Translocating chain-associated membrane protein

Overview
NameTranslocating chain-associated membrane protein
Smed IDSMED30031823
Length (bp)1408
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Translocating chain-associated membrane protein (SMED30031823) t-SNE clustered cells

Violin plots show distribution of expression levels for Translocating chain-associated membrane protein (SMED30031823) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Translocating chain-associated membrane protein (SMED30031823) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Translocating chain-associated membrane protein (SMED30031823) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031823

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30031823SMESG000051052.1 dd_Smed_v4_1740_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30031823SMESG000051052.1 dd_Smed_v4_1740_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30031823SMESG000051052.1 dd_Smed_v4_1740_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30031823SMESG000051052.1 dd_Smed_v4_1740_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30031823SMESG000051052.1 dd_Smed_v4_1740_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30031823SMESG000051052.1 dd_Smed_v4_1740_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30031823SMESG000051052.1 dd_Smed_v4_1740_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30031823SMESG000051052.1 dd_Smed_v4_1740_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30031823SMESG000051052.1 dd_Smed_v4_1740_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031823SMESG000051052.1 Contig42298newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031823SMESG000051052.1 Contig42298uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 2 cellSMED30031823SMESG000051052.1 dd_Smed_v6_1740_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30031823SMESG000051052.1 dd_Smed_v6_1740_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30031823SMESG000051052.1 dd_Smed_v6_1740_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30031823SMESG000051052.1 dd_Smed_v6_1740_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Translocating chain-associated membrane protein vs. Ensembl Human
Match: TRAM1 (translocation associated membrane protein 1 [Source:HGNC Symbol;Acc:HGNC:20568])

HSP 1 Score: 290.041 bits (741), Expect = 9.370e-94
Identity = 159/336 (47.32%), Postives = 222/336 (66.07%), Query Frame = 1
Query:  121 SLRKKN-KNLSYFSHEYIIQNHGDIVSFVAMIIVMGLMFKVSTPLASMFVVMSHNVTNNETLSNKLEN--LYLPGRNDVLCCFFYTLICIVIHAVIQEYGLDKLNKKLHLSKTKYSKFNESGQLAVFYLVSAIWGANIIYTEKYITSLSDLWETYPNIPLTFWAKFYFIFQICYWLHNYPELYFQKVKRDEMPGRVLYTTLYLFAVLMPYVLNMTRLGLVLLVANYIVEFIFHFSRLIYFSGRIKYAKIGFLLWDFLFVATRILCTALAFLYFHVGLEQKNQPTIKIAEGNFNTKIVRLNGLVFIFVTQLYAMWNFLHFHMKRWREKSSIGKQGSK 1119
            ++RKK+ K+    SHE+++QNH DIVS VAM+ ++GLMF+++   + +FV + +NVT   T     E+  LY  G  D+   FFY L+ I+IHAVIQEY LDK+N+++H SKTK+SKFNESGQL+ FYL + +WG  I+ +E YI+  + LW  YP+  +TF  KF++I Q+ YWLH +PELYFQK K++++P +++Y  LYLF +   Y+LN+  LGLVLLV +Y VEF+FH SRL YFS   KY K GF LW  LFV  R+L   L+ L    GL +     +  + GNFN   VR+  L  I VTQ + MW F++F ++RWRE S+      K
Sbjct:    2 AIRKKSTKSPPVLSHEFVLQNHADIVSCVAMVFLLGLMFEITAKASIIFVTLQYNVTLPATEEQATESVSLYYYGIKDLATVFFYMLVAIIIHAVIQEYMLDKINRRMHFSKTKHSKFNESGQLSAFYLFACVWGTFILISENYISDPTILWRAYPHNLMTFQMKFFYISQLAYWLHAFPELYFQKTKKEDIPRQLVYIGLYLFHIAGAYLLNLNHLGLVLLVLHYFVEFLFHISRLFYFSNE-KYQK-GFSLWAVLFVLGRLLTLILSVLTVGFGLARAENQKLDFSTGNFNVLAVRIAVLASICVTQAFMMWKFINFQLRRWREHSAFQAPAVK 335          
BLAST of Translocating chain-associated membrane protein vs. Ensembl Human
Match: TRAM2 (translocation associated membrane protein 2 [Source:HGNC Symbol;Acc:HGNC:16855])

HSP 1 Score: 246.899 bits (629), Expect = 3.933e-77
Identity = 132/323 (40.87%), Postives = 199/323 (61.61%), Query Frame = 1
Query:  121 SLRKKNKNLSYFSHEYIIQNHGDIVSFVAMIIVMGLMFKVSTPLASMFVVMSHNVTNNETLSNKLENLYLPGRNDVLCCFFYTLICIVIHAVIQEYGLDKLNKKLHLSKTKYSKFNESGQLAVFYLVSAIWGANIIYTEKYITSLSDLWETYPNIPLTFWAKFYFIFQICYWLHNYPELYFQKVKRDEMPGRVLYTTLYLFAVLMPYVLNMTRLGLVLLVANYIVEFIFHFSRLIYFSGRIKYAKIGFLLWDFLFVATRILCTALAFLYFHVGLEQKNQPTIKIAEGNFNTKIVRLNGLVFIFVTQLYAMWNFLHFHMKRWRE 1089
            + R++ K+   FS E++I NH DI   + + +++GLMF+V+   A +F++  +N++     S  +   Y  G  D++   FY  I I++HAV+QEY LDK++K+LHLSK K+SKFNESGQL VF+  S IW   ++ TE Y+T+   LWE YP++ L F  KF+++ Q+ YWLH  PELYFQKV+++E+P ++ Y  LYL  +   Y+LN++RLGL+LL+  Y  EF+FH +RL YF+   +  +  F  W  +F  TR+    LA L    GL +         +GNFNT   RL  L+ +   Q + MW F+H  ++ WRE
Sbjct:    2 AFRRRTKSYPLFSQEFVIHNHADIGFCLVLCVLIGLMFEVTAKTAFLFILPQYNISVPTADSETVHYHY--GPKDLVTILFYIFITIILHAVVQEYILDKISKRLHLSKVKHSKFNESGQLVVFHFTSVIWCFYVVVTEGYLTNPRSLWEDYPHVHLPFQVKFFYLCQLAYWLHALPELYFQKVRKEEIPRQLQYICLYLVHIAGAYLLNLSRLGLILLLLQYSTEFLFHTARLFYFAD--ENNEKLFSAWAAVFGVTRLFILTLAVLAIGFGLARMENQAFDPEKGNFNTLFCRLCVLLLVCAAQAWLMWRFIHSQLRHWRE 320          
BLAST of Translocating chain-associated membrane protein vs. Ensembl Human
Match: TRAM1 (translocation associated membrane protein 1 [Source:HGNC Symbol;Acc:HGNC:20568])

HSP 1 Score: 227.639 bits (579), Expect = 1.068e-70
Identity = 123/243 (50.62%), Postives = 167/243 (68.72%), Query Frame = 1
Query:  370 LICIVIHAVIQEYGLDKLNKKLHLSKTKYSKFNESGQLAVFYLVSAIWGANIIYTEKYITSLSDLWETYPNIPLTFWAKFYFIFQICYWLHNYPELYFQKVKRDEMPGRVLYTTLYLFAVLMPYVLNMTRLGLVLLVANYIVEFIFHFSRLIYFSGRIKYAKIGFLLWDFLFVATRILCTALAFLYFHVGLEQKNQPTIKIAEGNFNTKIVRLNGLVFIFVTQLYAMWNFLHFHMKRWREKSS 1098
            L+ I+IHAVIQEY LDK+N+++H SKTK+SKFNESGQL+ FYL + +WG  I+ +E YI+  + LW  YP+  +TF  KF++I Q+ YWLH +PELYFQK K++++P +++Y  LYLF +   Y+LN+  LGLVLLV +Y VEF+FH SRL YFS   KY K GF LW  LFV  R+L   L+ L    GL +     +  + GNFN   VR+  L  I VTQ + MW F++F ++RWRE S+
Sbjct:    2 LVAIIIHAVIQEYMLDKINRRMHFSKTKHSKFNESGQLSAFYLFACVWGTFILISENYISDPTILWRAYPHNLMTFQMKFFYISQLAYWLHAFPELYFQKTKKEDIPRQLVYIGLYLFHIAGAYLLNLNHLGLVLLVLHYFVEFLFHISRLFYFSNE-KYQK-GFSLWAVLFVLGRLLTLILSVLTVGFGLARAENQKLDFSTGNFNVLAVRIAVLASICVTQAFMMWKFINFQLRRWREHSA 242          
BLAST of Translocating chain-associated membrane protein vs. Ensembl Human
Match: TRAM1L1 (translocation associated membrane protein 1 like 1 [Source:HGNC Symbol;Acc:HGNC:28371])

HSP 1 Score: 214.542 bits (545), Expect = 9.796e-65
Identity = 133/339 (39.23%), Postives = 197/339 (58.11%), Query Frame = 1
Query:  121 SLRKKN-KNLSYFSHEYIIQNHGDIVSFVAMIIVMGLMFKVSTPLASMFVVMSHNVT--NNETLSNKLENLYLPGRNDVLCCFFYTLICIVIHAVIQEYGLDKLNKKLHLSKTKYSKFNESGQLAVFYLVSAIWGANIIYTEKYITSLSDLWETYPNIPLTFWAKFYFIFQICYWLHNYPELYFQKVKRDEMPGRVLYTTLYLFAVLMPYVLNMTRLGLVLLVANYIVEFIFHFSRLIYFSGRIKYAKIGFLLWDFLFVATRILCTALAFLY--FHVGLEQKNQPTIKIAEGNFNTKIVRLNGLVFIFVTQLYAMWNFLHFHMKRWREKSSIGKQGSKM 1122
             LRKK+ KN    S E+I+QNH DIVS V M  ++GL+F+ +   + +F+ + H+V     E  +   ++LY  G  D+   FFY L+ I+IHA IQEY LDK+NK++  +K K +KFNESGQ +VFY  S IWG  I+ +E  ++  + +W+  P+  +TF  KF++I Q+ YW H +PELYFQK K+ ++P +++Y  L+LF +   Y+L +  LGL+LLV +Y VE + H   L YFS   KY K G  LW  +F+  R++   ++ L   FH+   Q   P      GN N    ++  L      Q Y  WN +   ++RW E S+I  Q S M
Sbjct:    2 GLRKKSTKNPPVLSQEFILQNHADIVSCVGMFFLLGLVFEGTAEASIVFLTLQHSVAVPAAEEQATGSKSLYYYGVKDLATVFFYMLVAIIIHATIQEYVLDKINKRMQFTKAKQNKFNESGQFSVFYFFSCIWGTFILISENCLSDPTLIWKARPHSMMTFQMKFFYISQLAYWFHAFPELYFQKTKKQDIPRQLVYIGLHLFHITGAYLLYLNHLGLLLLVLHYFVELLSHMCGLFYFSDE-KYQK-GISLWAIVFILGRLVTLIVSVLTVGFHLAGSQNRNP--DALTGNVNVLAAKIAVLSSSCTIQAYVTWNLITLWLQRWVEDSNI--QASCM 334          
BLAST of Translocating chain-associated membrane protein vs. Ensembl Human
Match: TRAM1 (translocation associated membrane protein 1 [Source:HGNC Symbol;Acc:HGNC:20568])

HSP 1 Score: 111.309 bits (277), Expect = 7.483e-29
Identity = 53/109 (48.62%), Postives = 76/109 (69.72%), Query Frame = 1
Query:  208 MIIVMGLMFKVSTPLASMFVVMSHNVTNNETLSNKLEN--LYLPGRNDVLCCFFYTLICIVIHAVIQEYGLDKLNKKLHLSKTKYSKFNESGQLAVFYLVSAIWGANII 528
            M+ ++GLMF+++   + +FV + +NVT   T     E+  LY  G  D+   FFY L+ I+IHAVIQEY LDK+N+++H SKTK+SKFNESGQL+ FYL + +WG  I+
Sbjct:    1 MVFLLGLMFEITAKASIIFVTLQYNVTLPATEEQATESVSLYYYGIKDLATVFFYMLVAIIIHAVIQEYMLDKINRRMHFSKTKHSKFNESGQLSAFYLFACVWGTFIL 109          
BLAST of Translocating chain-associated membrane protein vs. Ensembl Celegans
Match: tram-1 (Translocating chain-associated membrane protein [Source:UniProtKB/TrEMBL;Acc:Q9XXK7])

HSP 1 Score: 222.631 bits (566), Expect = 3.391e-68
Identity = 131/335 (39.10%), Postives = 194/335 (57.91%), Query Frame = 1
Query:  112 NAKSLRKKNKNLSYFSHEYIIQNHGDIVSFVAMIIVMGLMFKVSTPLASMFVVMSHNVTNNETLSNKLE---NLYLPGRNDVLCCFFYTLICIVIHAVIQEYGLDKLNKKLHLSKTKYSKFNESGQLAVFYLVSAIWGANIIYTEKY--ITSLSDLWETYPNIPLTFWA--KFYFIFQICYWLHNYPELYFQKVKRDEMPGRVLYTTLYLFAVLMPYVLNMTRLGLVLLVANYIVEFIFHFSRLIYFSGRIKYAKIGFLLWDFLFVATRILCTALAFLYFHVGLEQKNQPTIKIAEGNFNTKIVRLNGLVFIFVTQLYAMWNFLHFHMKRWREKS 1095
               S   K       SHE+IIQNHGDI+S V M+ ++GLMF ++  L+S+F+   +N T    +    E   + YL G  D+   FFY++  IV+HAV+QEYGLDK++KK HLSK    KF ES    +F+ V +I  A  I +E+    + +  +W  YP       A  K YFIFQI YW+H +PE Y QK+KRDE+  + +   L++  + + Y  N TR+GL L+   YI + IFH +R  +F GR   +   F L++  FV  R+    +A + F  GL Q   P + I+ GNFNT ++RLN L+ + + QL+ +++F+ FHM R+RE +
Sbjct:    5 QGGSKASKKPQPPILSHEFIIQNHGDIMSCVVMVFIVGLMFPLTHSLSSLFIAPQYNGTYTVAVEQGQEREVHGYLSGILDLPAIFFYSVCWIVVHAVVQEYGLDKISKKTHLSKVSTFKFGESFH-QMFFTVYSIAHAFYIVSERLEDFSEVKSVWLGYPTEHRVMSAAYKLYFIFQISYWIHQFPEFYLQKLKRDEIRQKSVQAILHIAFISIAYFFNFTRVGLALITLEYITQLIFHIARFAHFVGRKGLSDPAFKLFNGSFVLVRLGSIIIAVMTFWYGLRQAESPFVDISAGNFNTAVIRLNVLLAVVLLQLFLLYSFVVFHMGRFRESN 338          
BLAST of Translocating chain-associated membrane protein vs. Ensembl Celegans
Match: tram-1 (Translocating chain-associated membrane protein [Source:UniProtKB/TrEMBL;Acc:Q9XXK7])

HSP 1 Score: 220.32 bits (560), Expect = 3.109e-67
Identity = 133/336 (39.58%), Postives = 194/336 (57.74%), Query Frame = 1
Query:  112 NAKSLRKKNKNLSYFSHEYIIQNHGDIVSFVAMIIVMGLMFKVSTPLASMFVVMSHNVTNNETLSNKLE---NLYLPGRNDVLCCFFYTLICIVIHAVIQEYGLDKLNKKLHLSKTKYSKFNESGQLAVFYLVSAIWGANIIYTEKY-----ITSLSDLWETYPNIPLTFWA--KFYFIFQICYWLHNYPELYFQKVKRDEMPGRVLYTTLYLFAVLMPYVLNMTRLGLVLLVANYIVEFIFHFSRLIYFSGRIKYAKIGFLLWDFLFVATRILCTALAFLYFHVGLEQKNQPTIKIAEGNFNTKIVRLNGLVFIFVTQLYAMWNFLHFHMKRWRE 1089
               S   K       SHE+IIQNHGDI+S V M+ ++GLMF ++  L+S+F+   +N T    +    E   + YL G  D+   FFY++  IV+HAV+QEYGLDK++KK HLSK    KF ES    +F+ V +I  A  I +E+      + S S +W  YP       A  K YFIFQI YW+H +PE Y QK+KRDE+  + +   L++  + + Y  N TR+GL L+   YI + IFH +R  +F GR   +   F L++  FV  R+    +A + F  GL Q   P + I+ GNFNT ++RLN L+ + + QL+ +++F+ FHM R+RE
Sbjct:    5 QGGSKASKKPQPPILSHEFIIQNHGDIMSCVVMVFIVGLMFPLTHSLSSLFIAPQYNGTYTVAVEQGQEREVHGYLSGILDLPAIFFYSVCWIVVHAVVQEYGLDKISKKTHLSKVSTFKFGESFH-QMFFTVYSIAHAFYIVSERLEDFSEVKSFS-VWLGYPTEHRVMSAAYKLYFIFQISYWIHQFPEFYLQKLKRDEIRQKSVQAILHIAFISIAYFFNFTRVGLALITLEYITQLIFHIARFAHFVGRKGLSDPAFKLFNGSFVLVRLGSIIIAVMTFWYGLRQAESPFVDISAGNFNTAVIRLNVLLAVVLLQLFLLYSFVVFHMGRFRE 338          
BLAST of Translocating chain-associated membrane protein vs. Ensembl Celegans
Match: hyl-2 (Ceramide synthase hyl-2 [Source:UniProtKB/Swiss-Prot;Acc:Q7Z139])

