALENIDPYLILQNLLKKDFQK 763
            +  L+   QC  CG+RF    +  + +H+D+HY +N      S K   R +      WI      D   R  +     V E  ++  +   +EK F  +   P    E C +C ++F+  WD +E+ + L NA+ VD K YH +C  D     SF       K  +EN  P  I+ N++K + Q+
Sbjct: 1334 INRLYTGIQCYSCGMRFTTSQTDVYADHLDWHYRQNRTEKDVSRKVTHRRWYYSLTDWIEFEEIADLEERAKSQFFEKVHEEVVLKTQEAAKEKEFQSVPAGPAGAVESCEICQEQFEQYWDEEEEEWHLKNAIRVDGKIYHPSCYEDYQNTSSFDCTPSPSKTPVEN--PLNIMLNIVKNELQE 1516          
BLAST of Pre-mRNA cleavage complex 2 protein Pcf11 vs. Ensembl Celegans
Match: pcf-11 (Polyadenylation and cleavage factor homolog 11 [Source:UniProtKB/Swiss-Prot;Acc:Q09345])

HSP 1 Score: 57.7658 bits (138), Expect = 3.149e-9
Identity = 40/148 (27.03%), Postives = 64/148 (43.24%), Query Frame = 2
Query:  287 CDICGIRFADKT--SSRFVNHMDYHYLKNSIYSKTSSKQ----RSYTKGSKSWIIDSNNRETTTVAESKIVNVKPEEKRFLILDEYPEHEQCMVCFDKFDVVWDRDEDNYILANAVLVDDKAYHQNCTVDIGKSFK----VIDDDIKE 700
            C  CG+R  D    S  + +HMD+H  +N     +++      R +   + +W+    + ET      K     PEE    +     + ++C VC +KFD  +D DE+ + L + V V  K  H  C  D  +S        D DIK+
Sbjct:  676 CKFCGMRLDDSQGKSKEWQDHMDWHVKQNLARHGSNNSAAVPYRQWYPSTSTWLTPRASDETNEQEADK-----PEEPLPGVASSGVKTKECSVCGEKFDEYYDDDEETWRLRDTVNVHGKIVHSACASDAARSLDNSSFFNDSDIKK 818          
BLAST of Pre-mRNA cleavage complex 2 protein Pcf11 vs. Ensembl Celegans
Match: pcf-11 (Polyadenylation and cleavage factor homolog 11 [Source:UniProtKB/Swiss-Prot;Acc:Q09345])

HSP 1 Score: 57.7658 bits (138), Expect = 3.149e-9
Identity = 40/148 (27.03%), Postives = 64/148 (43.24%), Query Frame = 2
Query:  287 CDICGIRFADKT--SSRFVNHMDYHYLKNSIYSKTSSKQ----RSYTKGSKSWIIDSNNRETTTVAESKIVNVKPEEKRFLILDEYPEHEQCMVCFDKFDVVWDRDEDNYILANAVLVDDKAYHQNCTVDIGKSFK----VIDDDIKE 700
            C  CG+R  D    S  + +HMD+H  +N     +++      R +   + +W+    + ET      K     PEE    +     + ++C VC +KFD  +D DE+ + L + V V  K  H  C  D  +S        D DIK+
Sbjct:  676 CKFCGMRLDDSQGKSKEWQDHMDWHVKQNLARHGSNNSAAVPYRQWYPSTSTWLTPRASDETNEQEADK-----PEEPLPGVASSGVKTKECSVCGEKFDEYYDDDEETWRLRDTVNVHGKIVHSACASDAARSLDNSSFFNDSDIKK 818          
BLAST of Pre-mRNA cleavage complex 2 protein Pcf11 vs. Ensembl Fly
Match: Pcf11 (gene:FBgn0264962 transcript:FBtr0339985)

HSP 1 Score: 48.9062 bits (115), Expect = 3.587e-6
Identity = 37/164 (22.56%), Postives = 67/164 (40.85%), Query Frame = 2
Query:  260 VEELHKDYQCDICGIRFADKTSSRFVNHMDYHYLKNSIYSKTSSKQRSYTKG--SKSWIIDSNN------RETTTVAESKIVNVKPEEKRFLILDEYPEHEQ------------------CMVCFDKFDVVWDRDEDNYILANAVLVDDKAYHQNCTVDIGKSF 673
            V  L+   QC  CG+RF  + + ++  H+D+H+ +N        ++R  T+   S+ W  D N+       E     E   +  + +      LDE  +                     C +C +KF+  ++ + + + L +A+ V+DK YH  C  D   S 
Sbjct: 1256 VAVLYLGMQCSSCGVRFPPEQTIKYSQHLDWHFRQN-------RRERDSTRKATSRKWYYDLNDWRQYEEIEDVEEREKNFLEAQGQPGGVEALDELSQQRSLDSPVPTCAAGRDDVDHCCDMCHEKFEQFYNEELEEWHLRSAIRVEDKIYHPLCYEDYKASL 1412          
BLAST of Pre-mRNA cleavage complex 2 protein Pcf11 vs. Ensembl Fly
Match: Pcf11 (gene:FBgn0264962 transcript:FBtr0302560)

