SMED30031822

Overview
NameSMED30031822
Smed IDSMED30031822
Length (bp)2052
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30031822 (SMED30031822) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30031822 (SMED30031822) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30031822 (SMED30031822) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30031822 (SMED30031822) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031822

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30031822SMESG000077258.1 dd_Smed_v4_8993_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30031822SMESG000077258.1 dd_Smed_v4_8993_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30031822SMESG000077258.1 dd_Smed_v6_8993_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30031822SMESG000077258.1 dd_Smed_v6_8993_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30031822SMESG000077258.1 dd_Smed_v4_8993_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30031822SMESG000077258.1 dd_Smed_v4_8993_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30031822SMESG000077258.1 dd_Smed_v4_8993_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30031822 vs. Ensembl Human
Match: EPS8L2 (EPS8 like 2 [Source:HGNC Symbol;Acc:HGNC:21296])

HSP 1 Score: 62.003 bits (149), Expect = 3.141e-9
Identity = 45/153 (29.41%), Postives = 74/153 (48.37%), Query Frame = 2
Query:  803 INEELHLLNTHLKEIRHFMNEMFKLIYNAVQEKKRKLQENYNRNEPQPQIVHL----PSKLEFIETVEKIKTCLNLAAAHREIITNPSSEEIINQLFIYLRILADATINHSTGKSDLVIGIKNPQINSSTVKFLTNHLNAENTKFWIILGFNF 1249
            I +E  +LN  L +I  F+  + K      Q  +RK  +   +  P   ++ L    PS+ EFI+  +KIK  +NL A  ++ I NPS+ E+++ LF  L    D  +N  +G  D+   +  P ++   V FL  HL  +    W  LG ++
Sbjct:  268 IEKETQILNCALDDIEWFVARLQKAAEAFKQLNQRKKGKKKGKKAPAEGVLTLRARPPSEGEFIDCFQKIKLAINLLAKLQKHIQNPSAAELVHFLFGPL----DLIVNTCSG-PDIARSVSCPLLSRDAVDFLRGHLVPKEMSLWESLGESW 415          
BLAST of SMED30031822 vs. Ensembl Human
Match: EPS8L2 (EPS8 like 2 [Source:HGNC Symbol;Acc:HGNC:21296])

HSP 1 Score: 62.003 bits (149), Expect = 3.141e-9
Identity = 45/153 (29.41%), Postives = 74/153 (48.37%), Query Frame = 2
Query:  803 INEELHLLNTHLKEIRHFMNEMFKLIYNAVQEKKRKLQENYNRNEPQPQIVHL----PSKLEFIETVEKIKTCLNLAAAHREIITNPSSEEIINQLFIYLRILADATINHSTGKSDLVIGIKNPQINSSTVKFLTNHLNAENTKFWIILGFNF 1249
            I +E  +LN  L +I  F+  + K      Q  +RK  +   +  P   ++ L    PS+ EFI+  +KIK  +NL A  ++ I NPS+ E+++ LF  L    D  +N  +G  D+   +  P ++   V FL  HL  +    W  LG ++
Sbjct:  268 IEKETQILNCALDDIEWFVARLQKAAEAFKQLNQRKKGKKKGKKAPAEGVLTLRARPPSEGEFIDCFQKIKLAINLLAKLQKHIQNPSAAELVHFLFGPL----DLIVNTCSG-PDIARSVSCPLLSRDAVDFLRGHLVPKEMSLWESLGESW 415          
BLAST of SMED30031822 vs. Ensembl Human
Match: EPS8L2 (EPS8 like 2 [Source:HGNC Symbol;Acc:HGNC:21296])

HSP 1 Score: 61.6178 bits (148), Expect = 3.385e-9
Identity = 45/153 (29.41%), Postives = 74/153 (48.37%), Query Frame = 2
Query:  803 INEELHLLNTHLKEIRHFMNEMFKLIYNAVQEKKRKLQENYNRNEPQPQIVHL----PSKLEFIETVEKIKTCLNLAAAHREIITNPSSEEIINQLFIYLRILADATINHSTGKSDLVIGIKNPQINSSTVKFLTNHLNAENTKFWIILGFNF 1249
            I +E  +LN  L +I  F+  + K      Q  +RK  +   +  P   ++ L    PS+ EFI+  +KIK  +NL A  ++ I NPS+ E+++ LF  L    D  +N  +G  D+   +  P ++   V FL  HL  +    W  LG ++
Sbjct:  252 IEKETQILNCALDDIEWFVARLQKAAEAFKQLNQRKKGKKKGKKAPAEGVLTLRARPPSEGEFIDCFQKIKLAINLLAKLQKHIQNPSAAELVHFLFGPL----DLIVNTCSG-PDIARSVSCPLLSRDAVDFLRGHLVPKEMSLWESLGESW 399          
BLAST of SMED30031822 vs. Ensembl Human
Match: EPS8L2 (EPS8 like 2 [Source:HGNC Symbol;Acc:HGNC:21296])

HSP 1 Score: 61.6178 bits (148), Expect = 3.385e-9
Identity = 45/153 (29.41%), Postives = 74/153 (48.37%), Query Frame = 2
Query:  803 INEELHLLNTHLKEIRHFMNEMFKLIYNAVQEKKRKLQENYNRNEPQPQIVHL----PSKLEFIETVEKIKTCLNLAAAHREIITNPSSEEIINQLFIYLRILADATINHSTGKSDLVIGIKNPQINSSTVKFLTNHLNAENTKFWIILGFNF 1249
            I +E  +LN  L +I  F+  + K      Q  +RK  +   +  P   ++ L    PS+ EFI+  +KIK  +NL A  ++ I NPS+ E+++ LF  L    D  +N  +G  D+   +  P ++   V FL  HL  +    W  LG ++
Sbjct:  252 IEKETQILNCALDDIEWFVARLQKAAEAFKQLNQRKKGKKKGKKAPAEGVLTLRARPPSEGEFIDCFQKIKLAINLLAKLQKHIQNPSAAELVHFLFGPL----DLIVNTCSG-PDIARSVSCPLLSRDAVDFLRGHLVPKEMSLWESLGESW 399          
BLAST of SMED30031822 vs. Ensembl Human
Match: EPS8L2 (EPS8 like 2 [Source:HGNC Symbol;Acc:HGNC:21296])