HSP 1 Score: 48.1358 bits (113), Expect = 8.428e-6
Identity = 32/153 (20.92%), Postives = 77/153 (50.33%), Query Frame = 1
Query:  445 KTKYSKFNESGQLAVFYLVSAIWGANIIYTEKYITSLSDLWETYPNIPLTFWAKFYFIFQICYWLHNYPELYFQKVKRDEMPGRVLYTTLYLFAVLMPYVLNMTRLGLVLLVANYIVEFIFHFSRLIYFSGRIKYAKIGFLLWDFLFVATRIL 903
            + KYS+  E    A++Y +S + G  ++  E ++  +++ W  +P  P+     +Y+  Q  +++     + F   KR +    +++  + L  + + + +NM R+G ++LV++  V+ +    +++ +        I F    F++VATR++
Sbjct:   82 EKKYSRMAECAMRALYYTISFVCGLYLVLHESHLYDITECWRNWPFHPIPNAVAWYYWIQGGFYIALVFGILFLDAKRSDFWQMLVHHFITLALIGVSWTMNMVRVGTLILVSHDAVDILIDVGKILRYEQFETALTICFAGVLFVWVATRLV 234          
BLAST of Translocating chain-associated membrane protein vs. Ensembl Fly
Match: TRAM (gene:FBgn0040340 transcript:FBtr0070169)

HSP 1 Score: 223.016 bits (567), Expect = 2.450e-68
Identity = 133/375 (35.47%), Postives = 214/375 (57.07%), Query Frame = 1
Query:  127 RKKNKNLSYFSHEYIIQNHGDIVSFVAMIIVMGLMFKVSTPLASMFVVMSHNVTNNETLSNKLEN---LYLPGRNDVLCCFFYTLICIVIHAVIQEYGLDKLNKKLHLSKTKYSKFNESGQLAVFYLVSAIWGANIIYTEKYITSLSDLWETYPNIPLTFWAKFYFIFQICYWLHNYPELYFQKVK-RDEMPGRVLYTTLYLFAVLMPYVLNMTRLGLVLLVANYIVEFIFHFSRLI-YFSGRIKYAKIGFLLWDFLFVATRILCTALAFLYFHVGLEQKNQPTIKIAEGNFNTKIVRLNGLVFIFVTQLYAMWNFLHFHMKRWREKSSIGKQGSKMLFXXXXXXXXXXXXXXXXXXLNELPEADQNQQKELRQR 1236
            +  NKN    SHE++IQNH DI+S VAM+ V+GLM + +   AS F+ + HNV+  +    +       Y+ G  D    FFYTL CI++HA+IQE+ LDK++KKLHLSK K ++FNESGQL  FYL+S +WGA+++  E Y+  ++ LWE +P+ P++F  KFYF+ Q+ Y+LH  PELYFQK+K ++E   +++++      +++ Y L+  RL LVLL  +Y  E + H  +LI  F    + AK+  ++ + +F   R   + +  L  + G+            G   + +     L  +   Q Y +++F+   ++  RE     K+ +K+   TKK   T K   K + + ++LPEADQ     ++Q+
Sbjct:   10 KTSNKNPPILSHEFVIQNHADIISCVAMVFVVGLMNESTAAFASAFISLHHNVSGEDPSREQPYGKPYTYIAGIKDYCAIFFYTLTCIIMHAIIQEFVLDKISKKLHLSKFKLARFNESGQLVAFYLLSFVWGAHVLLKEGYLGQVAQLWEGFPDHPMSFLHKFYFVVQLAYYLHMLPELYFQKIKTKEEQQPKIVHSISGFTLIVLAYTLSFQRLALVLLTLHYFSELLSHVFQLIGVFDREERLAKLR-VVNNAVFFLIRFATSVIGVLTLYYGI------------GGVRSLLA----LGGLIALQGYLVFSFITEQLRAKREAKKEAKREAKLALQTKKPAKTPKDKVKRKKE-SDLPEADQTSPSPIKQK 366          
BLAST of Translocating chain-associated membrane protein vs. Ensembl Fly
Match: TRAM (gene:FBgn0040340 transcript:FBtr0070168)

HSP 1 Score: 223.016 bits (567), Expect = 2.450e-68
Identity = 133/375 (35.47%), Postives = 214/375 (57.07%), Query Frame = 1
Query:  127 RKKNKNLSYFSHEYIIQNHGDIVSFVAMIIVMGLMFKVSTPLASMFVVMSHNVTNNETLSNKLEN---LYLPGRNDVLCCFFYTLICIVIHAVIQEYGLDKLNKKLHLSKTKYSKFNESGQLAVFYLVSAIWGANIIYTEKYITSLSDLWETYPNIPLTFWAKFYFIFQICYWLHNYPELYFQKVK-RDEMPGRVLYTTLYLFAVLMPYVLNMTRLGLVLLVANYIVEFIFHFSRLI-YFSGRIKYAKIGFLLWDFLFVATRILCTALAFLYFHVGLEQKNQPTIKIAEGNFNTKIVRLNGLVFIFVTQLYAMWNFLHFHMKRWREKSSIGKQGSKMLFXXXXXXXXXXXXXXXXXXLNELPEADQNQQKELRQR 1236
            +  NKN    SHE++IQNH DI+S VAM+ V+GLM + +   AS F+ + HNV+  +    +       Y+ G  D    FFYTL CI++HA+IQE+ LDK++KKLHLSK K ++FNESGQL  FYL+S +WGA+++  E Y+  ++ LWE +P+ P++F  KFYF+ Q+ Y+LH  PELYFQK+K ++E   +++++      +++ Y L+  RL LVLL  +Y  E + H  +LI  F    + AK+  ++ + +F   R   + +  L  + G+            G   + +     L  +   Q Y +++F+   ++  RE     K+ +K+   TKK   T K   K + + ++LPEADQ     ++Q+
Sbjct:   10 KTSNKNPPILSHEFVIQNHADIISCVAMVFVVGLMNESTAAFASAFISLHHNVSGEDPSREQPYGKPYTYIAGIKDYCAIFFYTLTCIIMHAIIQEFVLDKISKKLHLSKFKLARFNESGQLVAFYLLSFVWGAHVLLKEGYLGQVAQLWEGFPDHPMSFLHKFYFVVQLAYYLHMLPELYFQKIKTKEEQQPKIVHSISGFTLIVLAYTLSFQRLALVLLTLHYFSELLSHVFQLIGVFDREERLAKLR-VVNNAVFFLIRFATSVIGVLTLYYGI------------GGVRSLLA----LGGLIALQGYLVFSFITEQLRAKREAKKEAKREAKLALQTKKPAKTPKDKVKRKKE-SDLPEADQTSPSPIKQK 366          
BLAST of Translocating chain-associated membrane protein vs. Ensembl Fly
Match: TRAM (gene:FBgn0040340 transcript:FBtr0332589)

HSP 1 Score: 223.016 bits (567), Expect = 2.450e-68
Identity = 133/375 (35.47%), Postives = 214/375 (57.07%), Query Frame = 1
Query:  127 RKKNKNLSYFSHEYIIQNHGDIVSFVAMIIVMGLMFKVSTPLASMFVVMSHNVTNNETLSNKLEN---LYLPGRNDVLCCFFYTLICIVIHAVIQEYGLDKLNKKLHLSKTKYSKFNESGQLAVFYLVSAIWGANIIYTEKYITSLSDLWETYPNIPLTFWAKFYFIFQICYWLHNYPELYFQKVK-RDEMPGRVLYTTLYLFAVLMPYVLNMTRLGLVLLVANYIVEFIFHFSRLI-YFSGRIKYAKIGFLLWDFLFVATRILCTALAFLYFHVGLEQKNQPTIKIAEGNFNTKIVRLNGLVFIFVTQLYAMWNFLHFHMKRWREKSSIGKQGSKMLFXXXXXXXXXXXXXXXXXXLNELPEADQNQQKELRQR 1236
            +  NKN    SHE++IQNH DI+S VAM+ V+GLM + +   AS F+ + HNV+  +    +       Y+ G  D    FFYTL CI++HA+IQE+ LDK++KKLHLSK K ++FNESGQL  FYL+S +WGA+++  E Y+  ++ LWE +P+ P++F  KFYF+ Q+ Y+LH  PELYFQK+K ++E   +++++      +++ Y L+  RL LVLL  +Y  E + H  +LI  F    + AK+  ++ + +F   R   + +  L  + G+            G   + +     L  +   Q Y +++F+   ++  RE     K+ +K+   TKK   T K   K + + ++LPEADQ     ++Q+
Sbjct:   10 KTSNKNPPILSHEFVIQNHADIISCVAMVFVVGLMNESTAAFASAFISLHHNVSGEDPSREQPYGKPYTYIAGIKDYCAIFFYTLTCIIMHAIIQEFVLDKISKKLHLSKFKLARFNESGQLVAFYLLSFVWGAHVLLKEGYLGQVAQLWEGFPDHPMSFLHKFYFVVQLAYYLHMLPELYFQKIKTKEEQQPKIVHSISGFTLIVLAYTLSFQRLALVLLTLHYFSELLSHVFQLIGVFDREERLAKLR-VVNNAVFFLIRFATSVIGVLTLYYGI------------GGVRSLLA----LGGLIALQGYLVFSFITEQLRAKREAKKEAKREAKLALQTKKPAKTPKDKVKRKKE-SDLPEADQTSPSPIKQK 366          
BLAST of Translocating chain-associated membrane protein vs. Ensembl Fly
Match: TRAM (gene:FBgn0040340 transcript:FBtr0070167)

HSP 1 Score: 223.016 bits (567), Expect = 2.450e-68
Identity = 133/375 (35.47%), Postives = 214/375 (57.07%), Query Frame = 1
Query:  127 RKKNKNLSYFSHEYIIQNHGDIVSFVAMIIVMGLMFKVSTPLASMFVVMSHNVTNNETLSNKLEN---LYLPGRNDVLCCFFYTLICIVIHAVIQEYGLDKLNKKLHLSKTKYSKFNESGQLAVFYLVSAIWGANIIYTEKYITSLSDLWETYPNIPLTFWAKFYFIFQICYWLHNYPELYFQKVK-RDEMPGRVLYTTLYLFAVLMPYVLNMTRLGLVLLVANYIVEFIFHFSRLI-YFSGRIKYAKIGFLLWDFLFVATRILCTALAFLYFHVGLEQKNQPTIKIAEGNFNTKIVRLNGLVFIFVTQLYAMWNFLHFHMKRWREKSSIGKQGSKMLFXXXXXXXXXXXXXXXXXXLNELPEADQNQQKELRQR 1236
            +  NKN    SHE++IQNH DI+S VAM+ V+GLM + +   AS F+ + HNV+  +    +       Y+ G  D    FFYTL CI++HA+IQE+ LDK++KKLHLSK K ++FNESGQL  FYL+S +WGA+++  E Y+  ++ LWE +P+ P++F  KFYF+ Q+ Y+LH  PELYFQK+K ++E   +++++      +++ Y L+  RL LVLL  +Y  E + H  +LI  F    + AK+  ++ + +F   R   + +  L  + G+            G   + +     L  +   Q Y +++F+   ++  RE     K+ +K+   TKK   T K   K + + ++LPEADQ     ++Q+
Sbjct:   10 KTSNKNPPILSHEFVIQNHADIISCVAMVFVVGLMNESTAAFASAFISLHHNVSGEDPSREQPYGKPYTYIAGIKDYCAIFFYTLTCIIMHAIIQEFVLDKISKKLHLSKFKLARFNESGQLVAFYLLSFVWGAHVLLKEGYLGQVAQLWEGFPDHPMSFLHKFYFVVQLAYYLHMLPELYFQKIKTKEEQQPKIVHSISGFTLIVLAYTLSFQRLALVLLTLHYFSELLSHVFQLIGVFDREERLAKLR-VVNNAVFFLIRFATSVIGVLTLYYGI------------GGVRSLLA----LGGLIALQGYLVFSFITEQLRAKREAKKEAKREAKLALQTKKPAKTPKDKVKRKKE-SDLPEADQTSPSPIKQK 366          
BLAST of Translocating chain-associated membrane protein vs. Ensembl Fly
Match: TRAM (gene:FBgn0040340 transcript:FBtr0307182)

HSP 1 Score: 223.016 bits (567), Expect = 2.450e-68
Identity = 133/375 (35.47%), Postives = 214/375 (57.07%), Query Frame = 1
Query:  127 RKKNKNLSYFSHEYIIQNHGDIVSFVAMIIVMGLMFKVSTPLASMFVVMSHNVTNNETLSNKLEN---LYLPGRNDVLCCFFYTLICIVIHAVIQEYGLDKLNKKLHLSKTKYSKFNESGQLAVFYLVSAIWGANIIYTEKYITSLSDLWETYPNIPLTFWAKFYFIFQICYWLHNYPELYFQKVK-RDEMPGRVLYTTLYLFAVLMPYVLNMTRLGLVLLVANYIVEFIFHFSRLI-YFSGRIKYAKIGFLLWDFLFVATRILCTALAFLYFHVGLEQKNQPTIKIAEGNFNTKIVRLNGLVFIFVTQLYAMWNFLHFHMKRWREKSSIGKQGSKMLFXXXXXXXXXXXXXXXXXXLNELPEADQNQQKELRQR 1236
            +  NKN    SHE++IQNH DI+S VAM+ V+GLM + +   AS F+ + HNV+  +    +       Y+ G  D    FFYTL CI++HA+IQE+ LDK++KKLHLSK K ++FNESGQL  FYL+S +WGA+++  E Y+  ++ LWE +P+ P++F  KFYF+ Q+ Y+LH  PELYFQK+K ++E   +++++      +++ Y L+  RL LVLL  +Y  E + H  +LI  F    + AK+  ++ + +F   R   + +  L  + G+            G   + +     L  +   Q Y +++F+   ++  RE     K+ +K+   TKK   T K   K + + ++LPEADQ     ++Q+
Sbjct:   10 KTSNKNPPILSHEFVIQNHADIISCVAMVFVVGLMNESTAAFASAFISLHHNVSGEDPSREQPYGKPYTYIAGIKDYCAIFFYTLTCIIMHAIIQEFVLDKISKKLHLSKFKLARFNESGQLVAFYLLSFVWGAHVLLKEGYLGQVAQLWEGFPDHPMSFLHKFYFVVQLAYYLHMLPELYFQKIKTKEEQQPKIVHSISGFTLIVLAYTLSFQRLALVLLTLHYFSELLSHVFQLIGVFDREERLAKLR-VVNNAVFFLIRFATSVIGVLTLYYGI------------GGVRSLLA----LGGLIALQGYLVFSFITEQLRAKREAKKEAKREAKLALQTKKPAKTPKDKVKRKKE-SDLPEADQTSPSPIKQK 366          
BLAST of Translocating chain-associated membrane protein vs. Ensembl Zebrafish
Match: zgc:113278 (zgc:113278 [Source:ZFIN;Acc:ZDB-GENE-050327-66])

HSP 1 Score: 330.872 bits (847), Expect = 6.232e-110
Identity = 170/337 (50.45%), Postives = 230/337 (68.25%), Query Frame = 1
Query:  127 RKKNKNLSYFSHEYIIQNHGDIVSFVAMIIVMGLMFKVSTPLASMFVVMSHNVTNNETLSNKLE------NLYLPGRNDVLCCFFYTLICIVIHAVIQEYGLDKLNKKLHLSKTKYSKFNESGQLAVFYLVSAIWGANIIYTEKYITSLSDLWETYPNIPLTFWAKFYFIFQICYWLHNYPELYFQKVKRDEMPGRVLYTTLYLFAVLMPYVLNMTRLGLVLLVANYIVEFIFHFSRLIYFSGRIKYAKIGFLLWDFLFVATRILCTALAFLYFHVGLEQKNQPTIKIAEGNFNTKIVRLNGLVFIFVTQLYAMWNFLHFHMKRWREKSSIGKQGSK 1119
            RKKNK+    SHE++IQNH D+VS VAMII++GLMF+V+   A MF+ + +NVT  ++L   +E      N Y  G  D+   FFY LI I++HA+IQEY LDK+N++LHLSKTK+SKFNESGQLA FYL S IWG +I+  E ++ + + LWE YP+I + F  KF++I QI YW H  PELYFQKV+++++P ++ Y  LY+F +   YVLN+ RLGLVLLV +Y+VE +FH SRL YFS   K  + GF LW  LFV TR+L   ++ L F  GL + +     +AEGNFN   VR+  L  I +TQ + MW F++F +K+WRE+S I  Q SK
Sbjct:    4 RKKNKSPPVLSHEFVIQNHADMVSCVAMIILLGLMFEVTAKFAIMFITVQYNVT--QSLDTDVEDKPDPVNFYKYGAKDIATVFFYLLIAIILHALIQEYILDKINRRLHLSKTKHSKFNESGQLATFYLFSFIWGCSILTNEDFVMNPTFLWEGYPHIHMAFQVKFFYICQIAYWFHALPELYFQKVRKEDIPRQLYYICLYIFHITGAYVLNLHRLGLVLLVPHYLVELLFHASRLFYFSDENK--QKGFTLWALLFVITRLLTLTVSVLTFGFGLSRTDNQGFSLAEGNFNVLTVRMTCLSAICLTQAWMMWKFINFQLKKWREQSQI--QASK 334          
BLAST of Translocating chain-associated membrane protein vs. Ensembl Zebrafish
Match: tram1 (translocation associated membrane protein 1 [Source:ZFIN;Acc:ZDB-GENE-021011-1])