HSP 1 Score: 48.9062 bits (115), Expect = 3.617e-6
Identity = 37/164 (22.56%), Postives = 67/164 (40.85%), Query Frame = 2
Query:  260 VEELHKDYQCDICGIRFADKTSSRFVNHMDYHYLKNSIYSKTSSKQRSYTKG--SKSWIIDSNN------RETTTVAESKIVNVKPEEKRFLILDEYPEHEQ------------------CMVCFDKFDVVWDRDEDNYILANAVLVDDKAYHQNCTVDIGKSF 673
            V  L+   QC  CG+RF  + + ++  H+D+H+ +N        ++R  T+   S+ W  D N+       E     E   +  + +      LDE  +                     C +C +KF+  ++ + + + L +A+ V+DK YH  C  D   S 
Sbjct: 1245 VAVLYLGMQCSSCGVRFPPEQTIKYSQHLDWHFRQN-------RRERDSTRKATSRKWYYDLNDWRQYEEIEDVEEREKNFLEAQGQPGGVEALDELSQQRSLDSPVPTCAAGRDDVDHCCDMCHEKFEQFYNEELEEWHLRSAIRVEDKIYHPLCYEDYKASL 1401          
BLAST of Pre-mRNA cleavage complex 2 protein Pcf11 vs. Ensembl Fly
Match: Pcf11 (gene:FBgn0264962 transcript:FBtr0345528)

HSP 1 Score: 48.9062 bits (115), Expect = 3.617e-6
Identity = 37/164 (22.56%), Postives = 67/164 (40.85%), Query Frame = 2
Query:  260 VEELHKDYQCDICGIRFADKTSSRFVNHMDYHYLKNSIYSKTSSKQRSYTKG--SKSWIIDSNN------RETTTVAESKIVNVKPEEKRFLILDEYPEHEQ------------------CMVCFDKFDVVWDRDEDNYILANAVLVDDKAYHQNCTVDIGKSF 673
            V  L+   QC  CG+RF  + + ++  H+D+H+ +N        ++R  T+   S+ W  D N+       E     E   +  + +      LDE  +                     C +C +KF+  ++ + + + L +A+ V+DK YH  C  D   S 
Sbjct: 1245 VAVLYLGMQCSSCGVRFPPEQTIKYSQHLDWHFRQN-------RRERDSTRKATSRKWYYDLNDWRQYEEIEDVEEREKNFLEAQGQPGGVEALDELSQQRSLDSPVPTCAAGRDDVDHCCDMCHEKFEQFYNEELEEWHLRSAIRVEDKIYHPLCYEDYKASL 1401          
BLAST of Pre-mRNA cleavage complex 2 protein Pcf11 vs. Ensembl Fly
Match: Pcf11 (gene:FBgn0264962 transcript:FBtr0339986)

HSP 1 Score: 48.521 bits (114), Expect = 3.801e-6
Identity = 37/164 (22.56%), Postives = 67/164 (40.85%), Query Frame = 2
Query:  260 VEELHKDYQCDICGIRFADKTSSRFVNHMDYHYLKNSIYSKTSSKQRSYTKG--SKSWIIDSNN------RETTTVAESKIVNVKPEEKRFLILDEYPEHEQ------------------CMVCFDKFDVVWDRDEDNYILANAVLVDDKAYHQNCTVDIGKSF 673
            V  L+   QC  CG+RF  + + ++  H+D+H+ +N        ++R  T+   S+ W  D N+       E     E   +  + +      LDE  +                     C +C +KF+  ++ + + + L +A+ V+DK YH  C  D   S 
Sbjct: 1351 VAVLYLGMQCSSCGVRFPPEQTIKYSQHLDWHFRQN-------RRERDSTRKATSRKWYYDLNDWRQYEEIEDVEEREKNFLEAQGQPGGVEALDELSQQRSLDSPVPTCAAGRDDVDHCCDMCHEKFEQFYNEELEEWHLRSAIRVEDKIYHPLCYEDYKASL 1507          
BLAST of Pre-mRNA cleavage complex 2 protein Pcf11 vs. Ensembl Fly
Match: Pcf11 (gene:FBgn0264962 transcript:FBtr0302294)

HSP 1 Score: 48.521 bits (114), Expect = 3.871e-6
Identity = 37/164 (22.56%), Postives = 67/164 (40.85%), Query Frame = 2
Query:  260 VEELHKDYQCDICGIRFADKTSSRFVNHMDYHYLKNSIYSKTSSKQRSYTKG--SKSWIIDSNN------RETTTVAESKIVNVKPEEKRFLILDEYPEHEQ------------------CMVCFDKFDVVWDRDEDNYILANAVLVDDKAYHQNCTVDIGKSF 673
            V  L+   QC  CG+RF  + + ++  H+D+H+ +N        ++R  T+   S+ W  D N+       E     E   +  + +      LDE  +                     C +C +KF+  ++ + + + L +A+ V+DK YH  C  D   S 
Sbjct: 1359 VAVLYLGMQCSSCGVRFPPEQTIKYSQHLDWHFRQN-------RRERDSTRKATSRKWYYDLNDWRQYEEIEDVEEREKNFLEAQGQPGGVEALDELSQQRSLDSPVPTCAAGRDDVDHCCDMCHEKFEQFYNEELEEWHLRSAIRVEDKIYHPLCYEDYKASL 1515          
BLAST of Pre-mRNA cleavage complex 2 protein Pcf11 vs. Ensembl Zebrafish
Match: pcf11 (PCF11 cleavage and polyadenylation factor subunit [Source:ZFIN;Acc:ZDB-GENE-041114-175])

HSP 1 Score: 62.003 bits (149), Expect = 2.302e-10
Identity = 42/157 (26.75%), Postives = 73/157 (46.50%), Query Frame = 2
Query:  260 VEELHKDYQCDICGIRFADKTSSRFVNHMDYHYLKNSIYSKTSSK--QRSYTKGSKSWI-----IDSNNRETTTVAE---SKIVNVKPE---EKRFLILDEYPE--HEQCMVCFDKFDVVWDRDEDNYILANAVLVDDKAYHQNCTVDIGKSFKVID 685
            + +L+   QC  CG+RF    +  + +H+D+HY +N      S K   R +      WI      D   R  +   E    ++V    E   E+ F  +    +  HE C +C ++F++ W+ +E+ + L NA+ VD+K YH +C  D   +   +D
Sbjct: 1231 ITKLYTGIQCYSCGMRFTASQTDVYADHLDWHYRQNRSEKDISKKVTHRRWYYSLTDWIEFEEIADLEERAKSQFFEKVHEEVVQKTQEAAKEREFQSVKAAADVVHELCEICQEQFEMYWEEEEEEWHLKNAIRVDEKTYHPSCYEDYKNTSSFMD 1387          
BLAST of Pre-mRNA cleavage complex 2 protein Pcf11 vs. Ensembl Zebrafish
Match: pcf11 (PCF11 cleavage and polyadenylation factor subunit [Source:ZFIN;Acc:ZDB-GENE-041114-175])