HSP 1 Score: 61.6178 bits (148), Expect = 3.385e-9
Identity = 45/153 (29.41%), Postives = 74/153 (48.37%), Query Frame = 2
Query:  803 INEELHLLNTHLKEIRHFMNEMFKLIYNAVQEKKRKLQENYNRNEPQPQIVHL----PSKLEFIETVEKIKTCLNLAAAHREIITNPSSEEIINQLFIYLRILADATINHSTGKSDLVIGIKNPQINSSTVKFLTNHLNAENTKFWIILGFNF 1249
            I +E  +LN  L +I  F+  + K      Q  +RK  +   +  P   ++ L    PS+ EFI+  +KIK  +NL A  ++ I NPS+ E+++ LF  L    D  +N  +G  D+   +  P ++   V FL  HL  +    W  LG ++
Sbjct:  252 IEKETQILNCALDDIEWFVARLQKAAEAFKQLNQRKKGKKKGKKAPAEGVLTLRARPPSEGEFIDCFQKIKLAINLLAKLQKHIQNPSAAELVHFLFGPL----DLIVNTCSG-PDIARSVSCPLLSRDAVDFLRGHLVPKEMSLWESLGESW 399          
BLAST of SMED30031822 vs. Ensembl Zebrafish
Match: eps8l1b (eps8 like 1b [Source:ZFIN;Acc:ZDB-GENE-050506-143])

HSP 1 Score: 65.4698 bits (158), Expect = 1.827e-11
Identity = 37/118 (31.36%), Postives = 62/118 (52.54%), Query Frame = 2
Query:  962 PSKLEFIETVEKIKTCLNLAAAHREIITNPSSEEIINQLFIYLRILADATINHSTGKSDLVIGIKNPQINSSTVKFLTNHLNAENTKFWIILGFNFGFIRGSSLSHSSRNPIDEFEIK 1315
            PS+ EFI+T +K K CL L A  +  I+NPS+EE+++ +F  L ++  A     TG       + +P +    V  L N+L  +    W+ LG N+   R S+L    R+P+  + ++
Sbjct:   80 PSEREFIDTFQKFKYCLGLLARLKPAISNPSAEELVHHVFKPLDMMVKA-----TGGPGFAASVSSPAMTEGAVNLLKNNLTTQENALWLSLGPNWTHQR-SAL----RSPVAPYTLQ 187          
BLAST of SMED30031822 vs. Ensembl Zebrafish
Match: eps8l1b (eps8 like 1b [Source:ZFIN;Acc:ZDB-GENE-050506-143])

HSP 1 Score: 65.855 bits (159), Expect = 7.787e-11
Identity = 37/118 (31.36%), Postives = 62/118 (52.54%), Query Frame = 2
Query:  962 PSKLEFIETVEKIKTCLNLAAAHREIITNPSSEEIINQLFIYLRILADATINHSTGKSDLVIGIKNPQINSSTVKFLTNHLNAENTKFWIILGFNFGFIRGSSLSHSSRNPIDEFEIK 1315
            PS+ EFI+T +K K CL L A  +  I+NPS+EE+++ +F  L ++  A     TG       + +P +    V  L N+L  +    W+ LG N+   R S+L    R+P+  + ++
Sbjct:  104 PSEREFIDTFQKFKYCLGLLARLKPAISNPSAEELVHHVFKPLDMMVKA-----TGGPGFAASVSSPAMTEGAVNLLKNNLTTQENALWLSLGPNWTHQR-SAL----RSPVAPYTLQ 211          
BLAST of SMED30031822 vs. Ensembl Zebrafish
Match: eps8l1a (eps8 like 1a [Source:ZFIN;Acc:ZDB-GENE-050306-14])

HSP 1 Score: 62.7734 bits (151), Expect = 1.748e-10
Identity = 43/158 (27.22%), Postives = 74/158 (46.84%), Query Frame = 2
Query:  812 ELHLLNTHLKEIRHFM------------NEMFKLIYNAVQEKKRKLQENYNRNEPQPQIVHLPSKLEFIETVEKIKTCLNLAAAHREIITNPSSEEIINQLFIYLRILADATINHSTGKSDLVIGIKNPQINSSTVKFLTNHLNAENTKFWIILGFNF 1249
            E+ L+N    ++ HFM             E  K      ++K +  +     +EP PQ V  PS+ EF++  +KIK    L    +  I+ PSSEE+++ +F+ L+++       +TG   L   I +P + S  +  L ++LN +    W  LG N+
Sbjct:   53 EVELVNHCFADVEHFMARLQQTAEAKNIQEQLKRSKKKSRKKNKTKKNKKEDDEPTPQKVTPPSEQEFVDIFQKIKYSFCLLDRLKMKISEPSSEELLHHVFVPLQLMV-----KTTGGPKLASSISSPALTSGAISLLQHNLNEQEKTLWTSLGPNW 205          
BLAST of SMED30031822 vs. Ensembl Zebrafish
Match: eps8l1a (eps8 like 1a [Source:ZFIN;Acc:ZDB-GENE-050306-14])