HSP 1 Score: 303.908 bits (777), Expect = 1.850e-99
Identity = 152/326 (46.63%), Postives = 219/326 (67.18%), Query Frame = 1
Query:  127 RKKNKNLSYFSHEYIIQNHGDIVSFVAMIIVMGLMFKVSTPLASMFVVMSHNVT--NNETLSNKLENLYLPGRNDVLCCFFYTLICIVIHAVIQEYGLDKLNKKLHLSKTKYSKFNESGQLAVFYLVSAIWGANIIYTEKYITSLSDLWETYPNIPLTFWAKFYFIFQICYWLHNYPELYFQKVKRDEMPGRVLYTTLYLFAVLMPYVLNMTRLGLVLLVANYIVEFIFHFSRLIYFSGRIKYAKIGFLLWDFLFVATRILCTALAFLYFHVGLEQKNQPTIKIAEGNFNTKIVRLNGLVFIFVTQLYAMWNFLHFHMKRWREKSS 1098
            +K  KN    SHE++IQNH DIVS VAM+ ++GLMF++++ +A +F+ + +NVT   N        N +  G  DV   FFY L+ I++HA+IQEY LDK+N+K+H SKTK+SKFNESGQL+ FYL S +WGA+I+ +E  +++   LW+ YP+  + F  KFY+I Q+ YWLH  PELYFQK K++++P +++Y +LYL  +   Y LN+ RLGLVLLV +Y VE IFH SRLIYFS   + +  GF +W  LFV  R+L  +L+ L    GL    +  + +AEG+FN   VR+  L  I +TQ + MW F++F ++RWRE++ 
Sbjct:    5 KKTTKNPPVLSHEFVIQNHADIVSCVAMVFLLGLMFEITSKVAVLFITVQYNVTIPANGGPEEATVNYFHYGLKDVATIFFYMLVAIIMHAIIQEYVLDKINRKMHFSKTKHSKFNESGQLSAFYLFSCLWGASILVSENILSNPVSLWDGYPHTLMQFQMKFYYICQLGYWLHAIPELYFQKAKKEDIPRQLVYISLYLVHIAGAYALNLNRLGLVLLVLHYFVELIFHVSRLIYFSNEERQS--GFTVWAVLFVLGRLLTLSLSVLTVGFGLAGAEKQGLNLAEGSFNVLFVRVTVLAAICITQAFMMWKFINFQLRRWREQAQ 328          
BLAST of Translocating chain-associated membrane protein vs. Ensembl Zebrafish
Match: tram1 (translocation associated membrane protein 1 [Source:ZFIN;Acc:ZDB-GENE-021011-1])

HSP 1 Score: 303.908 bits (777), Expect = 1.850e-99
Identity = 152/326 (46.63%), Postives = 219/326 (67.18%), Query Frame = 1
Query:  127 RKKNKNLSYFSHEYIIQNHGDIVSFVAMIIVMGLMFKVSTPLASMFVVMSHNVT--NNETLSNKLENLYLPGRNDVLCCFFYTLICIVIHAVIQEYGLDKLNKKLHLSKTKYSKFNESGQLAVFYLVSAIWGANIIYTEKYITSLSDLWETYPNIPLTFWAKFYFIFQICYWLHNYPELYFQKVKRDEMPGRVLYTTLYLFAVLMPYVLNMTRLGLVLLVANYIVEFIFHFSRLIYFSGRIKYAKIGFLLWDFLFVATRILCTALAFLYFHVGLEQKNQPTIKIAEGNFNTKIVRLNGLVFIFVTQLYAMWNFLHFHMKRWREKSS 1098
            +K  KN    SHE++IQNH DIVS VAM+ ++GLMF++++ +A +F+ + +NVT   N        N +  G  DV   FFY L+ I++HA+IQEY LDK+N+K+H SKTK+SKFNESGQL+ FYL S +WGA+I+ +E  +++   LW+ YP+  + F  KFY+I Q+ YWLH  PELYFQK K++++P +++Y +LYL  +   Y LN+ RLGLVLLV +Y VE IFH SRLIYFS   + +  GF +W  LFV  R+L  +L+ L    GL    +  + +AEG+FN   VR+  L  I +TQ + MW F++F ++RWRE++ 
Sbjct:    5 KKTTKNPPVLSHEFVIQNHADIVSCVAMVFLLGLMFEITSKVAVLFITVQYNVTIPANGGPEEATVNYFHYGLKDVATIFFYMLVAIIMHAIIQEYVLDKINRKMHFSKTKHSKFNESGQLSAFYLFSCLWGASILVSENILSNPVSLWDGYPHTLMQFQMKFYYICQLGYWLHAIPELYFQKAKKEDIPRQLVYISLYLVHIAGAYALNLNRLGLVLLVLHYFVELIFHVSRLIYFSNEERQS--GFTVWAVLFVLGRLLTLSLSVLTVGFGLAGAEKQGLNLAEGSFNVLFVRVTVLAAICITQAFMMWKFINFQLRRWREQAQ 328          
BLAST of Translocating chain-associated membrane protein vs. Ensembl Zebrafish
Match: tram2 (translocation associated membrane protein 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2024])

HSP 1 Score: 271.937 bits (694), Expect = 5.676e-87
Identity = 141/324 (43.52%), Postives = 204/324 (62.96%), Query Frame = 1
Query:  121 SLRKKNKNLSYFSHEYIIQNHGDIVSFVAMIIVMGLMFKVSTPLASMFVVMSHNVTNNETLSNKLE-NLYLPGRNDVLCCFFYTLICIVIHAVIQEYGLDKLNKKLHLSKTKYSKFNESGQLAVFYLVSAIWGANIIYTEKYITSLSDLWETYPNIPLTFWAKFYFIFQICYWLHNYPELYFQKVKRDEMPGRVLYTTLYLFAVLMPYVLNMTRLGLVLLVANYIVEFIFHFSRLIYFSGRIKYAKIGFLLWDFLFVATRILCTALAFLYFHVGLEQKNQPTIKIAEGNFNTKIVRLNGLVFIFVTQLYAMWNFLHFHMKRWRE 1089
            + R++NK+  +FS E++IQNH DIV  + + I++GLMF+ +   A +F+   +N++    +S   E  LY  G  D     FY  I I++HAV+QEY LDK+N++LHLSK+K +KFNESGQL VFYLVS++W   +I TE ++   S LWE YP++ L F  KF+++ Q+ YW+H  PELYFQKV+++E+P ++ Y +LYL  +L  Y+LN+TR+GLVLL   Y+ E  FH SRL YF     +    F +W   FV TR++   L FL    GL +    T+ +  GNFNT  +RL  L  +  TQ + +W F  F + R RE
Sbjct:    2 AFRRRNKSYPFFSQEFLIQNHADIVFSLVIFILIGLMFETTAKTAILFIQPQYNIS---LMSADGEVTLYHYGWKDCATVLFYLCITIILHAVVQEYVLDKVNRRLHLSKSKNTKFNESGQLCVFYLVSSVWSLYVITTEGHLLHPSSLWENYPHVHLRFQVKFFYLTQLAYWIHALPELYFQKVRKEEIPRQLQYISLYLLHILAAYLLNLTRVGLVLLFLQYLSEMGFHLSRLFYFIDENHHKM--FEMWSVGFVLTRMITLTLMFLAVGFGLARSENQTLDLETGNFNTLSIRLLVLSVVCFTQSWLLWKFFRFQLSRTRE 320          
BLAST of Translocating chain-associated membrane protein vs. Ensembl Zebrafish
Match: tram2 (translocation associated membrane protein 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2024])

HSP 1 Score: 73.9442 bits (180), Expect = 3.473e-15
Identity = 44/113 (38.94%), Postives = 59/113 (52.21%), Query Frame = 1
Query:  751 MTRLGLVLLVANYIVEFIFHFSRLIYFSGRIKYAKIGFLLWDFLFVATRILCTALAFLYFHVGLEQKNQPTIKIAEGNFNTKIVRLNGLVFIFVTQLYAMWNFLHFHMKRWRE 1089
            +TR+GLVLL   Y+ E  FH SRL YF     +    F +W   FV TR++   L FL    GL +    T+ +  GNFNT  +RL  L  +  TQ + +W F  F + R RE
Sbjct:    2 LTRVGLVLLFLQYLSEMGFHLSRLFYFIDENHHKM--FEMWSVGFVLTRMITLTLMFLAVGFGLARSENQTLDLETGNFNTLSIRLLVLSVVCFTQSWLLWKFFRFQLSRTRE 112          
BLAST of Translocating chain-associated membrane protein vs. Ensembl Xenopus
Match: mbip (MAP3K12 binding inhibitory protein 1 [Source:Xenbase;Acc:XB-GENE-478230])

HSP 1 Score: 318.931 bits (816), Expect = 5.496e-105
Identity = 162/328 (49.39%), Postives = 223/328 (67.99%), Query Frame = 1
Query:  121 SLRKKN-KNLSYFSHEYIIQNHGDIVSFVAMIIVMGLMFKVSTPLASMFVVMSHNVT-NNETLSNKLENLYLPGRNDVLCCFFYTLICIVIHAVIQEYGLDKLNKKLHLSKTKYSKFNESGQLAVFYLVSAIWGANIIYTEKYITSLSDLWETYPNIPLTFWAKFYFIFQICYWLHNYPELYFQKVKRDEMPGRVLYTTLYLFAVLMPYVLNMTRLGLVLLVANYIVEFIFHFSRLIYFSGRIKYAKIGFLLWDFLFVATRILCTALAFLYFHVGLEQKNQPTIKIAEGNFNTKIVRLNGLVFIFVTQLYAMWNFLHFHMKRWREKSS 1098
             +RKKN K     SHE+IIQNH DIVS +AM+ ++GLMF+++  +A MFV + +NVT   E +  +  +LY  G  D+   FFY L+ I++HAVIQEY LDK+N+++H SKTK+SKFNESGQL+ FYL S IWGA+II +E Y +    LW+ YP+    F  KF++I Q+ YW H +PELYFQK K++++P +++Y  LYLF ++  YVLN+ RLGLVLLV +Y VEF+FH SRL YFS   KY K GF LW  LFV  R+L   L+ L    GL +     + ++ GNFN   +R++ L  I +TQ + MW F++F ++RWRE SS
Sbjct:    8 GIRKKNSKTPPVLSHEFIIQNHADIVSCLAMVFLLGLMFEITAKMAVMFVTLQYNVTIPVEGVLGEPASLYHYGIKDMATVFFYMLVAIILHAVIQEYILDKINRRMHFSKTKHSKFNESGQLSAFYLFSCIWGASIIVSENYFSDPISLWKGYPHTYFPFQMKFFYISQLAYWFHAFPELYFQKTKKEDIPRQLVYIGLYLFHIIGAYVLNLNRLGLVLLVLHYFVEFLFHMSRLFYFSNE-KYQK-GFTLWAVLFVLGRLLTLILSVLTVGFGLARAENQELDLSNGNFNILAIRISVLASICITQAFMMWKFINFQLRRWREHSS 333          
BLAST of Translocating chain-associated membrane protein vs. Ensembl Xenopus
Match: mbip (MAP3K12 binding inhibitory protein 1 [Source:Xenbase;Acc:XB-GENE-478230])

HSP 1 Score: 315.464 bits (807), Expect = 9.686e-104
Identity = 164/330 (49.70%), Postives = 223/330 (67.58%), Query Frame = 1
Query:  121 SLRKKN-KNLSYFSHEYIIQNHGDIVSFVAMIIVMGLMFKVS--TPLASMFVVMSHNVT-NNETLSNKLENLYLPGRNDVLCCFFYTLICIVIHAVIQEYGLDKLNKKLHLSKTKYSKFNESGQLAVFYLVSAIWGANIIYTEKYITSLSDLWETYPNIPLTFWAKFYFIFQICYWLHNYPELYFQKVKRDEMPGRVLYTTLYLFAVLMPYVLNMTRLGLVLLVANYIVEFIFHFSRLIYFSGRIKYAKIGFLLWDFLFVATRILCTALAFLYFHVGLEQKNQPTIKIAEGNFNTKIVRLNGLVFIFVTQLYAMWNFLHFHMKRWREKSS 1098
             +RKKN K     SHE+IIQNH DIVS +AM+ ++GLMF+VS    +A MFV + +NVT   E +  +  +LY  G  D+   FFY L+ I++HAVIQEY LDK+N+++H SKTK+SKFNESGQL+ FYL S IWGA+II +E Y +    LW+ YP+    F  KF++I Q+ YW H +PELYFQK K++++P +++Y  LYLF ++  YVLN+ RLGLVLLV +Y VEF+FH SRL YFS   KY K GF LW  LFV  R+L   L+ L    GL +     + ++ GNFN   +R++ L  I +TQ + MW F++F ++RWRE SS
Sbjct:    2 GIRKKNSKTPPVLSHEFIIQNHADIVSCLAMVFLLGLMFEVSITAKMAVMFVTLQYNVTIPVEGVLGEPASLYHYGIKDMATVFFYMLVAIILHAVIQEYILDKINRRMHFSKTKHSKFNESGQLSAFYLFSCIWGASIIVSENYFSDPISLWKGYPHTYFPFQMKFFYISQLAYWFHAFPELYFQKTKKEDIPRQLVYIGLYLFHIIGAYVLNLNRLGLVLLVLHYFVEFLFHMSRLFYFSNE-KYQK-GFTLWAVLFVLGRLLTLILSVLTVGFGLARAENQELDLSNGNFNILAIRISVLASICITQAFMMWKFINFQLRRWREHSS 329          
BLAST of Translocating chain-associated membrane protein vs. Ensembl Xenopus
Match: mbip (MAP3K12 binding inhibitory protein 1 [Source:Xenbase;Acc:XB-GENE-478230])

HSP 1 Score: 295.049 bits (754), Expect = 7.554e-96
Identity = 159/336 (47.32%), Postives = 217/336 (64.58%), Query Frame = 1
Query:  121 SLRKKN-KNLSYFSHEYIIQNHGDIVSFVAMIIVMGLMFKVSTPLASMFVVMSHNVT-NNETLSNKLENLYLPGRNDVLCCFFYTLICIVIHAVIQEYGLDKLNKKLHLSKTKYSKFNESGQLAVFYLVSAIWGANIIYTEKYITSLSDLWETYPNIPL--------TFWAKFYFIFQICYWLHNYPELYFQKVKRDEMPGRVLYTTLYLFAVLMPYVLNMTRLGLVLLVANYIVEFIFHFSRLIYFSGRIKYAKIGFLLWDFLFVATRILCTALAFLYFHVGLEQKNQPTIKIAEGNFNTKIVRLNGLVFIFVTQLYAMWNFLHFHMKRWREKSS 1098
             +RKKN K     SHE+IIQNH DIVS +AM+ ++GLMF+++  +A MFV + +NVT   E +  +  +LY  G  D+   FFY L+ I++HAVIQEY LDK+N+++H SKTK+SKFNESGQL+ FYL S IWGA+II +              PNI           F  KF++I Q+ YW H +PELYFQK K++++P +++Y  LYLF ++  YVLN+ RLGLVLLV +Y VEF+FH SRL YFS   KY K GF LW  LFV  R+L   L+ L    GL +     + ++ GNFN   +R++ L  I +TQ + MW F++F ++RWRE SS
Sbjct:    2 GIRKKNSKTPPVLSHEFIIQNHADIVSCLAMVFLLGLMFEITAKMAVMFVTLQYNVTIPVEGVLGEPASLYHYGIKDMATVFFYMLVAIILHAVIQEYILDKINRRMHFSKTKHSKFNESGQLSAFYLFSCIWGASIIVSV-----------NPPNIVTLCLFILLHRFQMKFFYISQLAYWFHAFPELYFQKTKKEDIPRQLVYIGLYLFHIIGAYVLNLNRLGLVLLVLHYFVEFLFHMSRLFYFSNE-KYQK-GFTLWAVLFVLGRLLTLILSVLTVGFGLARAENQELDLSNGNFNILAIRISVLASICITQAFMMWKFINFQLRRWREHSS 324          
BLAST of Translocating chain-associated membrane protein vs. Ensembl Xenopus
Match: mbip (MAP3K12 binding inhibitory protein 1 [Source:Xenbase;Acc:XB-GENE-478230])