HSP 1 Score: 62.003 bits (149), Expect = 2.325e-10
Identity = 42/157 (26.75%), Postives = 73/157 (46.50%), Query Frame = 2
Query:  260 VEELHKDYQCDICGIRFADKTSSRFVNHMDYHYLKNSIYSKTSSK--QRSYTKGSKSWI-----IDSNNRETTTVAE---SKIVNVKPE---EKRFLILDEYPE--HEQCMVCFDKFDVVWDRDEDNYILANAVLVDDKAYHQNCTVDIGKSFKVID 685
            + +L+   QC  CG+RF    +  + +H+D+HY +N      S K   R +      WI      D   R  +   E    ++V    E   E+ F  +    +  HE C +C ++F++ W+ +E+ + L NA+ VD+K YH +C  D   +   +D
Sbjct: 1237 ITKLYTGIQCYSCGMRFTASQTDVYADHLDWHYRQNRSEKDISKKVTHRRWYYSLTDWIEFEEIADLEERAKSQFFEKVHEEVVQKTQEAAKEREFQSVKAAADVVHELCEICQEQFEMYWEEEEEEWHLKNAIRVDEKTYHPSCYEDYKNTSSFMD 1393          
BLAST of Pre-mRNA cleavage complex 2 protein Pcf11 vs. Ensembl Xenopus
Match: pcf11 (PCF11, cleavage and polyadenylation factor subunit [Source:NCBI gene;Acc:100170197])

HSP 1 Score: 71.633 bits (174), Expect = 1.848e-13
Identity = 53/183 (28.96%), Postives = 85/183 (46.45%), Query Frame = 2
Query:  260 VEELHKDYQCDICGIRFADKTSSRFVNHMDYHYLKNSIYSKTSSK--QRSYTKGSKSWI-----IDSNNRETT----TVAESKIVNVK--PEEKRFLILDEYPE--HEQCMVCFDKFDVVWDRDEDNYILANAVLVDDKAYHQNCTVDIGKSFKVIDDD---IKEALENIDPYLILQNLLKKD 754
            +  L+   QC  CG+RF    +  + +H+D+HY +N      S K   R +    K WI      D   R  +     V E  I+  +   +EK FL +   P    E C +C ++F+  WD +E+ + L NA+ ++DK YH +C  D   +   +D      K  LEN  P   + NL+K++
Sbjct: 1481 INRLYTGIQCYSCGMRFTKSQTDIYADHLDWHYRQNRTEKDVSRKITHRRWYYSLKDWIEFEEIADLEERAKSQFFEKVHEEVILKTQEAAKEKEFLSVPAGPAGADEICEICQEQFEQYWDEEEEEWHLKNAMRMNDKIYHPSCYEDYKNTSSFLDSTPSPSKTLLEN--PLNAMLNLVKEE 1661          
BLAST of Pre-mRNA cleavage complex 2 protein Pcf11 vs. Ensembl Xenopus
Match: pcf11 (PCF11, cleavage and polyadenylation factor subunit [Source:NCBI gene;Acc:100170197])

HSP 1 Score: 70.4774 bits (171), Expect = 5.004e-13
Identity = 53/183 (28.96%), Postives = 85/183 (46.45%), Query Frame = 2
Query:  260 VEELHKDYQCDICGIRFADKTSSRFVNHMDYHYLKNSIYSKTSSK--QRSYTKGSKSWI-----IDSNNRETTT----VAESKIVNVK--PEEKRFLILDEYPE--HEQCMVCFDKFDVVWDRDEDNYILANAVLVDDKAYHQNCTVDIGKSFKVIDDD---IKEALENIDPYLILQNLLKKD 754
            +  L+   QC  CG+RF    +  + +H+D+HY +N      S K   R +    K WI      D   R  +     V E  I+  +   +EK FL +   P    E C +C ++F+  WD +E+ + L NA+ ++DK YH +C  D   +   +D      K  LEN  P   + NL+K++
Sbjct: 1389 INRLYTGIQCYSCGMRFTKSQTDIYADHLDWHYRQNRTEKDVSRKITHRRWYYSLKDWIEFEEIADLEERAKSQFFEKVHEEVILKTQEAAKEKEFLSVPAGPAGADEICEICQEQFEQYWDEEEEEWHLKNAMRMNDKIYHPSCYEDYKNTSSFLDSTPSPSKTLLEN--PLNAMLNLVKEE 1569          
BLAST of Pre-mRNA cleavage complex 2 protein Pcf11 vs. Ensembl Mouse
Match: Pcf11 (PCF11 cleavage and polyadenylation factor subunit [Source:MGI Symbol;Acc:MGI:1919579])