HSP 1 Score: 62.7734 bits (151), Expect = 1.906e-10
Identity = 43/160 (26.88%), Postives = 74/160 (46.25%), Query Frame = 2
Query:  812 ELHLLNTHLKEIRHFM------------NEMFKLIYNAVQEKKRKLQENYNRNEPQPQIVHLPSKLEFIETVEKIKTCLNLAAAHREIITNPSSEEIINQLFIYLRILADATINHSTGKSDLVIGIKNPQINSSTVKFLTNHLNAENTKFWIILGFNFGF 1255
            E+ L+N    ++ HFM             E  K      ++K +  +     +EP PQ V  PS+ EF++  +KIK    L    +  I+ PSSEE+++ +F+ L+++       +TG   L   I +P + S  +  L ++LN +    W  LG N+  
Sbjct:   40 EVELVNHCFADVEHFMARLQQTAEAKNIQEQLKRSKKKSRKKNKTKKNKKEDDEPTPQKVTPPSEQEFVDIFQKIKYSFCLLDRLKMKISEPSSEELLHHVFVPLQLMVK-----TTGGPKLASSISSPALTSGAISLLQHNLNEQEKTLWTSLGPNWTL 194          
BLAST of SMED30031822 vs. Ensembl Zebrafish
Match: eps8l1a (eps8 like 1a [Source:ZFIN;Acc:ZDB-GENE-050306-14])

HSP 1 Score: 63.5438 bits (153), Expect = 4.239e-10
Identity = 34/106 (32.08%), Postives = 57/106 (53.77%), Query Frame = 2
Query:  932 NEPQPQIVHLPSKLEFIETVEKIKTCLNLAAAHREIITNPSSEEIINQLFIYLRILADATINHSTGKSDLVIGIKNPQINSSTVKFLTNHLNAENTKFWIILGFNF 1249
            +EP PQ V  PS+ EF++  +KIK    L    +  I+ PSSEE+++ +F+ L+++       +TG   L   I +P + S  +  L ++LN +    W  LG N+
Sbjct:  105 DEPTPQKVTPPSEQEFVDIFQKIKYSFCLLDRLKMKISEPSSEELLHHVFVPLQLMV-----KTTGGPKLASSISSPALTSGAISLLQHNLNEQEKTLWTSLGPNW 205          
BLAST of SMED30031822 vs. Ensembl Xenopus
Match: EPS8L2 (EPS8-like 2 [Source:NCBI gene;Acc:100489749])

HSP 1 Score: 58.151 bits (139), Expect = 4.289e-8
Identity = 44/158 (27.85%), Postives = 74/158 (46.84%), Query Frame = 2
Query:  803 INEELHLLNTHLKEIRHFMNEMFKLIYNAVQEKKRKLQENYNRNEPQPQIVHL----PSKLEFIETVEKIKTCLNLAAAHREIITNPSSEEIINQLFIYLRILADATINHSTGKSDLVIGIKNPQINSSTVKFLTNHLNAENTKFWIILGFNFGFIRG 1264
            I ++  +LN  L +I  F+ ++ K      Q  +RK  +   +      ++ L    P++ EF++  +KIK  +NL A  ++ I NPSS E+I+ LF  L +     I  S+G  +L   I  P ++     FL  HL  +    W +LG  +   R 
Sbjct:  225 IEKDTQVLNCTLDDIEFFVAKLQKAAEAFKQLNQRKKGKKNKKKGHAEGMLTLRSKPPTEFEFVDCYQKIKLAINLLAKLKKHIQNPSSAELIHFLFGPLEL-----IIQSSGGPELGRSILAPLLSRDATDFLRGHLTPKEMAIWEVLGDRWTKCRA 377          
BLAST of SMED30031822 vs. Ensembl Xenopus
Match: EPS8L2 (EPS8-like 2 [Source:NCBI gene;Acc:100489749])

HSP 1 Score: 58.151 bits (139), Expect = 4.443e-8
Identity = 44/158 (27.85%), Postives = 74/158 (46.84%), Query Frame = 2
Query:  803 INEELHLLNTHLKEIRHFMNEMFKLIYNAVQEKKRKLQENYNRNEPQPQIVHL----PSKLEFIETVEKIKTCLNLAAAHREIITNPSSEEIINQLFIYLRILADATINHSTGKSDLVIGIKNPQINSSTVKFLTNHLNAENTKFWIILGFNFGFIRG 1264
            I ++  +LN  L +I  F+ ++ K      Q  +RK  +   +      ++ L    P++ EF++  +KIK  +NL A  ++ I NPSS E+I+ LF  L +     I  S+G  +L   I  P ++     FL  HL  +    W +LG  +   R 
Sbjct:  226 IEKDTQVLNCTLDDIEFFVAKLQKAAEAFKQLNQRKKGKKNKKKGHAEGMLTLRSKPPTEFEFVDCYQKIKLAINLLAKLKKHIQNPSSAELIHFLFGPLEL-----IIQSSGGPELGRSILAPLLSRDATDFLRGHLTPKEMAIWEVLGDRWTKCRA 378          
BLAST of SMED30031822 vs. Ensembl Xenopus
Match: EPS8L2 (EPS8-like 2 [Source:NCBI gene;Acc:100489749])

HSP 1 Score: 57.7658 bits (138), Expect = 4.896e-8
Identity = 44/158 (27.85%), Postives = 74/158 (46.84%), Query Frame = 2
Query:  803 INEELHLLNTHLKEIRHFMNEMFKLIYNAVQEKKRKLQENYNRNEPQPQIVHL----PSKLEFIETVEKIKTCLNLAAAHREIITNPSSEEIINQLFIYLRILADATINHSTGKSDLVIGIKNPQINSSTVKFLTNHLNAENTKFWIILGFNFGFIRG 1264
            I ++  +LN  L +I  F+ ++ K      Q  +RK  +   +      ++ L    P++ EF++  +KIK  +NL A  ++ I NPSS E+I+ LF  L +     I  S+G  +L   I  P ++     FL  HL  +    W +LG  +   R 
Sbjct:  218 IEKDTQVLNCTLDDIEFFVAKLQKAAEAFKQLNQRKKGKKNKKKGHAEGMLTLRSKPPTEFEFVDCYQKIKLAINLLAKLKKHIQNPSSAELIHFLFGPLEL-----IIQSSGGPELGRSILAPLLSRDATDFLRGHLTPKEMAIWEVLGDRWTKCRA 370          
BLAST of SMED30031822 vs. Ensembl Xenopus
Match: eps8 (epidermal growth factor receptor pathway substrate 8 [Source:NCBI gene;Acc:779963])