HSP 1 Score: 262.692 bits (670), Expect = 1.153e-83
Identity = 131/260 (50.38%), Postives = 178/260 (68.46%), Query Frame = 1
Query:  319 NLYLPGRNDVLCCFFYTLICIVIHAVIQEYGLDKLNKKLHLSKTKYSKFNESGQLAVFYLVSAIWGANIIYTEKYITSLSDLWETYPNIPLTFWAKFYFIFQICYWLHNYPELYFQKVKRDEMPGRVLYTTLYLFAVLMPYVLNMTRLGLVLLVANYIVEFIFHFSRLIYFSGRIKYAKIGFLLWDFLFVATRILCTALAFLYFHVGLEQKNQPTIKIAEGNFNTKIVRLNGLVFIFVTQLYAMWNFLHFHMKRWREKSS 1098
            +LY  G  D+   FFY L+ I++HAVIQEY LDK+N+++H SKTK+SKFNESGQL+ FYL S IWGA+II +E Y +    LW+ YP+    F  KF++I Q+ YW H +PELYFQK K++++P +++Y  LYLF ++  YVLN+ RLGLVLLV +Y VEF+FH SRL YFS   KY K GF LW  LFV  R+L   L+ L    GL +     + ++ GNFN   +R++ L  I +TQ + MW F++F ++RWRE SS
Sbjct:   31 SLYHYGIKDMATVFFYMLVAIILHAVIQEYILDKINRRMHFSKTKHSKFNESGQLSAFYLFSCIWGASIIVSENYFSDPISLWKGYPHTYFPFQMKFFYISQLAYWFHAFPELYFQKTKKEDIPRQLVYIGLYLFHIIGAYVLNLNRLGLVLLVLHYFVEFLFHMSRLFYFSNE-KYQK-GFTLWAVLFVLGRLLTLILSVLTVGFGLARAENQELDLSNGNFNILAIRISVLASICITQAFMMWKFINFQLRRWREHSS 288          
BLAST of Translocating chain-associated membrane protein vs. Ensembl Xenopus
Match: abo.3 (ABO blood group (transferase A, alpha 1-3-N-acetylgalactosaminyltransferase; transferase B, alpha 1-3-galactosyltransferase) gene 3 [Source:Xenbase;Acc:XB-GENE-5962599])

HSP 1 Score: 234.187 bits (596), Expect = 3.601e-72
Identity = 132/320 (41.25%), Postives = 204/320 (63.75%), Query Frame = 1
Query:  130 KKNKNLSYFSHEYIIQNHGDIVSFVAMIIVMGLMFKVSTPLASMFVVMSHNVTNNETLSNKLENLYLPGRNDVLCCFFYTLICIVIHAVIQEYGLDKLNKKLHLSKTKYSKFNESGQLAVFYLVSAIWGANIIYTEKYITSLSDLWETYPNIPLTFWAKFYFIFQICYWLHNYPELYFQKVKRDEMPGRVLYTTLYLFAVLMPYVLNMTRLGLVLLVANYIVEFIFHFSRLIYFSGRIKYAKIGFLLWDFLFVATRILCTALAFLYFHVGLEQKNQPTIKIAEGNFNTKIVRLNGLVFIFVTQLYAMWNFLHFHMKRWRE 1089
            ++ K+   FS E++I NH DI  F  + +++GLMF+V+   A +F++  +N ++ ++L  +L   Y  G  D++   FY +I I++HA++QEY LDK+N++LHLSK K S+FNESGQLA F+L S  W   +  TE Y+++   LWE YP++ L F  KF+++ Q+ YWLH  PELYFQKVK++E+P ++ Y  LYL  +   Y+LN+TRLGL+LL+   + EF+FH +RL YF    +  +  F  W  +FV TR+    L  L    GL +    T    +G+FNT + R+  L+ + ++Q + MW F+HF ++RWRE
Sbjct:    4 RRRKSYPLFSQEFVIHNHADIGFFFVLCVLIGLMFEVTAKTAFIFILPQYN-SSIQSLDGELV-YYHYGVKDLVTILFYVVIAIILHAIVQEYILDKINRRLHLSKVKQSRFNESGQLAAFHLTSMFWCLYVSATEGYLSNPKTLWENYPHVYLPFQVKFFYLCQLAYWLHALPELYFQKVKKEEVPRQLQYIVLYLLHIAGAYLLNLTRLGLILLLLQSVAEFLFHIARLFYFID--ENNQKLFNAWGVIFVVTRLFTLTLTVLTVGFGLARAEIHTFNPDKGDFNTLLFRMVVLLLMCISQTWMMWRFIHFQLRRWRE 319          
BLAST of Translocating chain-associated membrane protein vs. Ensembl Mouse
Match: Tram1 (translocating chain-associating membrane protein 1 [Source:MGI Symbol;Acc:MGI:1919515])

HSP 1 Score: 290.041 bits (741), Expect = 5.965e-94
Identity = 156/326 (47.85%), Postives = 217/326 (66.56%), Query Frame = 1
Query:  127 RKKNKNLSYFSHEYIIQNHGDIVSFVAMIIVMGLMFKVSTPLASMFVVMSHNVTNNETLSNKLEN--LYLPGRNDVLCCFFYTLICIVIHAVIQEYGLDKLNKKLHLSKTKYSKFNESGQLAVFYLVSAIWGANIIYTEKYITSLSDLWETYPNIPLTFWAKFYFIFQICYWLHNYPELYFQKVKRDEMPGRVLYTTLYLFAVLMPYVLNMTRLGLVLLVANYIVEFIFHFSRLIYFSGRIKYAKIGFLLWDFLFVATRILCTALAFLYFHVGLEQKNQPTIKIAEGNFNTKIVRLNGLVFIFVTQLYAMWNFLHFHMKRWREKSS 1098
            +K NKN    SHE+++QNH DIVS +AM+ ++GLMF+V+   A +FV + +NVT   T     E+  LY  G  D+    FY L+ I+IHA+IQEY LDK+N+++H SKTK+SKFNESGQL+ FYL + +WG  I+ +E YI+  + LW  YP+  +TF  KF++I Q+ YWLH +PELYFQK K++++P +++Y  LYLF +   Y+LN+  LGLVLLV +Y VEF+FH SRL YFS   KY K GF LW  LFV  R+L   L+ L    GL +     +  + GNFN   VR+  L  I +TQ + MW F++F ++RWRE S+
Sbjct:    5 KKSNKNPPLLSHEFLLQNHADIVSCLAMLFLLGLMFEVTAKGAIIFVALQYNVTRPATEEQATESASLYHYGIKDLATVLFYMLVAIIIHAIIQEYVLDKINRRMHFSKTKHSKFNESGQLSAFYLFACVWGTFILISENYISDPTILWRAYPHNLMTFQTKFFYISQLAYWLHAFPELYFQKTKKEDIPRQLVYIGLYLFHIAGAYLLNLNHLGLVLLVLHYFVEFLFHISRLFYFSDE-KYQK-GFSLWAVLFVLGRLLTLILSVLTVGFGLARAENQKLDFSTGNFNVLAVRIAVLASICITQAFMMWKFINFQLRRWREHSA 328          
BLAST of Translocating chain-associated membrane protein vs. Ensembl Mouse
Match: Tram2 (translocating chain-associating membrane protein 2 [Source:MGI Symbol;Acc:MGI:1924817])

HSP 1 Score: 243.047 bits (619), Expect = 7.383e-76
Identity = 132/323 (40.87%), Postives = 201/323 (62.23%), Query Frame = 1
Query:  121 SLRKKNKNLSYFSHEYIIQNHGDIVSFVAMIIVMGLMFKVSTPLASMFVVMSHNVTNNETLSNKLENLYLPGRNDVLCCFFYTLICIVIHAVIQEYGLDKLNKKLHLSKTKYSKFNESGQLAVFYLVSAIWGANIIYTEKYITSLSDLWETYPNIPLTFWAKFYFIFQICYWLHNYPELYFQKVKRDEMPGRVLYTTLYLFAVLMPYVLNMTRLGLVLLVANYIVEFIFHFSRLIYFSGRIKYAKIGFLLWDFLFVATRILCTALAFLYFHVGLEQKNQPTIKIAEGNFNTKIVRLNGLVFIFVTQLYAMWNFLHFHMKRWRE 1089
            + R++ K+   FS E+II NH DI   + + +++GLMF+V+   A +F++  +N++     S  +   Y  G  D++   FY +I I+ HAV+QEY LDK++K+LHLSK K+SKFNESGQL VF+L +  W   +I TE Y+T+   LWE YP++ L+F  KF+++ Q+ YWLH+ PELYFQKV+++E+P ++ Y  LYL  +   Y+LN++RLGL+LL+  Y  E +FH +RL +F+   +  +  F  W  +F  TR+    LA L    GL +         +GNFNT   RL  L+ + V Q + MW F+H  ++ WRE
Sbjct:    2 AFRRRTKSYPLFSQEFIIHNHADIGFCLVLCVLIGLMFEVTAKTAFLFILPQYNISVPTADSETVHYHY--GPKDLVTILFYVVITIIFHAVVQEYILDKISKRLHLSKVKHSKFNESGQLLVFHLSAVAWCFYVIVTEGYLTNPRSLWEDYPHVYLSFQVKFFYLGQLAYWLHSLPELYFQKVRKEEVPRQLQYICLYLLHITGAYLLNLSRLGLILLLLQYSTEALFHMARLFHFAD--ENNERLFNAWAAVFGVTRLFILTLAVLTIGFGLARVENQVFDPEKGNFNTLPCRLGMLLLVCVAQAWLMWRFIHSQLRHWRE 320          
BLAST of Translocating chain-associated membrane protein vs. Ensembl Mouse
Match: Tram1l1 (translocation associated membrane protein 1-like 1 [Source:MGI Symbol;Acc:MGI:2443503])

HSP 1 Score: 218.394 bits (555), Expect = 2.348e-66
Identity = 129/337 (38.28%), Postives = 203/337 (60.24%), Query Frame = 1
Query:  121 SLRKKN-KNLSYFSHEYIIQNHGDIVSFVAMIIVMGLMFKVSTPLASMFVVMSHNVT-NNETLSNKLENLYLPGRNDVLCCFFYTLICIVIHAVIQEYGLDKLNKKLHLSKTKYSKFNESGQLAVFYLVSAIWGANIIYTEKYITSLSDLWETYPNIPLTFWAKFYFIFQICYWLHNYPELYFQKVKRDEMPGRVLYTTLYLFAVLMPYVLNMTRLGLVLLVANYIVEFIFHFSRLIYFSGRIKYAKIGFLLWDFLFVATRI--LCTALAFLYFHVGLEQKNQPTIKIAEGNFNTKIVRLNGLVFIFVTQLYAMWNFLHFHMKRWREKSSIGKQGSK 1119
             LRKKN +N    SHE+++QNH D+VS V M  V+GLMF+ ++ ++  F+ + H V    E L +    LY  G  D+   FFY L+ I+IHA IQEY LDKL+++L L+K K +K NE+GQL+VFY+VS IWG  I+ +E  ++  + LW++ P+  +TF  KF++I Q+ YW H++PELYFQKV++ ++PG+++Y  L+LF +   Y+L +  LGL+LL+ +Y VE +     L+YF G  +Y K G  LW  +F++ R+  L  ++  +  H+    +N   +    GN N    ++  L      Q+Y  W      ++RW E +++   G K
Sbjct:    2 GLRKKNARNPPVLSHEFMVQNHADMVSCVGMFFVLGLMFEGTSEMSIAFLTLQHGVVVPAEGLPSGSRTLYHYGVKDLATVFFYMLVAIIIHATIQEYVLDKLSRRLQLTKGKQNKLNEAGQLSVFYIVSGIWGMIILASENCLSDPTLLWKSQPHNMMTFQMKFFYISQLAYWFHSFPELYFQKVRKQDIPGQLIYIGLHLFHIGGAYLLYLNHLGLLLLMLHYAVELLSSVCSLLYF-GDERYQK-GLSLWPIVFISGRLVTLIVSVVTVGLHLAGTNRNGNAL---SGNVNVLAAKIAVLSSSCSIQVYITWTLTTVWLQRWLEDANLHVCGRK 333          
BLAST of Translocating chain-associated membrane protein vs. Ensembl Mouse
Match: Tram1 (translocating chain-associating membrane protein 1 [Source:MGI Symbol;Acc:MGI:1919515])

HSP 1 Score: 62.003 bits (149), Expect = 4.830e-12
Identity = 28/58 (48.28%), Postives = 41/58 (70.69%), Query Frame = 1
Query:  127 RKKNKNLSYFSHEYIIQNHGDIVSFVAMIIVMGLMFKVSTPLASMFVVMSHNVTNNET 300
            +K NKN    SHE+++QNH DIVS +AM+ ++GLMF+V+   A +FV + +NVT   T
Sbjct:    5 KKSNKNPPLLSHEFLLQNHADIVSCLAMLFLLGLMFEVTAKGAIIFVALQYNVTRPAT 62          
BLAST of Translocating chain-associated membrane protein vs. Ensembl Mouse
Match: Cers4 (ceramide synthase 4 [Source:MGI Symbol;Acc:MGI:1914510])

HSP 1 Score: 51.2174 bits (121), Expect = 1.681e-6
Identity = 36/148 (24.32%), Postives = 79/148 (53.38%), Query Frame = 1
Query:  460 KFNESGQLAVFYLVSAIWGANIIYTEKYITSLSDLWETYPNIPLTFWAKFYFIFQICYWLHNYPELYFQKVKRDEMPGRVLYTTLYLFAVLMPYVLNMTRLGLVLLVANYIVEFIFHFSRLIYFSGRIKYAKIGFLLWDFLFVATRIL 903
            KF E+    VFYL S + G +I+Y E ++ S S  WE YP+  L     ++++ ++ ++L     L F  VKR +   +V++  + +  +   Y +N+ R+G V+L+ +   +++    +++ ++   +     F+++  +F  TR++
Sbjct:  132 KFCEACWRFVFYLCSFVGGTSILYHESWLWSPSLCWENYPHQTLNLSLYWWYLLELGFYLSLLITLPFD-VKRKDFKEQVVHHFVAVGLIGFSYSVNLLRIGAVVLLLHDCSDYLLEGCKILNYAHFRRGCDALFIMFALVFFYTRLI 278          
BLAST of Translocating chain-associated membrane protein vs. UniProt/SwissProt
Match: sp|Q6DED0|TR1L1_XENLA (Translocating chain-associated membrane protein 1-like 1 OS=Xenopus laevis OX=8355 GN=tram1l1 PE=2 SV=1)

HSP 1 Score: 316.235 bits (809), Expect = 2.331e-103
Identity = 159/325 (48.92%), Postives = 219/325 (67.38%), Query Frame = 1
Query:  127 RKKNKNLSYFSHEYIIQNHGDIVSFVAMIIVMGLMFKVSTPLASMFVVMSHNVT-NNETLSNKLENLYLPGRNDVLCCFFYTLICIVIHAVIQEYGLDKLNKKLHLSKTKYSKFNESGQLAVFYLVSAIWGANIIYTEKYITSLSDLWETYPNIPLTFWAKFYFIFQICYWLHNYPELYFQKVKRDEMPGRVLYTTLYLFAVLMPYVLNMTRLGLVLLVANYIVEFIFHFSRLIYFSGRIKYAKIGFLLWDFLFVATRILCTALAFLYFHVGLEQKNQPTIKIAEGNFNTKIVRLNGLVFIFVTQLYAMWNFLHFHMKRWREKSS 1098
            +K +K     SHE+IIQNH DIVS +AM+ ++GLMF+++   A MFV + +NVT   E +  +  +LY  G  D+   FFY L+ I++HAVIQEY LDK+N+++H SKTK+SKFNESGQL+ FYL S IWGA+II +E Y +    LW+ YP+    F  KF++I Q+ YW H +PELYFQK K++++P +++Y  LYLF +L  YVLN+ RLGLVLLV +Y VEF+FH SRL YFS   KY K GF +W  LFV  R+L   L  L    GL +     + ++ GNFN   +R++ L  I +TQ + MW F++F ++RWRE SS
Sbjct:    5 KKSSKTPPVLSHEFIIQNHADIVSCLAMVFLLGLMFEITAKAAVMFVTLQYNVTIPVEGVLGEQASLYHYGIKDMATVFFYMLVAIILHAVIQEYILDKINRRMHFSKTKHSKFNESGQLSAFYLFSCIWGASIIVSENYFSDPISLWKGYPHTYFPFQMKFFYISQLAYWFHAFPELYFQKTKKEDIPRQLVYIGLYLFHILGAYVLNLNRLGLVLLVLHYFVEFLFHMSRLFYFSNE-KYQK-GFTVWALLFVLGRLLTLILCVLTVGFGLARAENQELDLSNGNFNILAIRISVLASICITQAFMMWKFINFQLRRWREHSS 327          
BLAST of Translocating chain-associated membrane protein vs. UniProt/SwissProt
Match: sp|Q5XI41|TRAM1_RAT (Translocating chain-associated membrane protein 1 OS=Rattus norvegicus OX=10116 GN=Tram1 PE=1 SV=3)

HSP 1 Score: 291.582 bits (745), Expect = 9.114e-94
Identity = 155/326 (47.55%), Postives = 218/326 (66.87%), Query Frame = 1
Query:  127 RKKNKNLSYFSHEYIIQNHGDIVSFVAMIIVMGLMFKVSTPLASMFVVMSHNVTNNETLSNKLEN--LYLPGRNDVLCCFFYTLICIVIHAVIQEYGLDKLNKKLHLSKTKYSKFNESGQLAVFYLVSAIWGANIIYTEKYITSLSDLWETYPNIPLTFWAKFYFIFQICYWLHNYPELYFQKVKRDEMPGRVLYTTLYLFAVLMPYVLNMTRLGLVLLVANYIVEFIFHFSRLIYFSGRIKYAKIGFLLWDFLFVATRILCTALAFLYFHVGLEQKNQPTIKIAEGNFNTKIVRLNGLVFIFVTQLYAMWNFLHFHMKRWREKSS 1098
            +K NKN    SHE+++QNH DIVS +AM+ ++GLMF+++   A +FV + +NVT   T     E+  LY  G  D+   FFY L+ I++HA+IQEY LDK+N+++H SKTK+SKFNESGQL+ FYL + +WG  I+ +E YI+  + LW  YP+  +TF  KF++I Q+ YWLH +PELYFQK K++++P +++Y  LYLF +   Y+LN+  LGLVLLV +Y VEF+FH SRL YFS   KY K GF LW  LFV  R+L   L+ L    GL +     +  + GNFN   VR+  L  I +TQ + MW F++F ++RWRE S+
Sbjct:    5 KKSNKNPPVLSHEFVLQNHADIVSCLAMLFLLGLMFEITAKGAIIFVALQYNVTRPATEEQAAESASLYYYGIKDLATVFFYMLVAIIVHAIIQEYVLDKINRRMHFSKTKHSKFNESGQLSAFYLFACVWGTFILVSENYISDPTILWRAYPHNLMTFQMKFFYISQLAYWLHAFPELYFQKTKKEDIPRQLVYIGLYLFHIAGAYLLNLNHLGLVLLVLHYFVEFLFHISRLFYFSDE-KYQK-GFSLWAVLFVLGRLLTLILSVLTVGFGLARAENQKLDFSTGNFNVLAVRIAVLASICITQAFMMWKFINFQLRRWREHSA 328          
BLAST of Translocating chain-associated membrane protein vs. UniProt/SwissProt
Match: sp|Q9GKZ4|TRAM1_BOVIN (Translocating chain-associated membrane protein 1 OS=Bos taurus OX=9913 GN=TRAM1 PE=2 SV=3)