HSP 1 Score: 70.8626 bits (172), Expect = 2.250e-13
Identity = 56/216 (25.93%), Postives = 91/216 (42.13%), Query Frame = 2
Query:  167 PVIKQTRNRKNWISILRNIVTSCFNKFNREAVEELHKDYQCDICGIRFADKTSSRFVNHMDYHYLKNSIYSKTSSK--QRSYTKGSKSWI-----IDSNNRETTT----VAESKIVNVK--PEEKRFLILDEYPEH--EQCMVCFDKFDVVWDRDEDNYILANAVLVDDKAYHQNCTVDI--GKSFKVIDDDIKEALENIDPYLILQNLLKKDFQK 763
            P   + +N    +  L N       +     +  L+   QC  CG+RF    +  + +H+D+HY +N      S K   R +      WI      D   R  +     V E  ++  +   +EK F  +   P    E C +C ++F+  WD +E+ + L NA+ VD K YH +C  D     SF       K  +EN  P  I+ N++K + Q+
Sbjct: 1224 PEEDEDQNEDQDVPDLTNFTIEELKQRYDSVINRLYTGIQCYSCGMRFTTSQTDVYADHLDWHYRQNRTEKDVSRKVTHRRWYYSLTDWIEFEEIADLEERAKSQFFEKVHEEVVLKTQEAAKEKEFQSVPAGPAGAVESCEICQEQFEQYWDEEEEEWHLKNAIRVDGKIYHPSCYEDYQNTSSFDCTPSPSKTPVEN--PLNIMLNIVKNELQE 1437          
BLAST of Pre-mRNA cleavage complex 2 protein Pcf11 vs. Ensembl Mouse
Match: Pcf11 (PCF11 cleavage and polyadenylation factor subunit [Source:MGI Symbol;Acc:MGI:1919579])

HSP 1 Score: 70.8626 bits (172), Expect = 2.265e-13
Identity = 56/216 (25.93%), Postives = 91/216 (42.13%), Query Frame = 2
Query:  167 PVIKQTRNRKNWISILRNIVTSCFNKFNREAVEELHKDYQCDICGIRFADKTSSRFVNHMDYHYLKNSIYSKTSSK--QRSYTKGSKSWI-----IDSNNRETTT----VAESKIVNVK--PEEKRFLILDEYPEH--EQCMVCFDKFDVVWDRDEDNYILANAVLVDDKAYHQNCTVDI--GKSFKVIDDDIKEALENIDPYLILQNLLKKDFQK 763
            P   + +N    +  L N       +     +  L+   QC  CG+RF    +  + +H+D+HY +N      S K   R +      WI      D   R  +     V E  ++  +   +EK F  +   P    E C +C ++F+  WD +E+ + L NA+ VD K YH +C  D     SF       K  +EN  P  I+ N++K + Q+
Sbjct: 1301 PEEDEDQNEDQDVPDLTNFTIEELKQRYDSVINRLYTGIQCYSCGMRFTTSQTDVYADHLDWHYRQNRTEKDVSRKVTHRRWYYSLTDWIEFEEIADLEERAKSQFFEKVHEEVVLKTQEAAKEKEFQSVPAGPAGAVESCEICQEQFEQYWDEEEEEWHLKNAIRVDGKIYHPSCYEDYQNTSSFDCTPSPSKTPVEN--PLNIMLNIVKNELQE 1514          
BLAST of Pre-mRNA cleavage complex 2 protein Pcf11 vs. UniProt/SwissProt
Match: sp|O94913|PCF11_HUMAN (Pre-mRNA cleavage complex 2 protein Pcf11 OS=Homo sapiens OX=9606 GN=PCF11 PE=1 SV=3)

HSP 1 Score: 70.8626 bits (172), Expect = 1.645e-12
Identity = 52/185 (28.11%), Postives = 83/185 (44.86%), Query Frame = 2
Query:  260 VEELHKDYQCDICGIRFADKTSSRFVNHMDYHYLKNSIYSKTSSK--QRSYTKGSKSWI-----IDSNNRETT----TVAESKIVNVK--PEEKRFLILDEYPEH--EQCMVCFDKFDVVWDRDEDNYILANAVLVDDKAYHQNCTVDI--GKSFKVIDDDIKEALENIDPYLILQNLLKKDFQK 763
            +  L+   QC  CG+RF    +  + +H+D+HY +N      S K   R +      WI      D   R  +     V E  ++  +   +EK F  +   P    E C +C ++F+  WD +E+ + L NA+ VD K YH +C  D     SF       K  +EN  P  I+ N++K + Q+
Sbjct: 1334 INRLYTGIQCYSCGMRFTTSQTDVYADHLDWHYRQNRTEKDVSRKVTHRRWYYSLTDWIEFEEIADLEERAKSQFFEKVHEEVVLKTQEAAKEKEFQSVPAGPAGAVESCEICQEQFEQYWDEEEEEWHLKNAIRVDGKIYHPSCYEDYQNTSSFDCTPSPSKTPVEN--PLNIMLNIVKNELQE 1516          
BLAST of Pre-mRNA cleavage complex 2 protein Pcf11 vs. UniProt/SwissProt
Match: sp|Q09345|PCF11_CAEEL (Polyadenylation and cleavage factor homolog 11 OS=Caenorhabditis elegans OX=6239 GN=pcf-11 PE=4 SV=1)