HSP 1 Score: 55.8398 bits (133), Expect = 2.377e-7
Identity = 43/160 (26.88%), Postives = 77/160 (48.12%), Query Frame = 2
Query:  797 ASINEELHLLNTHLKEIRHFMNEMFKLIYNAVQEKKRKLQENYNRNEPQPQIVHL----PSKLEFIETVEKIKTCLNLAAAHREIITNPSSEEIINQLFIYLRILADATINHSTGKSDLVIGIKNPQINSSTVKFLTNHLNAENTKFWIILGFNFGFIRG 1264
            A I+ ++ +LN  L ++  F+ ++ K      +  KRK  +       +  ++ L    P + EF++  +K K  +NL A  +  I NPS+ E+++ LF  L ++ +A     TG  DL   + +P I   ++ FL   LN E  + W  LG ++   R 
Sbjct:  222 ARIDRDVQILNHILDDVEFFIMKLQKAAEAFSELSKRKKGKKKKGPGGEEGVLTLRARPPPQEEFVDCFQKFKHGINLLAKLKSHIQNPSASELVHFLFTPLHMMVEA-----TGGPDLARTVLSPLITKDSLDFLNFILNKEEKQLWTSLGDSWNKYRA 376          
BLAST of SMED30031822 vs. Ensembl Xenopus
Match: eps8 (epidermal growth factor receptor pathway substrate 8 [Source:NCBI gene;Acc:779963])

HSP 1 Score: 55.8398 bits (133), Expect = 2.408e-7
Identity = 32/101 (31.68%), Postives = 52/101 (51.49%), Query Frame = 2
Query:  962 PSKLEFIETVEKIKTCLNLAAAHREIITNPSSEEIINQLFIYLRILADATINHSTGKSDLVIGIKNPQINSSTVKFLTNHLNAENTKFWIILGFNFGFIRG 1264
            P + EF++  +K K  +NL A  +  I NPS+ E+++ LF  L ++ +A     TG  DL   + +P I   ++ FL   LN E  + W  LG ++   R 
Sbjct:  318 PPQEEFVDCFQKFKHGINLLAKLKSHIQNPSASELVHFLFTPLHMMVEA-----TGGPDLARTVLSPLITKDSLDFLNFILNKEEKQLWTSLGDSWNKYRA 413          
BLAST of SMED30031822 vs. Ensembl Mouse
Match: Eps8l2 (EPS8-like 2 [Source:MGI Symbol;Acc:MGI:2138828])

HSP 1 Score: 61.2326 bits (147), Expect = 3.143e-9
Identity = 45/150 (30.00%), Postives = 74/150 (49.33%), Query Frame = 2
Query:  803 INEELHLLNTHLKEIRHFMNEMFKLIYNAVQEKKRKLQENYNRNEPQPQIVHL----PSKLEFIETVEKIKTCLNLAAAHREIITNPSSEEIINQLFIYLRILADATINHSTGKSDLVIGIKNPQINSSTVKFLTNHLNAENTKFWIILG 1240
            I +E  +LN  L +I  F+  + K      Q  +RK  +  N+  P   ++ L    PS+ EF++  +K K  +NL A  ++ I NPS+ E+++ LF  L    D  IN + G  D+   + +P +++  V FL  HL  +    W  LG
Sbjct:  255 IEKETQILNCTLDDIEWFVARLQKAAEAFKQLNQRKKGKKKNKKGPAEGVLTLRARPPSEGEFVDCFQKTKLAINLLAKLQKHIQNPSAAELVHFLFGPL----DLIIN-TCGSPDIARSVSSPLLSTDAVSFLRGHLVPKEMTLWESLG 399          
BLAST of SMED30031822 vs. Ensembl Mouse
Match: Eps8 (epidermal growth factor receptor pathway substrate 8 [Source:MGI Symbol;Acc:MGI:104684])

HSP 1 Score: 58.9214 bits (141), Expect = 1.697e-8
Identity = 45/160 (28.12%), Postives = 76/160 (47.50%), Query Frame = 2
Query:  797 ASINEELHLLNTHLKEIRHFMNEMFKLIYNAVQEKKRKLQENYNRNEPQPQIVHL----PSKLEFIETVEKIKTCLNLAAAHREIITNPSSEEIINQLFIYLRILADATINHSTGKSDLVIGIKNPQINSSTVKFLTNHLNAENTKFWIILGFNFGFIRG 1264
            A I+ ++ +LN  L +I  F+ ++ K      +  KRK  +   R  P   ++ L    P   EF++  +K K   NL A  +  I NPS+ ++++ LF  L ++  A     TG  +L   + +P +   TV FL     AE  K W+ LG ++  +R 
Sbjct:  264 ARIDRDVQILNHILDDIEFFITKLQKAAEAFSELSKRKKSKKSKRKGPGEGVLTLRAKPPPPDEFVDCFQKFKHGFNLLAKLKSHIQNPSASDLVHFLFTPLNMVVQA-----TGGPELASSVLSPLLTKDTVDFLNYTATAEERKLWMSLGDSWVKVRA 418          
BLAST of SMED30031822 vs. Ensembl Mouse
Match: Eps8 (epidermal growth factor receptor pathway substrate 8 [Source:MGI Symbol;Acc:MGI:104684])