HSP 1 Score: 290.812 bits (743), Expect = 1.760e-93
Identity = 157/333 (47.15%), Postives = 219/333 (65.77%), Query Frame = 1
Query:  127 RKKNKNLSYFSHEYIIQNHGDIVSFVAMIIVMGLMFKVSTPLASMFVVMSHNVTNNETLSNKLEN--LYLPGRNDVLCCFFYTLICIVIHAVIQEYGLDKLNKKLHLSKTKYSKFNESGQLAVFYLVSAIWGANIIYTEKYITSLSDLWETYPNIPLTFWAKFYFIFQICYWLHNYPELYFQKVKRDEMPGRVLYTTLYLFAVLMPYVLNMTRLGLVLLVANYIVEFIFHFSRLIYFSGRIKYAKIGFLLWDFLFVATRILCTALAFLYFHVGLEQKNQPTIKIAEGNFNTKIVRLNGLVFIFVTQLYAMWNFLHFHMKRWREKSSIGKQGSK 1119
            +K +KN    SHE+++QNH DIVS VAM+ ++GLMF+++  ++ +FV + +NVT   T     E+  LY  G  D+   FFY L+ I+IHA+IQEY LDK+N+++H SKTK+SKFNESGQL+ FYL S IWG  I+ +E YI+  + LW  YP+  +TF  KF++I Q+ YW H +PELYFQK K++++P +++Y  LYLF +   Y+LN+  LGLVLLV +Y VEF+FH SRL YFS   KY K GF LW  LFV  R+L   L+ L    GL +     +  + GNFN   VR+  L  I +TQ + MW F++F ++RWRE S+      K
Sbjct:    5 KKSSKNPPVLSHEFVLQNHADIVSCVAMVFLLGLMFEITAKVSIIFVTLQYNVTLPATEEQATESAFLYYYGIKDLATVFFYMLVAIIIHAIIQEYVLDKINRRMHFSKTKHSKFNESGQLSAFYLFSCIWGTFILISENYISDPTILWRAYPHNLMTFQMKFFYISQLAYWFHAFPELYFQKTKKEDIPRQLVYIGLYLFHIAGAYLLNLNHLGLVLLVLHYFVEFLFHISRLFYFSDE-KYQK-GFSLWAVLFVLGRLLTLILSVLTVGFGLARAENQKLDFSTGNFNVLAVRIAVLASICITQAFMMWKFINFQLRRWREHSAFQAPAVK 335          
BLAST of Translocating chain-associated membrane protein vs. UniProt/SwissProt
Match: sp|Q91V04|TRAM1_MOUSE (Translocating chain-associated membrane protein 1 OS=Mus musculus OX=10090 GN=Tram1 PE=1 SV=3)

HSP 1 Score: 290.041 bits (741), Expect = 4.172e-93
Identity = 156/326 (47.85%), Postives = 217/326 (66.56%), Query Frame = 1
Query:  127 RKKNKNLSYFSHEYIIQNHGDIVSFVAMIIVMGLMFKVSTPLASMFVVMSHNVTNNETLSNKLEN--LYLPGRNDVLCCFFYTLICIVIHAVIQEYGLDKLNKKLHLSKTKYSKFNESGQLAVFYLVSAIWGANIIYTEKYITSLSDLWETYPNIPLTFWAKFYFIFQICYWLHNYPELYFQKVKRDEMPGRVLYTTLYLFAVLMPYVLNMTRLGLVLLVANYIVEFIFHFSRLIYFSGRIKYAKIGFLLWDFLFVATRILCTALAFLYFHVGLEQKNQPTIKIAEGNFNTKIVRLNGLVFIFVTQLYAMWNFLHFHMKRWREKSS 1098
            +K NKN    SHE+++QNH DIVS +AM+ ++GLMF+V+   A +FV + +NVT   T     E+  LY  G  D+    FY L+ I+IHA+IQEY LDK+N+++H SKTK+SKFNESGQL+ FYL + +WG  I+ +E YI+  + LW  YP+  +TF  KF++I Q+ YWLH +PELYFQK K++++P +++Y  LYLF +   Y+LN+  LGLVLLV +Y VEF+FH SRL YFS   KY K GF LW  LFV  R+L   L+ L    GL +     +  + GNFN   VR+  L  I +TQ + MW F++F ++RWRE S+
Sbjct:    5 KKSNKNPPLLSHEFLLQNHADIVSCLAMLFLLGLMFEVTAKGAIIFVALQYNVTRPATEEQATESASLYHYGIKDLATVLFYMLVAIIIHAIIQEYVLDKINRRMHFSKTKHSKFNESGQLSAFYLFACVWGTFILISENYISDPTILWRAYPHNLMTFQTKFFYISQLAYWLHAFPELYFQKTKKEDIPRQLVYIGLYLFHIAGAYLLNLNHLGLVLLVLHYFVEFLFHISRLFYFSDE-KYQK-GFSLWAVLFVLGRLLTLILSVLTVGFGLARAENQKLDFSTGNFNVLAVRIAVLASICITQAFMMWKFINFQLRRWREHSA 328          
BLAST of Translocating chain-associated membrane protein vs. UniProt/SwissProt
Match: sp|Q15629|TRAM1_HUMAN (Translocating chain-associated membrane protein 1 OS=Homo sapiens OX=9606 GN=TRAM1 PE=1 SV=3)

HSP 1 Score: 290.041 bits (741), Expect = 4.500e-93
Identity = 159/336 (47.32%), Postives = 222/336 (66.07%), Query Frame = 1
Query:  121 SLRKKN-KNLSYFSHEYIIQNHGDIVSFVAMIIVMGLMFKVSTPLASMFVVMSHNVTNNETLSNKLEN--LYLPGRNDVLCCFFYTLICIVIHAVIQEYGLDKLNKKLHLSKTKYSKFNESGQLAVFYLVSAIWGANIIYTEKYITSLSDLWETYPNIPLTFWAKFYFIFQICYWLHNYPELYFQKVKRDEMPGRVLYTTLYLFAVLMPYVLNMTRLGLVLLVANYIVEFIFHFSRLIYFSGRIKYAKIGFLLWDFLFVATRILCTALAFLYFHVGLEQKNQPTIKIAEGNFNTKIVRLNGLVFIFVTQLYAMWNFLHFHMKRWREKSSIGKQGSK 1119
            ++RKK+ K+    SHE+++QNH DIVS VAM+ ++GLMF+++   + +FV + +NVT   T     E+  LY  G  D+   FFY L+ I+IHAVIQEY LDK+N+++H SKTK+SKFNESGQL+ FYL + +WG  I+ +E YI+  + LW  YP+  +TF  KF++I Q+ YWLH +PELYFQK K++++P +++Y  LYLF +   Y+LN+  LGLVLLV +Y VEF+FH SRL YFS   KY K GF LW  LFV  R+L   L+ L    GL +     +  + GNFN   VR+  L  I VTQ + MW F++F ++RWRE S+      K
Sbjct:    2 AIRKKSTKSPPVLSHEFVLQNHADIVSCVAMVFLLGLMFEITAKASIIFVTLQYNVTLPATEEQATESVSLYYYGIKDLATVFFYMLVAIIIHAVIQEYMLDKINRRMHFSKTKHSKFNESGQLSAFYLFACVWGTFILISENYISDPTILWRAYPHNLMTFQMKFFYISQLAYWLHAFPELYFQKTKKEDIPRQLVYIGLYLFHIAGAYLLNLNHLGLVLLVLHYFVEFLFHISRLFYFSNE-KYQK-GFSLWAVLFVLGRLLTLILSVLTVGFGLARAENQKLDFSTGNFNVLAVRIAVLASICVTQAFMMWKFINFQLRRWREHSAFQAPAVK 335          
BLAST of Translocating chain-associated membrane protein vs. TrEMBL
Match: A0A267EGW3 (TLC domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003794g1 PE=4 SV=1)

HSP 1 Score: 402.134 bits (1032), Expect = 2.180e-134
Identity = 201/379 (53.03%), Postives = 268/379 (70.71%), Query Frame = 1
Query:  118 KSLRKKNKNLSYFSHEYIIQNHGDIVSFVAMIIVMGLMFKVSTPLASMFVVMSHNVTNNETLS-NKLENLYLPGRNDVLCCFFYTLICIVIHAVIQEYGLDKLNKKLHLSKTKYSKFNESGQLAVFYLVSAIWGANIIYTEKYITSLSDLWETYPNIPLTFWAKFYFIFQICYWLHNYPELYFQKVKRDEMPGRVLYTTLYLFAVLMPYVLNMTRLGLVLLVANYIVEFIFHFSRLIYFSGRIKYAKIGFLLWDFLFVATRILCTALAFLYFHVGLEQKNQPTIKIAEGNFNTKIVRLNGLVFIFVTQLYAMWNFLHFHMKRWRE-----KSSIGKQGSKMLFXXXXXXXXXXXXXXXXXXLNELPEADQNQQKELRQR 1236
            K  +KKNKN+SYFS+EYII NHGDIVSF+AMIIV+GLMF+ + P+A +F+++ HN T N T   +K   +Y  GR D+L   FYTLI IVIHAVIQEY LDK+N+KLHLSKTK+SK NESG LA+FY++SA+WGANIIY E+   S+  LWE YP++ ++FW KFYFI QICYWLH +PELYFQ++K+DEMP RV Y ++YL  +L  Y+L+  RL +VLLV +Y VE I+H SRL YF G+   AK GFL+WD LFV  R+L  ALAF+ F +GLE+    ++   EGNFNT++VR+N L+ + + Q Y MWNF+ FH+KR RE      S   ++  K L   K K   +++        NEL E D++  ++ ++R
Sbjct:    5 KPGKKKNKNVSYFSNEYIITNHGDIVSFIAMIIVLGLMFQFTAPIAKLFIIIQHNATVNATTEVDKDTPMYTTGRRDLLAVIFYTLIAIVIHAVIQEYILDKVNRKLHLSKTKHSKVNESGHLALFYIISAVWGANIIYRERLFVSVPSLWEGYPHMYMSFWFKFYFICQICYWLHCFPELYFQRIKKDEMPSRVTYYSIYLVCILGAYLLHFNRLAIVLLVVHYFVESIYHASRLFYFFGKTDVAKAGFLVWDVLFVLVRVLSVALAFITFMLGLERSAVDSVAWREGNFNTRLVRVNCLMLLCLLQGYLMWNFITFHIKRIREYISQRASRSPRKQQKKLGGGKSKADGEQQQDGGGAATNELTEVDRDLHEQRKKR 383          
BLAST of Translocating chain-associated membrane protein vs. TrEMBL
Match: A0A1I8HMR7 (TLC domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003794g2 PE=4 SV=1)

HSP 1 Score: 401.364 bits (1030), Expect = 4.010e-134
Identity = 200/379 (52.77%), Postives = 268/379 (70.71%), Query Frame = 1
Query:  118 KSLRKKNKNLSYFSHEYIIQNHGDIVSFVAMIIVMGLMFKVSTPLASMFVVMSHNVTNNETLS-NKLENLYLPGRNDVLCCFFYTLICIVIHAVIQEYGLDKLNKKLHLSKTKYSKFNESGQLAVFYLVSAIWGANIIYTEKYITSLSDLWETYPNIPLTFWAKFYFIFQICYWLHNYPELYFQKVKRDEMPGRVLYTTLYLFAVLMPYVLNMTRLGLVLLVANYIVEFIFHFSRLIYFSGRIKYAKIGFLLWDFLFVATRILCTALAFLYFHVGLEQKNQPTIKIAEGNFNTKIVRLNGLVFIFVTQLYAMWNFLHFHMKRWRE-----KSSIGKQGSKMLFXXXXXXXXXXXXXXXXXXLNELPEADQNQQKELRQR 1236
            K  +KKNKN+SYFS+EYII NHGDIVSF+AMIIV+GLMF+ + P+A +F+++ HN T N T   +K   +Y  GR D+L   FYTLI IVIHAVIQEY LDK+N+KLHLSKTK+SK NESG LA+FY++SA+WGANIIY E+   S+  LWE YP++ ++FW KFYFI QICYWLH +PELYFQ++K+DEMP RV Y ++YL  +L  Y+L+  RL +VLLV +Y VE I+H SRL YF G+   AK GFL+WD LFV  R+L  ALAF+ F +GLE+    ++   EGNFNT++VR+N L+ + + Q Y MWNF+ FH+KR RE      S   ++  K +   K K   +++        NEL E D++  ++ ++R
Sbjct:    5 KPGKKKNKNVSYFSNEYIITNHGDIVSFIAMIIVLGLMFQFTAPIAKLFIIIQHNATVNATTEVDKDTPMYTTGRRDLLAVIFYTLIAIVIHAVIQEYILDKVNRKLHLSKTKHSKVNESGHLALFYIISAVWGANIIYRERLFVSVPSLWEGYPHMYMSFWFKFYFICQICYWLHCFPELYFQRIKKDEMPSRVTYYSIYLVCILGAYLLHFNRLAIVLLVVHYFVESIYHASRLFYFFGKTDVAKAGFLVWDVLFVLVRVLSVALAFITFMLGLERSAVDSVAWREGNFNTRLVRVNCLMLLCLLQGYLMWNFITFHIKRIREYISQRASRSPRKQQKKMGGGKSKADGEQQQDGGGAATNELTEVDRDLHEQRKKR 383          
BLAST of Translocating chain-associated membrane protein vs. TrEMBL
Match: R7VDZ5 (TLC domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_175940 PE=4 SV=1)

HSP 1 Score: 384.415 bits (986), Expect = 2.571e-127
Identity = 185/332 (55.72%), Postives = 244/332 (73.49%), Query Frame = 1
Query:  130 KKNKNLSYFSHEYIIQNHGDIVSFVAMIIVMGLMFKVSTPLASMFVVMSHNVTNNET-LSNKLENLYLPGRNDVLCCFFYTLICIVIHAVIQEYGLDKLNKKLHLSKTKYSKFNESGQLAVFYLVSAIWGANIIYTEKYITSLSDLWETYPNIPLTFWAKFYFIFQICYWLHNYPELYFQKVKRDEMPGRVLYTTLYLFAVLMPYVLNMTRLGLVLLVANYIVEFIFHFSRLIYFSGRIKYAKIGFLLWDFLFVATRILCTALAFLYFHVGLEQKNQPTIKIAEGNFNTKIVRLNGLVFIFVTQLYAMWNFLHFHMKRWREKS-SIGKQGSK 1119
            K +KN + FSHE++ QNH DIVS VAM+ V+GLMF+ ++P+AS+FV M HNVT NET  + +  +LY  G  DV   FFY LIC+V+HAVIQEYGLDKLN+++HLSK K+SKFNESGQL  FY +SAIWGANII  E ++TS+S+LWE YP+  L F  KFYFI Q+ YW+H+YPELYFQKVK+DEM GRV Y +LYLF + M Y+LN +R+ L +LV +YIVEF+FH SRL+YF+ +   +  GF++W+ LFV  R+    LA L F  GLE+  Q +I +A GNFNT +VR+N L  + + Q + MW+F+ FH++R RE+S S     SK
Sbjct:    7 KSSKNPAIFSHEFVQQNHADIVSCVAMVFVVGLMFQTTSPIASLFVAMQHNVTQNETEPAYEGPSLYTYGSKDVFGIFFYFLICVVVHAVIQEYGLDKLNRRMHLSKVKHSKFNESGQLLAFYAMSAIWGANIIIQENFLTSISNLWEGYPHAQLPFIIKFYFILQLAYWVHSYPELYFQKVKKDEMSGRVQYASLYLFFIAMAYMLNFSRVALCILVLHYIVEFVFHLSRLLYFAEKSDLSNTGFMVWNLLFVLVRLAIITLAVLTFWYGLEKTGQSSIDMAAGNFNTPLVRINCLAAVCLLQAWMMWHFITFHLRRLRERSASAAPPASK 338          
BLAST of Translocating chain-associated membrane protein vs. TrEMBL
Match: A0A173GPI5 (Translocating chain-associated membrane protein OS=Azumapecten farreri OX=106299 PE=2 SV=1)