HSP 1 Score: 57.7658 bits (138), Expect = 4.005e-8
Identity = 40/148 (27.03%), Postives = 64/148 (43.24%), Query Frame = 2
Query:  287 CDICGIRFADKT--SSRFVNHMDYHYLKNSIYSKTSSKQ----RSYTKGSKSWIIDSNNRETTTVAESKIVNVKPEEKRFLILDEYPEHEQCMVCFDKFDVVWDRDEDNYILANAVLVDDKAYHQNCTVDIGKSFK----VIDDDIKE 700
            C  CG+R  D    S  + +HMD+H  +N     +++      R +   + +W+    + ET      K     PEE    +     + ++C VC +KFD  +D DE+ + L + V V  K  H  C  D  +S        D DIK+
Sbjct:  676 CKFCGMRLDDSQGKSKEWQDHMDWHVKQNLARHGSNNSAAVPYRQWYPSTSTWLTPRASDETNEQEADK-----PEEPLPGVASSGVKTKECSVCGEKFDEYYDDDEETWRLRDTVNVHGKIVHSACASDAARSLDNSSFFNDSDIKK 818          
BLAST of Pre-mRNA cleavage complex 2 protein Pcf11 vs. TrEMBL
Match: A0A0V0J1K8 (CID domain-containing protein (Fragment) OS=Schistocephalus solidus OX=70667 GN=TR88051 PE=4 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 1.678e-22
Identity = 53/138 (38.41%), Postives = 77/138 (55.80%), Query Frame = 2
Query:  260 VEELHKDYQCDICGIRFADKTSSRFVNHMDYHYLKNSIYSKTSSKQRSYTKGSKSWIIDSNNRETTTVAESKIVNVKPEEKRFLILDEYPEHEQCMVCFDKFDVVWDRDEDNYILANAVLVDDKAYHQNCTVDIGKSF 673
            +  L+  YQC  CG+RF D+ S  F  H+DYHY+KNS   +   + R+Y +    W++    R+     +   V V+ EE +     + P    C VCF+KFD  WD+DE+ ++L  AVLV DK YH  C  D+GK+F
Sbjct:  678 INALYSGYQCVQCGVRFEDEGSPDFAKHLDYHYVKNSAEHR-DRQSRTYYQSYHYWLMSEMTRDGAPQFKDT-VEVEEEEPKCPAFTD-PALNVCAVCFEKFDPFWDQDEEEWMLRGAVLVGDKVYHPICQEDVGKNF 812          
BLAST of Pre-mRNA cleavage complex 2 protein Pcf11 vs. TrEMBL
Match: A0A183T8X8 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS12926 PE=4 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 2.357e-22
Identity = 56/148 (37.84%), Postives = 82/148 (55.41%), Query Frame = 2
Query:  260 VEELHKDYQCDICGIRFADKTSSRFVNHMDYHYLKNSIYSKTSSKQRSYTKGSKSWIIDSNNRETTTVAESKIVNVKPEEKRFLILDEYPEHEQCMVCFDKFDVVWDRDEDNYILANAVLVDDKAYHQNCTVDIGKSFKVIDDDIKEA 703
            +  L+  YQC  CG+RF D+ S  F  H+DYHY+KNS   +   + R+Y +    W++    R+     +   V V+ EE +     + P    C VCF+KFD  WD+DE+ ++L  AVLV DK YH  C  D+GK+F  I   IK++
Sbjct:  580 INALYSGYQCVQCGVRFEDEGSPDFAKHLDYHYVKNSAEHR-DRQSRTYYQSYHYWLMSEMTRDGAPQFKD-TVEVEEEEPKCPAFTD-PALNVCAVCFEKFDPFWDQDEEEWMLRGAVLVGDKVYHPICQEDVGKNFNGISSYIKQS 724          
BLAST of Pre-mRNA cleavage complex 2 protein Pcf11 vs. TrEMBL
Match: A0A094ZUQ3 (Pre-mRNA cleavage complex 2 protein Pcf11 OS=Schistosoma haematobium OX=6185 GN=MS3_06338 PE=4 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 5.173e-22
Identity = 57/152 (37.50%), Postives = 85/152 (55.92%), Query Frame = 2
Query:  239 NKFNREAVEELHKDYQCDICGIRFADKTSSRFVNHMDYHYLKNSIYSKTSSKQRSYTKGSKSWIIDSNNRETTTVAE--SKIVNVKPEEKRFLILDEYPEHEQCMVCFDKFDVVWDRDEDNYILANAVLVDDKAYHQNCTVDIGKSFKVIDD 688
            N F  E ++EL+  +QC  CG+RF    S  F  H+DYHY+KNS Y +   + R++ +  + W+I    RE     E  S I +++ E K     D  P    C VC++ F+VVWD +E+ ++L +A+ VDDK YH  C  D GK F + D+
Sbjct:  717 NPFAVE-IDELYNGHQCGQCGLRFQSDLSPEFAKHLDYHYMKNSSYGQ-ERRSRNFYQPLQYWLISEMTREGAPQFEPGSPIHDLQ-EYKCTAFAD--PSKNVCAVCYESFEVVWDHEEEEWMLKDAIRVDDKVYHPICQEDAGKEFSIKDE 863          
BLAST of Pre-mRNA cleavage complex 2 protein Pcf11 vs. TrEMBL
Match: G7YCI4 (Pre-mRNA cleavage complex 2 protein Pcf11 OS=Clonorchis sinensis OX=79923 GN=CLF_104885 PE=4 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 5.717e-22
Identity = 49/155 (31.61%), Postives = 87/155 (56.13%), Query Frame = 2
Query:  263 EELHKDYQCDICGIRFADKTSSRFVNHMDYHYLKNSIYSKTSSKQRSYTKGSKSWIIDSNNRETTTVAESKIVNVKPEEKRFLILDEYPEHEQCMVCFDKFDVVWDRDEDNYILANAVLVDDKAYHQNCTVDIGKSFKVIDDDIKEALENIDPYL 727
            + L+  +QC  CG+RF    S  F +H+DYHY+KNS   ++  + R++ +G++ W++     +  +  +S+      +E +     + P    C VC++KFDV+WD +E+ ++L +AVLV +K YH  C  D GK F   D+ +   ++ + P L
Sbjct:  665 DNLYTGHQCSQCGLRFQSDLSPEFASHLDYHYMKNS-SDESERRSRNFYQGARYWLLSETVNDGGSQFDSETPLPDLQESKCPAFAD-PSRNVCAVCYEKFDVIWDHEEEEWMLRDAVLVQEKVYHPICQEDAGKEF-TPDNAVAHDMKEVPPPL 816          
BLAST of Pre-mRNA cleavage complex 2 protein Pcf11 vs. TrEMBL
Match: A0A075AD97 (CID domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_06732 PE=4 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 5.781e-22
Identity = 49/155 (31.61%), Postives = 87/155 (56.13%), Query Frame = 2
Query:  263 EELHKDYQCDICGIRFADKTSSRFVNHMDYHYLKNSIYSKTSSKQRSYTKGSKSWIIDSNNRETTTVAESKIVNVKPEEKRFLILDEYPEHEQCMVCFDKFDVVWDRDEDNYILANAVLVDDKAYHQNCTVDIGKSFKVIDDDIKEALENIDPYL 727
            + L+  +QC  CG+RF    S  F +H+DYHY+KNS   ++  + R++ +G++ W++     +  +  +S+      +E +     + P    C VC++KFDV+WD +E+ ++L +AVLV +K YH  C  D GK F   D+ +   ++ + P L
Sbjct:  705 DNLYTGHQCSQCGLRFQSDLSPEFASHLDYHYMKNS-SDESERRSRNFYQGARYWLLSETVNDGGSQFDSETPLPDLQESKCPAFAD-PSRNVCAVCYEKFDVIWDHEEEEWMLRDAVLVQEKVYHPICQEDAGKEF-TPDNAVAHDMKEVPPPL 856          
BLAST of Pre-mRNA cleavage complex 2 protein Pcf11 vs. Ensembl Cavefish
Match: pcf11 (PCF11 cleavage and polyadenylation factor subunit [Source:NCBI gene;Acc:103026916])