HSP 1 Score: 58.9214 bits (141), Expect = 2.077e-8
Identity = 45/160 (28.12%), Postives = 76/160 (47.50%), Query Frame = 2
Query:  797 ASINEELHLLNTHLKEIRHFMNEMFKLIYNAVQEKKRKLQENYNRNEPQPQIVHL----PSKLEFIETVEKIKTCLNLAAAHREIITNPSSEEIINQLFIYLRILADATINHSTGKSDLVIGIKNPQINSSTVKFLTNHLNAENTKFWIILGFNFGFIRG 1264
            A I+ ++ +LN  L +I  F+ ++ K      +  KRK  +   R  P   ++ L    P   EF++  +K K   NL A  +  I NPS+ ++++ LF  L ++  A     TG  +L   + +P +   TV FL     AE  K W+ LG ++  +R 
Sbjct:  264 ARIDRDVQILNHILDDIEFFITKLQKAAEAFSELSKRKKSKKSKRKGPGEGVLTLRAKPPPPDEFVDCFQKFKHGFNLLAKLKSHIQNPSASDLVHFLFTPLNMVVQA-----TGGPELASSVLSPLLTKDTVDFLNYTATAEERKLWMSLGDSWVKVRA 418          
BLAST of SMED30031822 vs. Ensembl Mouse
Match: Eps8 (epidermal growth factor receptor pathway substrate 8 [Source:MGI Symbol;Acc:MGI:104684])

HSP 1 Score: 58.9214 bits (141), Expect = 2.077e-8
Identity = 45/160 (28.12%), Postives = 76/160 (47.50%), Query Frame = 2
Query:  797 ASINEELHLLNTHLKEIRHFMNEMFKLIYNAVQEKKRKLQENYNRNEPQPQIVHL----PSKLEFIETVEKIKTCLNLAAAHREIITNPSSEEIINQLFIYLRILADATINHSTGKSDLVIGIKNPQINSSTVKFLTNHLNAENTKFWIILGFNFGFIRG 1264
            A I+ ++ +LN  L +I  F+ ++ K      +  KRK  +   R  P   ++ L    P   EF++  +K K   NL A  +  I NPS+ ++++ LF  L ++  A     TG  +L   + +P +   TV FL     AE  K W+ LG ++  +R 
Sbjct:  264 ARIDRDVQILNHILDDIEFFITKLQKAAEAFSELSKRKKSKKSKRKGPGEGVLTLRAKPPPPDEFVDCFQKFKHGFNLLAKLKSHIQNPSASDLVHFLFTPLNMVVQA-----TGGPELASSVLSPLLTKDTVDFLNYTATAEERKLWMSLGDSWVKVRA 418          
BLAST of SMED30031822 vs. Ensembl Mouse
Match: Eps8 (epidermal growth factor receptor pathway substrate 8 [Source:MGI Symbol;Acc:MGI:104684])

HSP 1 Score: 58.9214 bits (141), Expect = 2.077e-8
Identity = 45/160 (28.12%), Postives = 76/160 (47.50%), Query Frame = 2
Query:  797 ASINEELHLLNTHLKEIRHFMNEMFKLIYNAVQEKKRKLQENYNRNEPQPQIVHL----PSKLEFIETVEKIKTCLNLAAAHREIITNPSSEEIINQLFIYLRILADATINHSTGKSDLVIGIKNPQINSSTVKFLTNHLNAENTKFWIILGFNFGFIRG 1264
            A I+ ++ +LN  L +I  F+ ++ K      +  KRK  +   R  P   ++ L    P   EF++  +K K   NL A  +  I NPS+ ++++ LF  L ++  A     TG  +L   + +P +   TV FL     AE  K W+ LG ++  +R 
Sbjct:  264 ARIDRDVQILNHILDDIEFFITKLQKAAEAFSELSKRKKSKKSKRKGPGEGVLTLRAKPPPPDEFVDCFQKFKHGFNLLAKLKSHIQNPSASDLVHFLFTPLNMVVQA-----TGGPELASSVLSPLLTKDTVDFLNYTATAEERKLWMSLGDSWVKVRA 418          
BLAST of SMED30031822 vs. UniProt/SwissProt
Match: sp|F1M3L7|EPS8_RAT (Epidermal growth factor receptor kinase substrate 8 OS=Rattus norvegicus OX=10116 GN=Eps8 PE=1 SV=2)

HSP 1 Score: 67.781 bits (164), Expect = 2.435e-10
Identity = 86/351 (24.50%), Postives = 145/351 (41.31%), Query Frame = 2
Query:  797 ASINEELHLLNTHLKEIRHFMNEMFKLIYNAVQEKKRKLQENYNRNEPQPQIVHL----PSKLEFIETVEKIKTCLNLAAAHREIITNPSSEEIINQLFIYLRILADATINHSTGKSDLVIGIKNPQINSSTVKFLTNHLNAENTKFWIILGFNFGFIRGSSLSHSSRNPIDEFEIKEISNIH-EYEQKHHSFTLQRQFQSNNRYMSADSIHEHEYVTPNSGTKNRRYDNSRESPVPLISSDLIYRSFPRLYEPLKKETPFYETENFQYQNVPSHSPNNNCYAHSNNCTWDDRQCRFIDAVRLRNGRIGKVLYDRSVQNYRELGVSSNEIVEILRDHGEMLSVKNALGEIG 1834
            A I+ ++ +LN  L +I  F+ ++ K      +  KRK  +   R  P   ++ L    P   EF++  +K K   NL A  +  I NPS+ ++++ LF  L ++  A     TG  +L   + +P +   TV FL   + AE  + W+ LG  +  +R       +  P ++F    +      +E    +F      Q  + Y  A+S+        N+  + R+ D+ R+S      SD         Y P       Y   N  Y   P         A  +  T +    R  D V+ +  +  K  YD   +N  EL V  ++++EIL D  +   V+NA G+ G
Sbjct:  264 ARIDRDVQILNHILDDIEFFITKLQKAAEAFSELSKRKKSKKSKRKGPGEGVLTLRAKPPPPDEFVDCFQKFKHGFNLLAKLKSHIQNPSASDLVHFLFTPLNMVVQA-----TGGPELASSVLSPLLTKDTVDFLNYTVKAEERQLWMSLGETWMKVR-------AEWPKEQFIPPYVPRFRNGWEPPMLNFMGAPTEQ--DMYQLAESV-------ANAAEQQRKQDSKRQSTEHSSMSD---------YPPADG----YTFSNSMYHRGPHVDQGEAALALKS--TPNRHVDRNYDPVKTQPKKYAKSKYDFVARNSSELSVMKDDVLEILDDRKQWWKVRNASGDSG 578          
BLAST of SMED30031822 vs. UniProt/SwissProt
Match: sp|Q5R4H4|EPS8_PONAB (Epidermal growth factor receptor kinase substrate 8 OS=Pongo abelii OX=9601 GN=EPS8 PE=2 SV=2)