HSP 1 Score: 364.77 bits (935), Expect = 6.228e-120
Identity = 186/375 (49.60%), Postives = 256/375 (68.27%), Query Frame = 1
Query:  130 KKNKNLSYFSHEYIIQNHGDIVSFVAMIIVMGLMFKVSTPLASMFVVMSHNVTNNETLSNKLENLYLPGRNDVLCCFFYTLICIVIHAVIQEYGLDKLNKKLHLSKTKYSKFNESGQLAVFYLVSAIWGANIIYTEKYITSLSDLWETYPNIPLTFWAKFYFIFQICYWLHNYPELYFQKVKRDEMPGRVLYTTLYLFAVLMPYVLNMTRLGLVLLVANYIVEFIFHFSRLIYFSGRIKYAKIGFLLWDFLFVATRILCTALAFLYFHVGLEQKNQPTIKIAEGNFNTKIVRLNGLVFIFVTQLYAMWNFLHFHMKRWREKSSIGKQGSKMLFXXXXXXXXXXXXXXXXXXLNELPEADQNQQKE---LRQRKSK 1245
            +  KN   FSHE+ IQNH DIVS +AM+ V+GLMF+ + P+A++FV + HNVT N T S     LY  GR D+    FY LIC+V+HAVIQEY LDKLN+K+HLSK K+SKFNESGQL  FY  SA+WGA+II  E YI +++ LWE YP+  LTF  KF+FI QI YW+H +PELYFQK+K++E+  R+ Y TLYL  ++  YVLN  R+ L ++V +Y+VEF+FH +RL+YF+ + + A  GF++++ LFV  R+    LA L F  GL+Q +Q ++  A GNFN + VR+N L  + + Q + MWNF++FH+KR REKS+  ++          K   KK++K  E+D+N LPE DQN   E   +R RK+K
Sbjct:    7 RSTKNPPIFSHEFFIQNHADIVSCIAMVFVVGLMFQATAPVATLFVALQHNVTRNGTDSADDVGLYTYGRKDIFSTMFYLLICVVVHAVIQEYVLDKLNRKMHLSKVKHSKFNESGQLLAFYFASAVWGADIIVRESYI-NINQLWEGYPHAELTFVVKFFFILQIAYWIHCFPELYFQKIKKEEISSRIQYATLYLVFIVGAYVLNFNRVALCMMVLHYLVEFVFHLARLLYFAEKSELANTGFMVFNGLFVLVRLGTIILAVLTFWYGLDQNSQASVDFATGNFNAQWVRINCLAAVCLLQAWMMWNFINFHLKRRREKSAASRR---------LKSPNKKRNKVAEEDINSLPEVDQNTATENGNVRARKAK 371          
BLAST of Translocating chain-associated membrane protein vs. TrEMBL
Match: T1IL87 (TLC domain-containing protein OS=Strigamia maritima OX=126957 PE=4 SV=1)

HSP 1 Score: 363.999 bits (933), Expect = 2.314e-119
Identity = 189/377 (50.13%), Postives = 249/377 (66.05%), Query Frame = 1
Query:  127 RKKNKNLSYFSHEYIIQNHGDIVSFVAMIIVMGLMFKVSTPLASMFVVMSHNVTNNETLSNKLENL--YLPGRNDVLCCFFYTLICIVIHAVIQEYGLDKLNKKLHLSKTKYSKFNESGQLAVFYLVSAIWGANIIYTEKYITSLSDLWETYPNIPLTFWAKFYFIFQICYWLHNYPELYFQKVKRDEMPGRVLYTTLYLFAVLMPYVLNMTRLGLVLLVANYIVEFIFHFSRLIYFSGRIKYAKIGFLLWDFLFVATRILCTALAFLYFHVGLEQKNQPTIKIAEGNFNTKIVRLNGLVFIFVTQLYAMWNFLHFHMKRWREKSSIGKQGSKMLFXXXXXXXXXXXXXXXXXXLNELPEADQNQQKELRQRKSKTK 1251
            R  +KN    SHE++IQNH DIVS VAM+ V+GLMF+ + P ASMFV M HNVTNN T  N+  ++  Y  G  D+   FFY LICIV+HA++QEY LDKLN+K+HLSK K+SKFNESG L +FYLVS +WG +II+ E +I + S LW+ YP+  + F  KF+FI Q+ YWLH +PELYFQKVK++EM  R+ Y  L+       Y LN TR+ L L V +Y+VE IFH SRL+YF+ + + A  GF++W+ LFV  R+    +  L F  GL   +QP   +AEGNFNT+I+R+NGL+ + + Q + MWNF+ FH+KR RE+  I     K     KK+   K      EDD + LPEADQN +K LR R S T 
Sbjct:    6 RPSSKNPPILSHEFVIQNHADIVSCVAMVFVIGLMFQATAPYASMFVAMHHNVTNNATNDNERPDVITYTAGIKDICVTFFYFLICIVMHAIVQEYILDKLNRKMHLSKMKHSKFNESGHLLIFYLVSVLWGGDIIFRENFILNFSKLWDDYPHCEMQFMFKFFFIIQLSYWLHCFPELYFQKVKKEEMSARIQYAALHFVFFAAAYALNFTRVALCLAVIHYLVETIFHISRLLYFAEKTEIANTGFMVWNSLFVLVRLGSITITVLTFWYGLSLSSQPITNVAEGNFNTQIIRINGLLAVCLLQAWMMWNFITFHLKRMRERGIISYNLKKRT-PAKKEKKPKTGKSGAEDDFSLLPEADQNTKK-LRLRSSATS 380          
BLAST of Translocating chain-associated membrane protein vs. Ensembl Cavefish
Match: zgc:113278 (translocating chain-associated membrane protein 1-like 1 [Source:NCBI gene;Acc:103034532])

HSP 1 Score: 328.561 bits (841), Expect = 3.634e-109
Identity = 167/331 (50.45%), Postives = 227/331 (68.58%), Query Frame = 1
Query:  127 RKKNKNLSYFSHEYIIQNHGDIVSFVAMIIVMGLMFKVSTPLASMFVVMSHNVTNNETLSNKLENLYLPGRNDVLCCFFYTLICIVIHAVIQEYGLDKLNKKLHLSKTKYSKFNESGQLAVFYLVSAIWGANIIYTEKYITSLSDLWETYPNIPLTFWAKFYFIFQICYWLHNYPELYFQKVKRDEMPGRVLYTTLYLFAVLMPYVLNMTRLGLVLLVANYIVEFIFHFSRLIYFSGRIKYAKIGFLLWDFLFVATRILCTALAFLYFHVGLEQKNQPTIKIAEGNFNTKIVRLNGLVFIFVTQLYAMWNFLHFHMKRWREKSSIGKQGSK 1119
            RKKNK+    SHE++IQNH D+VS VAMII++GLMF+V+   A MF+ + +NVT       +  N Y  G  D+   FFY LI I++HA+IQEY LDK+N++LHLSKTK+SKFNESGQLA FYL S IWG +I+  E+++T+ + LWE YP+  +TF  KF++I QI YW H  PELYFQKV+++++P ++ Y  LY+F +   Y+LN+ RLGLVLL+ +Y+VE +FH SRL YFS   K  + GF LW  LFV  R+L   L+ L F  GL + +     +AEGNFN   VR+  L  I +TQ + MW F++F +K+WRE+S I  Q SK
Sbjct:    4 RKKNKSPPVLSHEFVIQNHADMVSCVAMIILLGLMFEVTAKFAIMFITVQYNVTQTSEEKPEPVNFYQYGPKDIATVFFYLLIAIILHALIQEYVLDKINRRLHLSKTKHSKFNESGQLAAFYLFSFIWGCSILTAEEFVTNPTFLWEGYPHTHMTFQVKFFYICQIAYWFHALPELYFQKVRKEDIPRQLYYICLYIFHITGAYILNLHRLGLVLLIPHYLVELLFHASRLFYFSNENK--QKGFTLWALLFVIARLLTLTLSVLTFGFGLSRTDNQGFSLAEGNFNVLTVRMTCLSAICLTQAWMMWKFINFQLKKWREQSQI--QASK 330          
BLAST of Translocating chain-associated membrane protein vs. Ensembl Cavefish
Match: zgc:113278 (translocating chain-associated membrane protein 1-like 1 [Source:NCBI gene;Acc:103034532])

HSP 1 Score: 268.855 bits (686), Expect = 1.256e-85
Identity = 128/240 (53.33%), Postives = 174/240 (72.50%), Query Frame = 1
Query:  127 RKKNKNLSYFSHEYIIQNHGDIVSFVAMIIVMGLMFKVSTPLASMFVVMSHNVTNNETLSNKLENLYLPGRNDVLCCFFYTLICIVIHAVIQEYGLDKLNKKLHLSKTKYSKFNESGQLAVFYLVSAIWGANIIYTEKYITSLSDLWETYPNIPLTFWAKFYFIFQICYWLHNYPELYFQKVKRDEMPGRVLYTTLYLFAVLMPYVLNMTRLGLVLLVANYIVEFIFHFSRLIYFSGRIK 846
            RKKNK+    SHE++IQNH D+VS VAMII++GLMF+V+   A MF+ + +NVT       +  N Y  G  D+   FFY LI I++HA+IQEY LDK+N++LHLSKTK+SKFNESGQLA FYL S IWG +I+  E+++T+ + LWE YP+  +TF  KF++I QI YW H  PELYFQKV+++++P ++ Y  LY+F +   Y+LN+ RLGLVLL+ +Y+VE +FH SRL YFS   K
Sbjct:    4 RKKNKSPPVLSHEFVIQNHADMVSCVAMIILLGLMFEVTAKFAIMFITVQYNVTQTSEEKPEPVNFYQYGPKDIATVFFYLLIAIILHALIQEYVLDKINRRLHLSKTKHSKFNESGQLAAFYLFSFIWGCSILTAEEFVTNPTFLWEGYPHTHMTFQVKFFYICQIAYWFHALPELYFQKVRKEDIPRQLYYICLYIFHITGAYILNLHRLGLVLLIPHYLVELLFHASRLFYFSNENK 243          
BLAST of Translocating chain-associated membrane protein vs. Ensembl Cavefish
Match: tram2 (translocation associated membrane protein 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2024])

HSP 1 Score: 261.151 bits (666), Expect = 6.410e-83
Identity = 141/324 (43.52%), Postives = 201/324 (62.04%), Query Frame = 1
Query:  121 SLRKKNKNLSYFSHEYIIQNHGDIVSFVAMIIVMGLMFKVSTPLASMFVVMSHNVTNNETLSNKLE-NLYLPGRNDVLCCFFYTLICIVIHAVIQEYGLDKLNKKLHLSKTKYSKFNESGQLAVFYLVSAIWGANIIYTEKYITSLSDLWETYPNIPLTFWAKFYFIFQICYWLHNYPELYFQKVKRDEMPGRVLYTTLYLFAVLMPYVLNMTRLGLVLLVANYIVEFIFHFSRLIYFSGRIKYAKIGFLLWDFLFVATRILCTALAFLYFHVGLEQKNQPTIKIAEGNFNTKIVRLNGLVFIFVTQLYAMWNFLHFHMKRWRE 1089
            + R++NK+  +FS E++IQNH DIV  + + I++GLMF+ +   A +F+   +N++   TL+   E +LY  G  D     FY  I I++HAV+QEY LDK+N++LHLSK+K +KFNESGQL VFYLVS+ W   I+ TE Y+   S LWE YP+  L F  KF+++ Q+ YW H  PELYFQKV+++E+P ++ Y  LYL  +L  Y+LN TR+GLVLL   Y+ E  FH SRL YF     +    F +W   FV TR++   + FL    GL +     +    GNFNT  +RL  L+ +  TQ + +W F  F ++R RE
Sbjct:    2 AFRRRNKSYPFFSQEFLIQNHADIVFSLVIFILIGLMFEATAKTAILFIQPQYNIS---TLTPDGEVSLYHYGWKDCATVLFYLFITIILHAVVQEYILDKVNRRLHLSKSKNTKFNESGQLCVFYLVSSFWSLYILATEGYLLHPSSLWENYPHSHLRFQVKFFYLTQLAYWFHALPELYFQKVRKEEIPRQLQYIGLYLSHILAAYLLNFTRVGLVLLFLQYLSEMGFHLSRLFYFIDETHHKM--FDMWSVGFVLTRMVILTVMFLAVGFGLARSENQMLDWEMGNFNTLSIRLLVLLLVCSTQSWLLWKFFRFQLRRTRE 320          
BLAST of Translocating chain-associated membrane protein vs. Ensembl Cavefish
Match: tram1 (translocation associated membrane protein 1 [Source:ZFIN;Acc:ZDB-GENE-021011-1])

HSP 1 Score: 243.432 bits (620), Expect = 4.018e-77
Identity = 119/242 (49.17%), Postives = 168/242 (69.42%), Query Frame = 1
Query:  370 LICIVIHAVIQEYGLDKLNKKLHLSKTKYSKFNESGQLAVFYLVSAIWGANIIYTEKYITSLSDLWETYPNIPLTFWAKFYFIFQICYWLHNYPELYFQKVKRDEMPGRVLYTTLYLFAVLMPYVLNMTRLGLVLLVANYIVEFIFHFSRLIYFSGRIKYAKIGFLLWDFLFVATRILCTALAFLYFHVGLEQKNQPTIKIAEGNFNTKIVRLNGLVFIFVTQLYAMWNFLHFHMKRWREKS 1095
            L+ I++HA+IQEY LDK+N+K+H SKTK+SKFNESGQL+ FYL S  WGA+I+ +E  +++   LWE YP+  + F  KFY+I Q+ YWLH  PELYFQK+K+++MP +++Y +LYL  +   Y+LN+ RLGLVLLV +Y VE +FH SR+IYFS   +  + GF +W  LFV  R+L  +L+ L    GL    Q  + ++EGNFN   VR+  L  I  TQ + MW F++F ++RWRE +
Sbjct:    2 LVAIIMHAIIQEYILDKINRKMHFSKTKHSKFNESGQLSAFYLFSCAWGASILVSEHILSNPVSLWEGYPHTLMPFQMKFYYICQLGYWLHAIPELYFQKIKKEDMPRQLVYISLYLVHIAGAYILNLNRLGLVLLVLHYFVELLFHVSRIIYFSNEER--QTGFSVWAVLFVLARLLTLSLSVLTVGFGLAGAEQQGLNLSEGNFNVLFVRVTVLAAICTTQAFMMWKFINFQLRRWREHA 241          
BLAST of Translocating chain-associated membrane protein vs. Ensembl Cavefish
Match: ENSAMXT00000050746.1 (pep primary_assembly:Astyanax_mexicanus-2.0:3:29968955:29969140:1 gene:ENSAMXG00000041016.1 transcript:ENSAMXT00000050746.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.5286 bits (127), Expect = 3.638e-9
Identity = 26/50 (52.00%), Postives = 35/50 (70.00%), Query Frame = 1
Query:  127 RKKNKNLSYFSHEYIIQNHGDIVSFVAMIIVMGLMFKVSTPLASMFVVMS 276
            +K NKN    SHE++IQNH DIVS VAM+ ++GLMF+V   L   F++ S
Sbjct:    5 KKSNKNPPVLSHEFVIQNHADIVSCVAMLFLLGLMFEVGFGLIFCFILGS 54          
BLAST of Translocating chain-associated membrane protein vs. Ensembl Sea Lamprey
Match: tram2 (translocation associated membrane protein 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2024])

HSP 1 Score: 296.59 bits (758), Expect = 1.268e-97
Identity = 145/335 (43.28%), Postives = 222/335 (66.27%), Query Frame = 1
Query:  121 SLRKKNKNLSYFSHEYIIQNHGDIVSFVAMIIVMGLMFKVSTPLASMFVVMSHNVT-NNETLSNKLENLYLPGRNDVLCCFFYTLICIVIHAVIQEYGLDKLNKKLHLSKTKYSKFNESGQLAVFYLVSAIWGANIIYTEKYITSLSDLWETYPNIPLTFWAKFYFIFQICYWLHNYPELYFQKVKRDEMPGRVLYTTLYLFAVLMPYVLNMTRLGLVLLVANYIVEFIFHFSRLIYFSGRIKYAKIGFLLWDFLFVATRILCTALAFLYFHVGLEQKNQPTIKIAEGNFNTKIVRLNGLVFIFVTQLYAMWNFLHFHMKRWRE-KSSIGKQGSK 1119
             LRKK+K+   FS +++IQNH DI+ FV +  + G+MF+ +   A MF+ + HN+T  +E  S +  ++Y  G+ D    FFY ++ IVIH  +QEY LDKL+++LHLSK K+SK+NESGQL+ F L+ + WG  II  E+Y T LS LWE +P+  ++ + KFY+IFQ+ YW+H  PELYFQK+K++E+  ++ + +LY+  +   Y+LN+TRLG++L+V +Y+VEF+FH SR+ YF     Y K GF +W  LF  +R++   L+ L    GL +    T+ +A GNFNT ++R+  L  I +TQ + MW F+ F +++WRE K SI  +  +
Sbjct:    2 GLRKKSKSPPLFSQDFVIQNHADIMIFVVIAFLFGVMFEATANTAFMFMSIQHNITTQDEDGSGEPSSVYQYGKKDFATIFFYIIVAIVIHGTVQEYILDKLHRRLHLSKMKHSKYNESGQLSFFSLIFSFWGLYIIIVEEYATQLSRLWEGFPHTTMSCYVKFYYIFQLAYWVHALPELYFQKIKKEEISKQLQHISLYIIHIAAAYLLNLTRLGMLLIVLHYMVEFVFHISRIFYFIDE-NYQK-GFQVWAVLFGLSRLITLTLSVLTIGFGLARSENQTLDVAAGNFNTLLIRICLLALICLTQAWMMWTFIKFQLRQWREYKMSISNKKKQ 334          
BLAST of Translocating chain-associated membrane protein vs. Ensembl Sea Lamprey
Match: cers6 (ceramide synthase 6 [Source:ZFIN;Acc:ZDB-GENE-070522-1])