HSP 1 Score: 58.5362 bits (140), Expect = 2.387e-9
Identity = 40/157 (25.48%), Postives = 71/157 (45.22%), Query Frame = 2
Query:  260 VEELHKDYQCDICGIRFADKTSSRFVNHMDYHYLKNSIYSKTSSK--QRSYTKGSKSWI-----IDSNNRETTTVAE---SKIVNVKPE---EKRFLILDEYPE--HEQCMVCFDKFDVVWDRDEDNYILANAVLVDDKAYHQNCTVDIGKSFKVID 685
            + +L+   QC  CG+RF    +  + +H+D+HY +N      S K   R +      WI      D   R  +   E    ++V    E   E+ F  +   P+   E C +C ++ ++ W+ +E+ + L NA+ V+ K YH +C  D   +   +D
Sbjct: 1279 ITKLYTGIQCYSCGMRFTASQTDVYADHLDWHYRQNRSEKDISKKITHRRWYYTLTDWIEFEEIADLEERAKSQFFEKVHEEVVQKTQEAAKEREFQSVKAAPDVVDESCEICQEQLEMYWEEEEEEWHLKNAIRVEGKIYHPSCYEDYKNTSSFLD 1435          
BLAST of Pre-mRNA cleavage complex 2 protein Pcf11 vs. Ensembl Medaka
Match: pcf11 (PCF11 cleavage and polyadenylation factor subunit [Source:NCBI gene;Acc:101164244])

HSP 1 Score: 65.4698 bits (158), Expect = 1.274e-11
Identity = 40/152 (26.32%), Postives = 70/152 (46.05%), Query Frame = 2
Query:  260 VEELHKDYQCDICGIRFADKTSSRFVNHMDYHYLKNSIYSKTSSK--QRSYTKGSKSWI-----IDSNNRETTTVAESKIVNV------KPEEKRFLILDEYPEH--EQCMVCFDKFDVVWDRDEDNYILANAVLVDDKAYHQNCTVDIGKS 670
            V +L+   QC +C +RF+   +  + +H+D+H+ +N    + S K   R +      WI      D   R  +   E +   V        +EK F  +    +   E C +C + F+  W  +E+++ L NA+ VD+K +H +C  D  KS
Sbjct: 1245 VTKLYTGNQCCLCSMRFSATQTDLYADHLDWHFRQNHADKQASKKVTHRRWYYTLTDWIEFEEIADLEERAKSHFFEKENEEVVQKTQAAAKEKEFQSVRATKDQVGESCEICQEPFETYWVEEEEDWFLKNAIKVDEKNFHPSCFEDYKKS 1396          
BLAST of Pre-mRNA cleavage complex 2 protein Pcf11 vs. Ensembl Medaka
Match: pcf11 (PCF11 cleavage and polyadenylation factor subunit [Source:NCBI gene;Acc:101164244])

HSP 1 Score: 63.929 bits (154), Expect = 4.473e-11
Identity = 39/151 (25.83%), Postives = 69/151 (45.70%), Query Frame = 2
Query:  260 VEELHKDYQCDICGIRFADKTSSRFVNHMDYHYLKNSIYSKTSSK--QRSYTKGSKSWI-----IDSNNRETTTVAESKIVNV------KPEEKRFLILDEYPEH--EQCMVCFDKFDVVWDRDEDNYILANAVLVDDKAYHQNCTVDIGK 667
            V +L+   QC +C +RF+   +  + +H+D+H+ +N    + S K   R +      WI      D   R  +   E +   V        +EK F  +    +   E C +C + F+  W  +E+++ L NA+ VD+K +H +C  D  K
Sbjct: 1245 VTKLYTGNQCCLCSMRFSATQTDLYADHLDWHFRQNHADKQASKKVTHRRWYYTLTDWIEFEEIADLEERAKSHFFEKENEEVVQKTQAAAKEKEFQSVRATKDQVGESCEICQEPFETYWVEEEEDWFLKNAIKVDEKNFHPSCFEDYKK 1395          
BLAST of Pre-mRNA cleavage complex 2 protein Pcf11 vs. Planmine SMEST
Match: SMESG000059890.1 (SMESG000059890.1)