HSP 1 Score: 62.3882 bits (150), Expect = 1.230e-8
Identity = 83/373 (22.25%), Postives = 142/373 (38.07%), Query Frame = 2
Query:  797 ASINEELHLLNTHLKEIRHFMNEMFKLIYNAVQEKKRKLQENYNRNEPQPQIVHL----PSKLEFIETVEKIKTCLNLAAAHREIITNPSSEEIINQLFIYLRILADATINHSTGKSDLVIGIKNPQINSSTVKFLTNHLNAENTKFWIILGFNFGFIRGS------------SLSHSSRNPI----------DEFEIKE-ISNIHEYEQKHHSFTLQRQFQSNNRYMSADSIHEHEYVTPNSGTKNRRYDNSRESPVPLISSDLIYRSFPRLYEPLKKETPFYETENFQYQNVPSHSPNNNCYAHSNNCTWDDRQCRFIDAVRLRNGRIGKVLYDRSVQNYRELGVSSNEIVEILRDHGEMLSVKNALGEIG 1834
            A I+ ++ +LN  L +I  F+ ++ K      +  KRK  +   R  P   ++ L    P   EF++  +K K   NL A  +  I NPS+ ++++ LF  L ++  A     TG  +L   + +P +N  T+ FL   +N +  + W+ LG  +   R                 +    P+          D +++ E ++N+ E+++K     L  +  S + Y  AD        + N  T+    D    +     +S+   R   R YEPLK +   Y                                               K  YD   +N  EL V  ++I+EIL D  +   V+NA G+ G
Sbjct:  264 ARIDRDVQILNHILDDIEFFITKLQKAAEAFSELSKRKKNKKGKRKGPGEGVLTLRAKPPPPDEFLDCFQKFKHGFNLLAKLKSHIQNPSAADLVHFLFTPLNMVVQA-----TGGPELASSVLSPLLNKDTIDFLNYTVNGDERQLWMSLGGTWTKARAEWPKEQFIPPYVPRFRNGWEPPMLNFMGATMEQDLYQLAESVANVAEHQRKQEIKRLSTEHSSVSEYHPADGY----AFSSNIYTRGSHLDQGEAAVAFKPTSN---RHIDRNYEPLKTQPKKY----------------------------------------------AKSKYDFVARNNSELSVLKDDILEILDDRKQWWKVRNASGDSG 578          
BLAST of SMED30031822 vs. UniProt/SwissProt
Match: sp|Q9H6S3|ES8L2_HUMAN (Epidermal growth factor receptor kinase substrate 8-like protein 2 OS=Homo sapiens OX=9606 GN=EPS8L2 PE=1 SV=2)

HSP 1 Score: 61.6178 bits (148), Expect = 1.625e-8
Identity = 45/153 (29.41%), Postives = 74/153 (48.37%), Query Frame = 2
Query:  803 INEELHLLNTHLKEIRHFMNEMFKLIYNAVQEKKRKLQENYNRNEPQPQIVHL----PSKLEFIETVEKIKTCLNLAAAHREIITNPSSEEIINQLFIYLRILADATINHSTGKSDLVIGIKNPQINSSTVKFLTNHLNAENTKFWIILGFNF 1249
            I +E  +LN  L +I  F+  + K      Q  +RK  +   +  P   ++ L    PS+ EFI+  +KIK  +NL A  ++ I NPS+ E+++ LF  L    D  +N  +G  D+   +  P ++   V FL  HL  +    W  LG ++
Sbjct:  252 IEKETQILNCALDDIEWFVARLQKAAEAFKQLNQRKKGKKKGKKAPAEGVLTLRARPPSEGEFIDCFQKIKLAINLLAKLQKHIQNPSAAELVHFLFGPL----DLIVNTCSG-PDIARSVSCPLLSRDAVDFLRGHLVPKEMSLWESLGESW 399          
BLAST of SMED30031822 vs. UniProt/SwissProt
Match: sp|Q12929|EPS8_HUMAN (Epidermal growth factor receptor kinase substrate 8 OS=Homo sapiens OX=9606 GN=EPS8 PE=1 SV=1)

HSP 1 Score: 61.6178 bits (148), Expect = 1.779e-8
Identity = 83/373 (22.25%), Postives = 142/373 (38.07%), Query Frame = 2
Query:  797 ASINEELHLLNTHLKEIRHFMNEMFKLIYNAVQEKKRKLQENYNRNEPQPQIVHL----PSKLEFIETVEKIKTCLNLAAAHREIITNPSSEEIINQLFIYLRILADATINHSTGKSDLVIGIKNPQINSSTVKFLTNHLNAENTKFWIILGFNFGFIRGS------------SLSHSSRNPI----------DEFEIKE-ISNIHEYEQKHHSFTLQRQFQSNNRYMSADSIHEHEYVTPNSGTKNRRYDNSRESPVPLISSDLIYRSFPRLYEPLKKETPFYETENFQYQNVPSHSPNNNCYAHSNNCTWDDRQCRFIDAVRLRNGRIGKVLYDRSVQNYRELGVSSNEIVEILRDHGEMLSVKNALGEIG 1834
            A I+ ++ +LN  L +I  F+ ++ K      +  KRK  +   R  P   ++ L    P   EF++  +K K   NL A  +  I NPS+ ++++ LF  L ++  A     TG  +L   + +P +N  T+ FL   +N +  + W+ LG  +   R                 +    P+          D +++ E ++N+ E+++K     L  +  S + Y  AD        + N  T+    D    +     +S+   R   R YEPLK +   Y                                               K  YD   +N  EL V  ++I+EIL D  +   V+NA G+ G
Sbjct:  264 ARIDRDVQILNHILDDIEFFITKLQKAAEAFSELSKRKKNKKGKRKGPGEGVLTLRAKPPPPDEFLDCFQKFKHGFNLLAKLKSHIQNPSAADLVHFLFTPLNMVVQA-----TGGPELASSVLSPLLNKDTIDFLNYTVNGDERQLWMSLGGTWMKARAEWPKEQFIPPYVPRFRNGWEPPMLNFMGATMEQDLYQLAESVANVAEHQRKQEIKRLSTEHSSVSEYHPADGY----AFSSNIYTRGSHLDQGEAAVAFKPTSN---RHIDRNYEPLKTQPKKY----------------------------------------------AKSKYDFVARNNSELSVLKDDILEILDDRKQWWKVRNASGDSG 578          
BLAST of SMED30031822 vs. UniProt/SwissProt
Match: sp|Q99K30|ES8L2_MOUSE (Epidermal growth factor receptor kinase substrate 8-like protein 2 OS=Mus musculus OX=10090 GN=Eps8l2 PE=1 SV=1)