HSP 1 Score: 48.1358 bits (113), Expect = 2.648e-6
Identity = 36/170 (21.18%), Postives = 81/170 (47.65%), Query Frame = 1
Query:  394 VIQEYGLDKLNKKLHLSKTKYSKFNESGQLAVFYLVSAIWGANIIYTEKYITSLSDLWETYPNIPLTFWAKFYFIFQIC-YWLHNYPELYFQKVKRDEMPGRVLYTTLYLFAVLMPYVLNMTRLGLVLLVANYIVEFIFHFSRLIYFSGRIKYAKIGFLLWDFLFVATRI 900
             IQ +   + N++     +  +KF ES    +FYL   ++G  ++    ++      W  +P  PL    ++Y+I ++  YW   + +  F  +KR +     ++  + +  +   Y++NM R+G V+L  +   +F+   +++  ++   K   + F+L+  +F  TR+
Sbjct:   74 TIQRWFRRRRNQE---KPSPLAKFCESMWRFMFYLYVFVYGLRLLSQSNWVWDSRQCWYNHPYQPLPSDIQYYYIVELAFYWSLMFSQ--FTDIKRKDFFMMFMHHLITVSLISFSYIVNMVRMGSVILCMHDAADFLLEAAKMANYARYQKLCDLLFILFALVFFVTRL 238          
BLAST of Translocating chain-associated membrane protein vs. Ensembl Yeast
Match: LAG1 (Ceramide synthase component; involved in synthesis of ceramide from C26(acyl)-coenzyme A and dihydrosphingosine or phytosphingosine, functionally equivalent to Lac1p; forms ER foci upon DNA replication stress; homolog of human CERS2, a tumor metastasis suppressor gene whose silencing enhances invasion/metastasis of prostate cancer cells; LAG1 has a paralog, LAC1, that arose from the whole genome duplication [Source:SGD;Acc:S000000995])

HSP 1 Score: 46.2098 bits (108), Expect = 6.103e-6
Identity = 54/243 (22.22%), Postives = 101/243 (41.56%), Query Frame = 1
Query:  130 KKNKNL---SYFSHEYIIQNHGDIVSFVAMIIVMGLMF-----KVSTPLASMFVVMSHNVTNNETLSNKLENLYLPGRNDVLCCFFYTLICIVIHAVIQEYGLDKLNKKLHLSKTKYSKFNESGQLAVFYL-VSAIWGANIIY-TEKYITSLSDLWETYPNIPLTFWAKFYFIFQICYWLHNYPELYFQKVK-RDEMPGRVLYTTLYLFAVLMPYVLNMTRLGLVLLVANYIVEFIFHFSRLI 825
            KK+ +L    +FS+  +   H  +  F  ++ V    F       S PL  MFV +S+ V   ++        Y  G  D+   FFY +    +   + +  +      L+++     K       A+FY  VS  +G  I+Y ++ ++     ++ TYP I   F  K +++ Q  +W      L  Q  K R +    V +  + L  +   YV + T++GL + +   + +F    S+ +
Sbjct:   62 KKDSDLLWKVWFSYREMNYRHSWLTPFFILVCVYSAYFLSGNRTESNPL-HMFVAISYQVDGTDS--------YAKGIKDLSFVFFYMIFFTFLREFLMDVVIRPFTVYLNVTSEHRQKRMLEQMYAIFYCGVSGPFGLYIMYHSDLWLFKTKPMYRTYPVITNPFLFKIFYLGQAAFWAQQACVLVLQLEKPRKDYKELVFHHIVTLLLIWSSYVFHFTKMGLAIYITMDVSDFFLSLSKTL 295          
BLAST of Translocating chain-associated membrane protein vs. Ensembl Nematostella
Match: EDO40100 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S840])

HSP 1 Score: 284.263 bits (726), Expect = 2.725e-92
Identity = 140/322 (43.48%), Postives = 202/322 (62.73%), Query Frame = 1
Query:  127 RKKNKNLSYFSHEYIIQNHGDIVSFVAMIIVMGLMFKVSTPLASMFVVMSHNVTNNETLSNKLENLYLPGRNDVLCCFFYTLICIVIHAVIQEYGLDKLNKKLHLSKTKYSKFNESGQLAVFYLVSAIWGANIIYTEKYITSLSDLWETYPNIPLTFWAKFYFIFQICYWLHNYPELYFQKVKRDEMPGRVLYTTLYLFAVLMPYVLNMTRLGLVLLVANYIVEFIFHFSRLIYFSGRIKYAKIGFLLWDFLFVATRILCTALAFLYFHVGLEQKNQPTIKIAEGNFNTKIVRLNGLVFIFVTQLYAMWNFLHFHMKRWREK 1092
            R KNKN   FSHE+II NHGDIVS V M+ ++GLMF+V++ +A++F+   HNV+ N   ++ +   Y  G  D    FFY++  IV+HA+IQEY LD++ +KLHLSKTK +KFN+SG L  FY  SA WG +I+  E +  ++S LWE YP+  ++F  KFYFI QI +W+H  PELYF K K+DE+  +V     YL  +   Y+LN T + L  L  +Y VEF+FHF RL+  SG+   A   F+LW  LFV  R+   AL  + F  GL +     + +  GNFN  ++R+  +  + + Q +  WNF+++ ++ WREK
Sbjct:    5 RNKNKNAPVFSHEFIITNHGDIVSCVCMVFMIGLMFQVTSKVAAVFIAPQHNVSRNLNGTDAVVTSYTNGPKDFCTIFFYSMAWIVVHAIIQEYILDRVIRKLHLSKTKNTKFNDSGGLLPFYFASAAWGLDIMMKEHFFPNISRLWEGYPHNEMSFMLKFYFILQISHWVHCLPELYFMKAKKDEIFPKVQLYIEYLLFIWAAYMLNFTHVALCCLTIHYAVEFVFHFMRLMKLSGKYDIANNIFILWSLLFVLARLAIIALTVMTFWYGLPRLENAGLNVDLGNFNNPMIRITAMAGVLLMQAWLAWNFIYYQIRLWREK 326          
BLAST of Translocating chain-associated membrane protein vs. Ensembl Nematostella
Match: EDO40099 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S839])

HSP 1 Score: 97.8265 bits (242), Expect = 5.606e-25
Identity = 45/84 (53.57%), Postives = 59/84 (70.24%), Query Frame = 1
Query:  427 KKLHLSKTKYSKFNESGQLAVFYLVSAIWGANIIYTEKYITSLSDLWETYPNIPLTFWAKFYFIFQICYWLHNYPELYFQKVKR 678
            +KLHLSKTK +KFN+SG L  FY  SA WG +I+  E +  ++S LWE YP+  ++F  KFYFI QI +W+H  PELYF K K+
Sbjct:    4 RKLHLSKTKNTKFNDSGGLLPFYFASAAWGLDIMMKEHFFPNISKLWEGYPHNEMSFMLKFYFILQISHWVHCLPELYFMKAKK 87          
BLAST of Translocating chain-associated membrane protein vs. Ensembl Nematostella
Match: EDO27868 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T828])

HSP 1 Score: 51.9878 bits (123), Expect = 1.807e-8
Identity = 24/51 (47.06%), Postives = 31/51 (60.78%), Query Frame = 1
Query:  595 FWAKFYFIFQICYWLHNYPELYFQKVKRDEMPGRVLYTTLYLFAVLMPYVL 747
            F  KFYFI QI +W+H  PELYF K K+DE+  +V     YL  +   Y+L
Sbjct:   69 FMLKFYFILQISHWVHCLPELYFMKAKKDEIFPKVQLYIEYLLFIWAAYML 119          
BLAST of Translocating chain-associated membrane protein vs. Ensembl Medaka
Match: zgc:113278 (translocating chain-associated membrane protein 1-like 1 [Source:NCBI gene;Acc:101155768])

HSP 1 Score: 315.849 bits (808), Expect = 3.927e-104
Identity = 167/333 (50.15%), Postives = 223/333 (66.97%), Query Frame = 1
Query:  127 RKKNKNLSYFSHEYIIQNHGDIVSFVAMIIVMGLMFKVSTPLASMFVVMSHNVTNNETLSNKLE--NLYLPGRNDVLCCFFYTLICIVIHAVIQEYGLDKLNKKLHLSKTKYSKFNESGQLAVFYLVSAIWGANIIYTEKYITSLSDLWETYPNIPLTFWAKFYFIFQICYWLHNYPELYFQKVKRDEMPGRVLYTTLYLFAVLMPYVLNMTRLGLVLLVANYIVEFIFHFSRLIYFSGRIKYAKIGFLLWDFLFVATRILCTALAFLYFHVGLEQKNQPTIKIAEGNFNTKIVRLNGLVFIFVTQLYAMWNFLHFHMKRWREKSSIGKQGSK 1119
            RKKNK+    SHE++IQNH D+VS +AMII++GLMF+V+   A MF+ + +NVT  E L  K E  N Y  G  DV   FFY LI +++HA+IQEY LDK+N++LHLSKTK+SKFNESGQLA FYL S +WG +I+  E +  + + LWE YP+  + F  KF++I QI YWLH  PELYFQKV+++++P ++ Y  LY+  +   YVLN+ RLGLVLLV +Y+VE +FH SRL YFS   K  + GF LW  LFV  R+L   L+ L F  GL +       +A+GNFN   VR+  L  I +TQ + MW F++F +K+WRE S    Q SK
Sbjct:    4 RKKNKSPPVLSHEFVIQNHADMVSCLAMIILLGLMFEVTAKFAIMFITVQYNVT--EVLDEKSEPLNFYQYGPKDVATVFFYLLIAVILHALIQEYILDKINRRLHLSKTKHSKFNESGQLAAFYLFSFVWGCSILTAEDFAKNPTFLWEGYPHTRMVFQVKFFYICQIAYWLHALPELYFQKVRKEDIPRQLYYICLYIVHITGAYVLNLHRLGLVLLVPHYLVELLFHASRLFYFSDENK--QKGFTLWALLFVIARLLTLTLSVLTFGFGLPRTENLGFSLADGNFNVLTVRMTCLAAICLTQAWMMWKFINFQLKKWREHSQ--SQASK 330          
BLAST of Translocating chain-associated membrane protein vs. Ensembl Medaka
Match: tram1 (translocation associated membrane protein 1 [Source:NCBI gene;Acc:101175442])

HSP 1 Score: 298.901 bits (764), Expect = 8.573e-98
Identity = 156/330 (47.27%), Postives = 217/330 (65.76%), Query Frame = 1
Query:  121 SLRKK--NKNLSYFSHEYIIQNHGDIVSFVAMIIVMGLMFKVSTPLASMFVVMSHNVT--NNETLSNKLENLYLPGRNDVLCCFFYTLICIVIHAVIQEYGLDKLNKKLHLSKTKYSKFNESGQLAVFYLVSAIWGANIIYTEKYITSLSDLWETYPNIPLTFWAKFYFIFQICYWLHNYPELYFQKVKRDEMPGRVLYTTLYLFAVLMPYVLNMTRLGLVLLVANYIVEFIFHFSRLIYFSGRIKYAKIGFLLWDFLFVATRILCTALAFLYFHVGLEQKNQPTIKIAEGNFNTKIVRLNGLVFIFVTQLYAMWNFLHFHMKRWREKSS 1098
             +RKK  +KN    SHE++IQNH DIVS VAM+ ++GLMF++++  A +F+ + +NVT   NE       N +  G  D+   FFY L+ I++HA+IQEY LDKLN+K H SKTK+SKFNESGQL+ FYL S  WG +I+ +E ++++   LWE YP+  + F  KFY+I Q+ YWLH  PELYFQK K++++P +++Y  LYL  +   YVLN+ RLGLVLLV +Y VEF+FH SRL+YFS   +  ++GF +W  LFV  R+L  +L+ L    GL          A GNFN   VR+  L  I +TQ + MW F++F ++RWRE S 
Sbjct:    2 GIRKKTASKNPPVLSHEFVIQNHADIVSCVAMVFLLGLMFEITSKFAVIFITVQYNVTISTNEGSEETAVNHFHHGIKDLATIFFYMLVAIIMHAIIQEYVLDKLNRKKHFSKTKHSKFNESGQLSAFYLFSFCWGTSILLSENFLSNPVSLWEGYPHTLMPFQMKFYYICQLGYWLHALPELYFQKTKKEDIPRQLVYIFLYLVHIAGAYVLNLNRLGLVLLVLHYFVEFLFHVSRLVYFSNENR--QMGFTVWAVLFVVGRLLTLSLSVLTVGFGLATSESQGFNWAAGNFNILFVRITVLAAICLTQAFMMWKFINFQLRRWREHSQ 329          
BLAST of Translocating chain-associated membrane protein vs. Ensembl Medaka
Match: tram1 (translocation associated membrane protein 1 [Source:NCBI gene;Acc:101175442])

HSP 1 Score: 298.516 bits (763), Expect = 1.952e-97
Identity = 157/331 (47.43%), Postives = 218/331 (65.86%), Query Frame = 1
Query:  121 SLRKK--NKNLSYFSHEYIIQNHGDIVSFVAMIIVMGLMFKVSTPLASMFVVMSHNVT---NNETLSNKLENLYLPGRNDVLCCFFYTLICIVIHAVIQEYGLDKLNKKLHLSKTKYSKFNESGQLAVFYLVSAIWGANIIYTEKYITSLSDLWETYPNIPLTFWAKFYFIFQICYWLHNYPELYFQKVKRDEMPGRVLYTTLYLFAVLMPYVLNMTRLGLVLLVANYIVEFIFHFSRLIYFSGRIKYAKIGFLLWDFLFVATRILCTALAFLYFHVGLEQKNQPTIKIAEGNFNTKIVRLNGLVFIFVTQLYAMWNFLHFHMKRWREKSS 1098
             +RKK  +KN    SHE++IQNH DIVS VAM+ ++GLMF++++  A +F+ + +NVT   N ET  N   +    G  D+   FFY L+ I++HA+IQEY LDKLN+K H SKTK+SKFNESGQL+ FYL S  WG +I+ +E ++++   LWE YP+  + F  KFY+I Q+ YWLH  PELYFQK K++++P +++Y  LYL  +   YVLN+ RLGLVLLV +Y VEF+FH SRL+YFS   +  ++GF +W  LFV  R+L  +L+ L    GL          A GNFN   VR+  L  I +TQ + MW F++F ++RWRE S 
Sbjct:    2 GIRKKTASKNPPVLSHEFVIQNHADIVSCVAMVFLLGLMFEITSKFAVIFITVQYNVTISTNEETAVNHFHH----GIKDLATIFFYMLVAIIMHAIIQEYVLDKLNRKKHFSKTKHSKFNESGQLSAFYLFSFCWGTSILLSENFLSNPVSLWEGYPHTLMPFQMKFYYICQLGYWLHALPELYFQKTKKEDIPRQLVYIFLYLVHIAGAYVLNLNRLGLVLLVLHYFVEFLFHVSRLVYFSNENR--QMGFTVWAVLFVVGRLLTLSLSVLTVGFGLATSESQGFNWAAGNFNILFVRITVLAAICLTQAFMMWKFINFQLRRWREHSQ 326          
BLAST of Translocating chain-associated membrane protein vs. Ensembl Medaka
Match: tram2 (translocating chain-associated membrane protein 2 [Source:NCBI gene;Acc:101161454])

HSP 1 Score: 276.944 bits (707), Expect = 4.028e-89
Identity = 143/324 (44.14%), Postives = 210/324 (64.81%), Query Frame = 1
Query:  121 SLRKKNKNLSYFSHEYIIQNHGDIVSFVAMIIVMGLMFKVSTPLASMFVVMSHNVTNNETLSNKLE-NLYLPGRNDVLCCFFYTLICIVIHAVIQEYGLDKLNKKLHLSKTKYSKFNESGQLAVFYLVSAIWGANIIYTEKYITSLSDLWETYPNIPLTFWAKFYFIFQICYWLHNYPELYFQKVKRDEMPGRVLYTTLYLFAVLMPYVLNMTRLGLVLLVANYIVEFIFHFSRLIYFSGRIKYAKIGFLLWDFLFVATRILCTALAFLYFHVGLEQKNQPTIKIAEGNFNTKIVRLNGLVFIFVTQLYAMWNFLHFHMKRWRE 1089
            + R++NK+  +FS E++IQNH DIV  + ++I++GLMF+ +   A +F+   +NVT   TLS + E   YL G  D     FY  I I++HAV+QEY LDK+N++LHLSK+K +KFNESGQL VF+ VS++W   ++  E YI   S LWE YP+  L F  KF+++ Q+ YWLH  PELYFQKV+++E+P ++ Y  LYL  +   Y+LN+TR+GLVLL   Y+ E  FH +RL+YF+    + K+ F LW   FV TR+    L FL    GL +     + +  GNFNT ++R+  L+ + +TQ + +W F+ F ++RWRE
Sbjct:    2 AFRRRNKSYPFFSQEFLIQNHADIVFSLVIVILIGLMFETTAKTAILFIQPQYNVT---TLSPEGEVTTYLYGWKDCATILFYFFITIILHAVVQEYLLDKVNRRLHLSKSKNTKFNESGQLCVFHFVSSVWSFYVLLNEGYILHPSSLWENYPHSHLRFQVKFFYLTQLAYWLHALPELYFQKVRKEEIPRQLQYICLYLLHISAAYLLNLTRVGLVLLFLQYLSELGFHIARLLYFTDE-NHQKM-FDLWAVSFVFTRMTTLTLMFLSVGFGLARAENQGLDLEMGNFNTVLIRMIVLLLVCLTQSWLLWKFIRFQLRRWRE 320          
BLAST of Translocating chain-associated membrane protein vs. Ensembl Medaka
Match: cers2a (ceramide synthase 2 [Source:NCBI gene;Acc:101162853])