HSP 1 Score: 385.185 bits (988), Expect = 2.106e-129
Identity = 185/185 (100.00%), Postives = 185/185 (100.00%), Query Frame = 2
Query:  236 FNKFNREAVEELHKDYQCDICGIRFADKTSSRFVNHMDYHYLKNSIYSKTSSKQRSYTKGSKSWIIDSNNRETTTVAESKIVNVKPEEKRFLILDEYPEHEQCMVCFDKFDVVWDRDEDNYILANAVLVDDKAYHQNCTVDIGKSFKVIDDDIKEALENIDPYLILQNLLKKDFQKDSNIVYSGV 790
            FNKFNREAVEELHKDYQCDICGIRFADKTSSRFVNHMDYHYLKNSIYSKTSSKQRSYTKGSKSWIIDSNNRETTTVAESKIVNVKPEEKRFLILDEYPEHEQCMVCFDKFDVVWDRDEDNYILANAVLVDDKAYHQNCTVDIGKSFKVIDDDIKEALENIDPYLILQNLLKKDFQKDSNIVYSGV
Sbjct:  590 FNKFNREAVEELHKDYQCDICGIRFADKTSSRFVNHMDYHYLKNSIYSKTSSKQRSYTKGSKSWIIDSNNRETTTVAESKIVNVKPEEKRFLILDEYPEHEQCMVCFDKFDVVWDRDEDNYILANAVLVDDKAYHQNCTVDIGKSFKVIDDDIKEALENIDPYLILQNLLKKDFQKDSNIVYSGV 774          

HSP 2 Score: 95.9005 bits (237), Expect = 4.367e-22
Identity = 76/79 (96.20%), Postives = 78/79 (98.73%), Query Frame = 1
Query:    1 FNHMPVIXXXXXXXXXXLIQPAIQTXXXXXXXXXXXXXXXXSMSDINMICKNLISSGYQANSQQEKLDIDFTKYSYELF 237
            FNHMPVITPPMTTMTPPLIQPAIQTPPFNNCLLQN+NCNPNSMSDINMICKNLISSGYQANS+ EKLDIDFTKYSYELF
Sbjct:  512 FNHMPVITPPMTTMTPPLIQPAIQTPPFNNCLLQNINCNPNSMSDINMICKNLISSGYQANSKHEKLDIDFTKYSYELF 590          
BLAST of Pre-mRNA cleavage complex 2 protein Pcf11 vs. Planmine SMEST
Match: SMESG000059830.1 (SMESG000059830.1)

HSP 1 Score: 97.0561 bits (240), Expect = 1.662e-22
Identity = 52/154 (33.77%), Postives = 79/154 (51.30%), Query Frame = 2
Query:  230 SCFNKFNREAVEELHKDYQCDICGIRFADKTSSRFVNHMDYHYLKNSIYSKTSSKQRSYTKGSKSWIIDSN--------NRETTTVAESKIVNVKPEEKRFLILDEYPEHEQCMVCFDKFDVVWDRDEDNYILANAVLVDDKAYHQNCTVDIGK 667
            +CF   N + + EL+  +QCD+CG RF +K S  F  H+DYH+ KN+    ++ K R+Y  GS+ W++  +        N E TT  E K             + E  E  +C VC + F+V WD +E+ ++L +  L +DK YH  C  D  K
Sbjct:  552 NCFKMCNDKEISELYSGHQCDLCGTRFKNKDSKEFELHLDYHFYKNTTSLTSTRKGRNYVTGSRLWVLGGSMKAAEPEYNYEQTTSCEQKFK---------CPMFEDVEMNKCAVCMEGFEVAWDDEEEAFMLQDGQLHNDKVYHPICLEDADK 696          
BLAST of Pre-mRNA cleavage complex 2 protein Pcf11 vs. Planmine SMEST
Match: SMESG000059887.1 (SMESG000059887.1)