HSP 1 Score: 61.2326 bits (147), Expect = 2.198e-8
Identity = 45/150 (30.00%), Postives = 74/150 (49.33%), Query Frame = 2
Query:  803 INEELHLLNTHLKEIRHFMNEMFKLIYNAVQEKKRKLQENYNRNEPQPQIVHL----PSKLEFIETVEKIKTCLNLAAAHREIITNPSSEEIINQLFIYLRILADATINHSTGKSDLVIGIKNPQINSSTVKFLTNHLNAENTKFWIILG 1240
            I +E  +LN  L +I  F+  + K      Q  +RK  +  N+  P   ++ L    PS+ EF++  +K K  +NL A  ++ I NPS+ E+++ LF  L    D  IN + G  D+   + +P +++  V FL  HL  +    W  LG
Sbjct:  255 IEKETQILNCTLDDIEWFVARLQKAAEAFKQLNQRKKGKKKNKKGPAEGVLTLRARPPSEGEFVDCFQKTKLAINLLAKLQKHIQNPSAAELVHFLFGPL----DLIIN-TCGSPDIARSVSSPLLSTDAVSFLRGHLVPKEMTLWESLG 399          
BLAST of SMED30031822 vs. TrEMBL
Match: T1IH22 (SH3 domain-containing protein OS=Strigamia maritima OX=126957 PE=4 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 3.564e-12
Identity = 75/330 (22.73%), Postives = 143/330 (43.33%), Query Frame = 2
Query:  962 PSKLEFIETVEKIKTCLNLAAAHREIITNPSSEEIINQLFIYLRILADATINHSTGKSDLVIGIKNPQINSSTVKFLTNHLNAENTKFWIILG----------------FNFGFIRGSSLSHSSRNPIDEFEIKEISNIHEYEQKHHSFTLQRQFQSNNRYMS-ADSIHEHEYVTPNSGTKNRRYDNSRESPVPLISSDLIYRSFPRLYEPLKKETPFYETE-------NFQYQNVPSHSPNNNCYAHSNNCT-------WDDRQCRFIDAVRLRNGRIGKVLYDRSVQNYRELGVSSNEIVEILRDHGEMLSVKNALGEIGECPKAIIS 1858
            P + EF++ ++K K   NL A  +  I  P++ E+++ LF  L ++ DA+ + + G  +L   + +P +    V+ LTN L ++ +  W  LG                ++  F  G +  +      +  EI   +     +Q  H   L+ Q  + +R  +  D    +++  PN        D+ + SP+P   S+     F   YEP   E   YE E       + +Y +       ++    S   T       +D +Q ++++ +R+R G++ +V Y R+  N +EL V   E +E+L D  +    +N  G++   P  I++
Sbjct:  252 PPEREFVDILQKFKLSFNLLAKLKSHIHEPNAPELVHFLFTPLALIMDASRDSNYG-PNLAGKVTSPLLTRDAVELLTNCLTSKESDLWHSLGETWIIPREQWKDYVSPYHPVFFSGWAPDYPLNEDRERQEITAKAAASVAQQSRHEEILKAQHDAESREQAYRDGRFPNDFYYPN--------DHEQPSPLP---SEERRHQFDSPYEPHLDERRTYERERARSPQSDREYHDSRDRDGRSDISTDSIERTSMDPQRPFDRQQQQWLEELRIRGGKVVQVTYPRTANNDKELTVFRGEFLEVLDDSRKWWKTRNIRGQVAHVPHTIVT 569          
BLAST of SMED30031822 vs. TrEMBL
Match: T1PA31 (Phosphotyrosine-binding protein OS=Musca domestica OX=7370 PE=2 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 1.875e-11
Identity = 82/384 (21.35%), Postives = 166/384 (43.23%), Query Frame = 2
Query:  812 ELHLLNTHLKEIRHFMNEMFKLIYNAVQEKKRKLQENYNRNEPQPQIVHL----PSKLEFIETVEKIKTCLNLAAAHREIITNPSSEEIINQLFIYLRILADATINHSTGKSDLVIGIKNPQINSSTVKFLTNHLNAENTKFWIILGFNFGFIRGSSLSHSSRNPIDEF-EIKEISNIHEYEQKHH-------------SFTLQRQFQSNNRYMSADSIHE----HEYVTPNSGTKNRRYDNSRESPVPLISSDLIYRSFPRLYEPLKKETPFYETENFQYQNVPSHSPNNNC-----------YAHSNNCTWDDRQCRFIDAVRLRNGRIGKVLYDRSVQNYRELGVSSNEIVEILRDHGEMLSVKNALGEIGECPKAIISEI 1864
            E++LLN+   +I  F+  + +    AV+E +R+    Y + E    +++L    PS+ EF++ + K K   NL +  +  I +P++ E+++ LF  L ++ +A    +  +S +   +  P + S T++FL N ++++ T+ W             SL  S   P +++ E +++SNI  Y +  H              + L  + Q +  ++   S         Y   N  ++ R +D S    + +     + RS  ++   +            Q QN+P    ++N             A  +    D    ++++ +R++  ++  V Y R   N +EL V   E +EI+ D  +   V+N  G +G  P  I++ +