HSP 1 Score: 50.447 bits (119), Expect = 2.016e-6
Identity = 44/230 (19.13%), Postives = 106/230 (46.09%), Query Frame = 1
Query:  232 FKVSTPLASMF-VVMSHNVT--NNETLSNKLENLYLPGRNDVLCCFFYTLICIVIHAVIQEYGLDKLNKKLHLSKTKYSKFNESGQLAVFYLVSAIWGANIIYTEKYITSLSDLWETYPNIPLTFWAKFYFIFQICYWLHNYPELYF---QKVKRDEMPGRVLYTTLYLFAVLMPYVLNMTRLGLVLLVANYIVEFIFHFSRLIYFSGRIKYAKIGFLLWDFLFVATRIL 903
            +KV+ PLA++  V + H V+   N TL +             +        C V    +Q +   + N++     +K +KF E+     FYL +   G  ++  + +   +  +WE +P +PL     +Y++ ++ ++L     L F     VKR +   ++++  + +  +   +++N  R G ++++ +   +++   +++  ++G  +     F+ +  +FV TR++
Sbjct:   58 WKVAKPLAALLGVDLKHRVSASQNPTLESHFCQYSKHPTQSAIENLSKQTGCSVRQ--VQSWFRRRRNQE---RPSKLTKFQEASWRFTFYLFAFYAGLAVLIDKPWFQDIRKVWEDFPKMPLLASQYWYYMIELGFYL----SLLFSVASDVKRKDFWEQIVHHVVTIVLISFSWLVNYVRAGSLIMLVHDAADYLMELAKMFNYAGWKRTCNFLFVAFAAVFVITRLM 278          
BLAST of Translocating chain-associated membrane protein vs. Planmine SMEST
Match: SMESG000051052.1 (SMESG000051052.1)

HSP 1 Score: 742.651 bits (1916), Expect = 0.000e+0
Identity = 381/382 (99.74%), Postives = 382/382 (100.00%), Query Frame = 1
Query:  109 MNAKSLRKKNKNLSYFSHEYIIQNHGDIVSFVAMIIVMGLMFKVSTPLASMFVVMSHNVTNNETLSNKLENLYLPGRNDVLCCFFYTLICIVIHAVIQEYGLDKLNKKLHLSKTKYSKFNESGQLAVFYLVSAIWGANIIYTEKYITSLSDLWETYPNIPLTFWAKFYFIFQICYWLHNYPELYFQKVKRDEMPGRVLYTTLYLFAVLMPYVLNMTRLGLVLLVANYIVEFIFHFSRLIYFSGRIKYAKIGFLLWDFLFVATRILCTALAFLYFHVGLEQKNQPTIKIAEGNFNTKIVRLNGLVFIFVTQLYAMWNFLHFHMKRWREKSSIGKQGSKMLFXXXXXXXXXXXXXXXXXXLNELPEADQNQQKELRQRKSKTKL 1254
            MNAKSLRKKNKNLSYFSHEYIIQNHGDIVSFVAMIIVMGLMFKVSTPLASMFVVMSHNVTNNETLSNKLENLYLPGRNDVLCCFFYTLICIVIHAVIQEYGLDKLNKKLHLSKTKYSKFNESGQLAVFYLVSAIWGANIIYTEKYITSLSDLWETYPNIPLTFWAKFYFIFQICYWLHNYPELYFQKVKRDEMPGRVLYTTLYLFAVLMPYVLNMTRLGLVLLVANYIVEFIFHFSRLIYFSGRIKYAKIGFLLWDFLFVATRILCTALAFLYFHVGLEQKNQPTIKIAEGNFNTKIVRLNGLVFIFVTQLYAMWNFLHFHMKRWREK+SIGKQGSKMLFDTKKKDGTKKKSKKDEDDLNELPEADQNQQKELRQRKSKTKL
Sbjct:    1 MNAKSLRKKNKNLSYFSHEYIIQNHGDIVSFVAMIIVMGLMFKVSTPLASMFVVMSHNVTNNETLSNKLENLYLPGRNDVLCCFFYTLICIVIHAVIQEYGLDKLNKKLHLSKTKYSKFNESGQLAVFYLVSAIWGANIIYTEKYITSLSDLWETYPNIPLTFWAKFYFIFQICYWLHNYPELYFQKVKRDEMPGRVLYTTLYLFAVLMPYVLNMTRLGLVLLVANYIVEFIFHFSRLIYFSGRIKYAKIGFLLWDFLFVATRILCTALAFLYFHVGLEQKNQPTIKIAEGNFNTKIVRLNGLVFIFVTQLYAMWNFLHFHMKRWREKASIGKQGSKMLFDTKKKDGTKKKSKKDEDDLNELPEADQNQQKELRQRKSKTKL 382          
The following BLAST results are available for this feature:
BLAST of Translocating chain-associated membrane protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAM19.370e-9447.32translocation associated membrane protein 1 [Sourc... [more]
TRAM23.933e-7740.87translocation associated membrane protein 2 [Sourc... [more]
TRAM11.068e-7050.62translocation associated membrane protein 1 [Sourc... [more]
TRAM1L19.796e-6539.23translocation associated membrane protein 1 like 1... [more]
TRAM17.483e-2948.62translocation associated membrane protein 1 [Sourc... [more]
back to top
BLAST of Translocating chain-associated membrane protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tram-13.391e-6839.10Translocating chain-associated membrane protein [... [more]
tram-13.109e-6739.58Translocating chain-associated membrane protein [... [more]
hyl-28.428e-620.92Ceramide synthase hyl-2 [Source:UniProtKB/Swiss-P... [more]
back to top
BLAST of Translocating chain-associated membrane protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAM2.450e-6835.47gene:FBgn0040340 transcript:FBtr0070169[more]
TRAM2.450e-6835.47gene:FBgn0040340 transcript:FBtr0070168[more]
TRAM2.450e-6835.47gene:FBgn0040340 transcript:FBtr0332589[more]
TRAM2.450e-6835.47gene:FBgn0040340 transcript:FBtr0070167[more]
TRAM2.450e-6835.47gene:FBgn0040340 transcript:FBtr0307182[more]
back to top
BLAST of Translocating chain-associated membrane protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1132786.232e-11050.45zgc:113278 [Source:ZFIN;Acc:ZDB-GENE-050327-66][more]
tram11.850e-9946.63translocation associated membrane protein 1 [Sourc... [more]
tram11.850e-9946.63translocation associated membrane protein 1 [Sourc... [more]
tram25.676e-8743.52translocation associated membrane protein 2 [Sourc... [more]
tram23.473e-1538.94translocation associated membrane protein 2 [Sourc... [more]
back to top
BLAST of Translocating chain-associated membrane protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mbip5.496e-10549.39MAP3K12 binding inhibitory protein 1 [Source:Xenba... [more]
mbip9.686e-10449.70MAP3K12 binding inhibitory protein 1 [Source:Xenba... [more]
mbip7.554e-9647.32MAP3K12 binding inhibitory protein 1 [Source:Xenba... [more]
mbip1.153e-8350.38MAP3K12 binding inhibitory protein 1 [Source:Xenba... [more]
abo.33.601e-7241.25ABO blood group (transferase A, alpha 1-3-N-acetyl... [more]
back to top
BLAST of Translocating chain-associated membrane protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tram15.965e-9447.85translocating chain-associating membrane protein 1... [more]
Tram27.383e-7640.87translocating chain-associating membrane protein 2... [more]
Tram1l12.348e-6638.28translocation associated membrane protein 1-like 1... [more]
Tram14.830e-1248.28translocating chain-associating membrane protein 1... [more]
Cers41.681e-624.32ceramide synthase 4 [Source:MGI Symbol;Acc:MGI:191... [more]
back to top
BLAST of Translocating chain-associated membrane protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6DED0|TR1L1_XENLA2.331e-10348.92Translocating chain-associated membrane protein 1-... [more]
sp|Q5XI41|TRAM1_RAT9.114e-9447.55Translocating chain-associated membrane protein 1 ... [more]
sp|Q9GKZ4|TRAM1_BOVIN1.760e-9347.15Translocating chain-associated membrane protein 1 ... [more]
sp|Q91V04|TRAM1_MOUSE4.172e-9347.85Translocating chain-associated membrane protein 1 ... [more]
sp|Q15629|TRAM1_HUMAN4.500e-9347.32Translocating chain-associated membrane protein 1 ... [more]
back to top
BLAST of Translocating chain-associated membrane protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267EGW32.180e-13453.03TLC domain-containing protein OS=Macrostomum ligna... [more]
A0A1I8HMR74.010e-13452.77TLC domain-containing protein OS=Macrostomum ligna... [more]
R7VDZ52.571e-12755.72TLC domain-containing protein OS=Capitella teleta ... [more]
A0A173GPI56.228e-12049.60Translocating chain-associated membrane protein OS... [more]
T1IL872.314e-11950.13TLC domain-containing protein OS=Strigamia maritim... [more]
back to top
BLAST of Translocating chain-associated membrane protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1132783.634e-10950.45translocating chain-associated membrane protein 1-... [more]
zgc:1132781.256e-8553.33translocating chain-associated membrane protein 1-... [more]
tram26.410e-8343.52translocation associated membrane protein 2 [Sourc... [more]
tram14.018e-7749.17translocation associated membrane protein 1 [Sourc... [more]
ENSAMXT00000050746.13.638e-952.00pep primary_assembly:Astyanax_mexicanus-2.0:3:2996... [more]
back to top
BLAST of Translocating chain-associated membrane protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tram21.268e-9743.28translocation associated membrane protein 2 [Sourc... [more]
cers62.648e-621.18ceramide synthase 6 [Source:ZFIN;Acc:ZDB-GENE-0705... [more]
back to top
BLAST of Translocating chain-associated membrane protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
LAG16.103e-622.22Ceramide synthase component; involved in synthesis... [more]
back to top
BLAST of Translocating chain-associated membrane protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO401002.725e-9243.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO400995.606e-2553.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO278681.807e-847.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Translocating chain-associated membrane protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1132783.927e-10450.15translocating chain-associated membrane protein 1-... [more]
tram18.573e-9847.27translocation associated membrane protein 1 [Sourc... [more]
tram11.952e-9747.43translocation associated membrane protein 1 [Sourc... [more]
tram24.028e-8944.14translocating chain-associated membrane protein 2 ... [more]
cers2a2.016e-619.13ceramide synthase 2 [Source:NCBI gene;Acc:10116285... [more]
back to top
BLAST of Translocating chain-associated membrane protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000051052.10.000e+099.74SMESG000051052.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031823 ID=SMED30031823|Name=Translocating chain-associated membrane protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1408bp
CAATCGTGCAAACATCTTCATATGTTTTGTTTTAATTCTCTGTATTGTAA
CGTTTACAAACATAATTTTATTTGACGTGGTTTATCATCTACTGTATCAC
TGTTAATCATGAATGCCAAGTCCTTAAGAAAGAAAAATAAGAATCTATCT
TATTTTTCTCATGAATATATAATTCAAAATCATGGTGATATTGTAAGTTT
TGTCGCAATGATCATTGTGATGGGATTAATGTTTAAGGTTTCTACCCCAT
TAGCTTCAATGTTCGTTGTTATGAGCCATAATGTTACAAATAACGAGACT
TTATCTAATAAATTGGAAAATTTGTACCTTCCTGGTCGTAATGATGTTTT
GTGCTGTTTTTTCTATACATTAATTTGTATTGTTATTCATGCTGTCATTC
AAGAATATGGATTAGATAAACTGAACAAAAAGCTACATTTATCCAAGACA
AAATACAGCAAATTCAATGAATCTGGGCAGTTGGCAGTATTTTATCTCGT
GTCAGCCATCTGGGGTGCTAATATAATCTACACTGAAAAATATATAACGA
GCTTGAGTGATCTCTGGGAAACTTATCCAAATATTCCATTGACATTTTGG
GCGAAATTCTATTTTATTTTCCAAATATGCTACTGGTTGCATAACTATCC
GGAATTATATTTCCAGAAGGTGAAGCGAGACGAAATGCCCGGAAGAGTAC
TCTATACAACTCTCTACTTATTTGCTGTCCTAATGCCTTATGTACTAAAT
ATGACTCGTCTCGGATTAGTGCTATTGGTTGCCAATTATATTGTAGAATT
CATTTTCCACTTTTCCAGATTGATATACTTCTCTGGTAGAATTAAATATG
CTAAAATTGGATTTCTTCTGTGGGACTTTTTGTTTGTAGCAACTAGAATT
CTCTGTACCGCTCTCGCATTTTTATATTTTCATGTCGGATTGGAGCAAAA
GAATCAACCAACTATTAAAATTGCCGAAGGAAACTTTAATACCAAAATCG
TCAGATTGAATGGATTGGTGTTTATATTTGTCACTCAACTCTATGCCATG
TGGAATTTCCTGCATTTCCACATGAAAAGATGGAGAGAAAAATCTTCCAT
TGGAAAACAAGGCTCGAAAATGCTTTTCGATACAAAAAAGAAAGATGGAA
CCAAAAAAAAATCTAAGAAAGATGAAGATGATTTGAACGAGTTGCCGGAA
GCTGATCAGAACCAACAGAAAGAGCTGAGACAGCGTAAATCAAAAACCAA
ATTGTGATCTGAGCGGCATTTACATGGAAATTTCCCCCATTTAATTTTTA
ATCAAAAATTGCGTGAATGTGCTTTGAAAATATTTTACGTATTTGCTTTG
TTATTGACTTGTTTGATATTATTTCAATTGTTCTTTATTTTCTGGTGGTT
TGCAATCA
back to top

protein sequence of SMED30031823-orf-1

>SMED30031823-orf-1 ID=SMED30031823-orf-1|Name=SMED30031823-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=383bp
MNAKSLRKKNKNLSYFSHEYIIQNHGDIVSFVAMIIVMGLMFKVSTPLAS
MFVVMSHNVTNNETLSNKLENLYLPGRNDVLCCFFYTLICIVIHAVIQEY
GLDKLNKKLHLSKTKYSKFNESGQLAVFYLVSAIWGANIIYTEKYITSLS
DLWETYPNIPLTFWAKFYFIFQICYWLHNYPELYFQKVKRDEMPGRVLYT
TLYLFAVLMPYVLNMTRLGLVLLVANYIVEFIFHFSRLIYFSGRIKYAKI
GFLLWDFLFVATRILCTALAFLYFHVGLEQKNQPTIKIAEGNFNTKIVRL
NGLVFIFVTQLYAMWNFLHFHMKRWREKSSIGKQGSKMLFDTKKKDGTKK
KSKKDEDDLNELPEADQNQQKELRQRKSKTKL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006616SRP-dependent cotranslational protein targeting to membrane, translocation
GO:0006810transport
GO:0015031protein transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000028Category 2 cell
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000484secretory system
PLANA:0002032epidermal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR006634TLC-dom
IPR016447Translocation_assoc_membrane
IPR013599TRAM1
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006634TRAM/LAG1/CLN8 homology domainSMARTSM00724lag1_27coord: 117..328
e-value: 1.5E-28
score: 110.9
IPR006634TRAM/LAG1/CLN8 homology domainPFAMPF03798TRAM_LAG1_CLN8coord: 118..318
e-value: 5.7E-21
score: 75.2
IPR006634TRAM/LAG1/CLN8 homology domainPROSITEPS50922TLCcoord: 117..328
score: 16.513
IPR016447Translocation associated membrane proteinPIRSFPIRSF005449TRAMcoord: 1..381
e-value: 2.6E-137
score: 455.2
IPR016447Translocation associated membrane proteinPANTHERPTHR12371TRANSLOCATION ASSOCIATED MEMBRANE PROTEINcoord: 3..374
IPR013599TRAM1-like proteinPFAMPF08390TRAM1coord: 49..115
e-value: 9.6E-18
score: 63.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 340..382
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 340..375
NoneNo IPR availablePANTHERPTHR12371:SF11TRANSLOCATING CHAIN-ASSOCIATED MEMBRANE PROTEINcoord: 3..374
NoneNo IPR availableTMHMMTMhelixcoord: 218..240
NoneNo IPR availableTMHMMTMhelixcoord: 197..214
NoneNo IPR availableTMHMMTMhelixcoord: 80..102
NoneNo IPR availableTMHMMTMhelixcoord: 20..42
NoneNo IPR availableTMHMMTMhelixcoord: 155..177
NoneNo IPR availableTMHMMTMhelixcoord: 252..274
NoneNo IPR availableTMHMMTMhelixcoord: 123..140
NoneNo IPR availableTMHMMTMhelixcoord: 297..319