HSP 1 Score: 72.0182 bits (175), Expect = 5.529e-14
Identity = 45/152 (29.61%), Postives = 77/152 (50.66%), Query Frame = 2
Query:  212 LRNIVTSCFNKFNREAVEELHKDYQCDICGIRFADKTSSRFVNHMDYHYLKNSIYSKTSSKQRSYTKGSKSWIIDSNNRETTTVAESKIVNVKPEEKRFLILDEYPEHEQCMVCFDKFDVVWDRDEDNYILANAVLVDDKAYHQNCTVDIGK 667
            L+N   S F+  N     +L++   C IC  RF +  +  F  H+D+H++K    S+T    R YT     W       E   V +S  +  K E  R + L E  +  +C +C + FDV +D ++D+++L NA++ ++K YH  C +++ K
Sbjct:  627 LKNYSLSKFSILNDSTARKLYEGIPCGICHKRFRNTENPEFKRHLDFHFVK----SQTFKIVRRYTWNYSKWT------ENMFVKKSNQMPCKQEFVRTIQLSEDNQRNKCGICREIFDVRFDNEKDSFMLQNAIVQENKPYHPTC-IEVNK 767          
The following BLAST results are available for this feature:
BLAST of Pre-mRNA cleavage complex 2 protein Pcf11 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
PCF113.425e-1328.11PCF11 cleavage and polyadenylation factor subunit ... [more]
back to top
BLAST of Pre-mRNA cleavage complex 2 protein Pcf11 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pcf-113.149e-927.03Polyadenylation and cleavage factor homolog 11 [S... [more]
pcf-113.149e-927.03Polyadenylation and cleavage factor homolog 11 [S... [more]
back to top
BLAST of Pre-mRNA cleavage complex 2 protein Pcf11 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pcf113.587e-622.56gene:FBgn0264962 transcript:FBtr0339985[more]
Pcf113.617e-622.56gene:FBgn0264962 transcript:FBtr0302560[more]
Pcf113.617e-622.56gene:FBgn0264962 transcript:FBtr0345528[more]
Pcf113.801e-622.56gene:FBgn0264962 transcript:FBtr0339986[more]
Pcf113.871e-622.56gene:FBgn0264962 transcript:FBtr0302294[more]
back to top
BLAST of Pre-mRNA cleavage complex 2 protein Pcf11 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pcf112.302e-1026.75PCF11 cleavage and polyadenylation factor subunit ... [more]
pcf112.325e-1026.75PCF11 cleavage and polyadenylation factor subunit ... [more]
back to top
BLAST of Pre-mRNA cleavage complex 2 protein Pcf11 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pcf111.848e-1328.96PCF11, cleavage and polyadenylation factor subunit... [more]
pcf115.004e-1328.96PCF11, cleavage and polyadenylation factor subunit... [more]
back to top
BLAST of Pre-mRNA cleavage complex 2 protein Pcf11 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Pcf112.250e-1325.93PCF11 cleavage and polyadenylation factor subunit ... [more]
Pcf112.265e-1325.93PCF11 cleavage and polyadenylation factor subunit ... [more]
back to top
BLAST of Pre-mRNA cleavage complex 2 protein Pcf11 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|O94913|PCF11_HUMAN1.645e-1228.11Pre-mRNA cleavage complex 2 protein Pcf11 OS=Homo ... [more]
sp|Q09345|PCF11_CAEEL4.005e-827.03Polyadenylation and cleavage factor homolog 11 OS=... [more]
back to top
BLAST of Pre-mRNA cleavage complex 2 protein Pcf11 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0V0J1K81.678e-2238.41CID domain-containing protein (Fragment) OS=Schist... [more]
A0A183T8X82.357e-2237.84Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A094ZUQ35.173e-2237.50Pre-mRNA cleavage complex 2 protein Pcf11 OS=Schis... [more]
G7YCI45.717e-2231.61Pre-mRNA cleavage complex 2 protein Pcf11 OS=Clono... [more]
A0A075AD975.781e-2231.61CID domain-containing protein OS=Opisthorchis vive... [more]
back to top
BLAST of Pre-mRNA cleavage complex 2 protein Pcf11 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pcf112.387e-925.48PCF11 cleavage and polyadenylation factor subunit ... [more]
back to top
BLAST of Pre-mRNA cleavage complex 2 protein Pcf11 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pre-mRNA cleavage complex 2 protein Pcf11 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pre-mRNA cleavage complex 2 protein Pcf11 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pre-mRNA cleavage complex 2 protein Pcf11 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pcf111.274e-1126.32PCF11 cleavage and polyadenylation factor subunit ... [more]
pcf114.473e-1125.83PCF11 cleavage and polyadenylation factor subunit ... [more]
back to top
BLAST of Pre-mRNA cleavage complex 2 protein Pcf11 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000059890.12.106e-129100.00SMESG000059890.1[more]
SMESG000059830.11.662e-2233.77SMESG000059830.1[more]
SMESG000059887.15.529e-1429.61SMESG000059887.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031838 ID=SMED30031838|Name=Pre-mRNA cleavage complex 2 protein Pcf11|organism=Schmidtea mediterranea sexual|type=transcript|length=816bp
TTCAATCATATGCCTGTAATAACCCCACCGATGACCACAATGACCCCTCC
ACTTATCCAACCGGCAATACAAACTCCGCCATTCAACAATTGCCTATTGC
AAAACCTAAATTGCAATCCAAATTCCATGAGCGATATCAACATGATCTGT
AAGAATTTAATCTCATCCGGTTATCAAGCAAACTCGCAACAGGAAAAATT
GGATATCGATTTTACGAAATATAGTTACGAGTTGTTTTAACAAATTTAAC
CGCGAAGCCGTTGAAGAACTCCATAAAGATTATCAGTGCGATATATGTGG
GATTCGGTTCGCCGATAAAACCTCCTCGAGATTCGTTAATCACATGGATT
ATCATTATCTGAAGAACTCTATTTACTCGAAAACCTCATCCAAGCAGAGA
TCATATACAAAGGGATCGAAATCATGGATTATAGACAGCAATAATCGCGA
AACAACAACGGTCGCGGAATCGAAAATCGTGAATGTCAAACCCGAGGAGA
AAAGATTTCTCATATTGGATGAGTACCCGGAACATGAGCAGTGTATGGTT
TGTTTCGATAAGTTTGACGTTGTATGGGACAGAGACGAGGACAATTATAT
ATTGGCCAATGCGGTTTTAGTCGACGATAAAGCCTATCATCAAAACTGCA
CTGTGGATATCGGAAAATCTTTCAAAGTTATTGATGATGACATCAAAGAA
GCACTCGAGAATATTGATCCGTATTTGATATTGCAAAATTTGCTGAAAAA
AGACTTTCAAAAAGATTCAAATATAGTTTACAGTGGTGTATAAATTATTT
TATTATAATAAGAGTC
back to top

protein sequence of SMED30031838-orf-1

>SMED30031838-orf-1 ID=SMED30031838-orf-1|Name=SMED30031838-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=150bp
MDYHYLKNSIYSKTSSKQRSYTKGSKSWIIDSNNRETTTVAESKIVNVKP
EEKRFLILDEYPEHEQCMVCFDKFDVVWDRDEDNYILANAVLVDDKAYHQ
NCTVDIGKSFKVIDDDIKEALENIDPYLILQNLLKKDFQKDSNIVYSGV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: biological process
TermDefinition
GO:0000398mRNA splicing, via spliceosome
GO:0006369termination of RNA polymerase II transcription
GO:0006378mRNA polyadenylation
GO:0006379mRNA cleavage
GO:0006397mRNA processing
GO:0031124mRNA 3'-end processing
Vocabulary: molecular function
TermDefinition
GO:0000993RNA polymerase II core binding
GO:0003729mRNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005737cytoplasm
GO:0005739mitochondrion
GO:0005849mRNA cleavage factor complex