Sbjct:  201 EVNLLNSCFDDIEKFIARL-QHTAAAVREIERR---KYKKREIGDGLLNLHTRPPSEQEFVDILAKFKLSFNLLSKLKSHIHDPNAPELVHFLFTPLALIVEAA-RDTYAESQIASNVIEPLLTSDTIQFLMNCVSSKETELW------------KSLGASWITPAEQWCEREDMSNIRGYNRPSHNMGGNEFPLPRPDQYGLADEQQIDYSHLPGTSTSRLNMLSGYKYKNKMSEQRNFDPSIGEEIEVNQVQDVMRSQEQMLGGM------------QIQNIPGEDMSDNAPHSSSQHLGKFKARHSPMEMDTLNEKWLNQLRMKGSKVVVVCYPRIANNDKELSVVKGEYLEIIDDSRKWWKVRNVNGNVGHIPSTIVAPV 555          
BLAST of SMED30031822 vs. TrEMBL
Match: A0A1I8M941 (SH3 domain-containing protein OS=Musca domestica OX=7370 GN=101893583 PE=4 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 2.720e-11
Identity = 82/384 (21.35%), Postives = 167/384 (43.49%), Query Frame = 2
Query:  812 ELHLLNTHLKEIRHFMNEMFKLIYNAVQEKKRKLQENYNRNEPQPQIVHL----PSKLEFIETVEKIKTCLNLAAAHREIITNPSSEEIINQLFIYLRILADATINHSTGKSDLVIGIKNPQINSSTVKFLTNHLNAENTKFWIILGFNFGFIRGSSLSHSSRNPIDEF-EIKEISNIHEYEQKHH-------------SFTLQRQFQSNNRYMSADSIHE----HEYVTPNSGTKNRRYDNSRESPVPLISSDLIYRSFPRLYEPLKKETPFYETENFQYQNVPSHSPNNNC-----------YAHSNNCTWDDRQCRFIDAVRLRNGRIGKVLYDRSVQNYRELGVSSNEIVEILRDHGEMLSVKNALGEIGECPKAIISEI 1864
            E++LLN+   +I  F+  + +    AV+E +R+    Y + E    +++L    PS+ EF++ + K K   NL +  +  I +P++ E+++ LF  L ++ +A  + +  +S +   +  P + S T++FL N ++++ T+ W             SL  S   P +++ E +++SNI  Y +  H              + L  + Q +  ++   S         Y   N  ++ R +D S    + +     + RS  ++   +            Q QN+P    ++N             A  +    D    ++++ +R++  ++  V Y R   N +EL V   E +EI+ D  +   V+N  G +G  P  I++ +
Sbjct:  220 EVNLLNSCFDDIEKFIARL-QHTAAAVREIERR---KYKKREIGDGLLNLHTRPPSEQEFVDILAKFKLSFNLLSKLKSHIHDPNAPELVHFLFTPLALIVEAARD-TYAESQIASNVIEPLLTSDTIQFLMNCVSSKETELW------------KSLGASWITPAEQWCEREDMSNIRGYNRPSHNMGGNEFPLPRPDQYGLADEQQIDYSHLPGTSTSRLNMLSGYKYKNKMSEQRNFDPSIGEEIEVNQVQDVMRSQEQVLGGM------------QIQNIPGEDMSDNAPHSSSQHLGKFKARHSPMEMDTLNEKWLNQLRMKGSKVVVVCYPRIANNDKELSVVKGEYLEIIDDSRKWWKVRNVNGNVGHIPSTIVAPV 574          
BLAST of SMED30031822 vs. TrEMBL
Match: A0A0P4W5F0 (SH3 domain-containing protein OS=Scylla olivacea OX=85551 PE=4 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 7.638e-11
Identity = 72/307 (23.45%), Postives = 129/307 (42.02%), Query Frame = 2
Query:  962 PSKLEFIETVEKIKTCLNLAAAHREIITNPSSEEIINQLFIYLRILADATINHSTGKSDLVIGIKNPQINSSTVKFLTNHLNAENTKFWIILGFNFGFIRGS-SLSHSSRNPIDEFEIKEISNIHEYEQKHHSFTLQRQFQSNNRYMSADSIH--EHEYVTPNSGTKNRR-----YDNSRESPVPLISSDLIYRSFPRLYEPLKKETPFYETENFQYQNVPSHSPNNNCYAHSNNCTWDDRQCRFIDAVRLRNGRIGKVLYDRSVQNYRELGVSSNEIVEILRDHGEMLSVKNALGEIGECPKAIIS 1858
            P + EF++  +K K   NL A  +  I +P++ E+++ LF  L ++ DA+ + + G  +L   + +P + +  V+ LTN L +  T+ W  LG  +   R S   S     P+  F       + + + +  S  L  +  +  +   A+ I   +HE        +        YD+ R  P P +         PR   P   E P     +   ++V             +  T+D  Q R++  ++ R  +I +V Y R+  N +EL V   E +E+L D  +     NA G+    P  I++
Sbjct:  333 PPEREFVDIFQKFKLSFNLLAKLKAHIHDPNAPELVHFLFTPLALIVDASRDSNYG-PNLPGKVLSPLLTADAVELLTNCLTSRETEIWQSLGETWCIPRSSWKYSVPPYQPV--FSNGWAPELAD-DSRDRSSVLASEVATEVKRTRAEDIRSAQHEAEIRQGRLRGDEYSSDFYDSDRREPSPPLGRYYAREDRPRSMTP-PSEYPQAGRSDISQESV-------------DQSTFDKHQQRWLSDLKARGAKIVQVTYPRTANNDKELTVVRGEYLEVLDDSRKWWKAVNARGQAAHVPHTIVT 621          
BLAST of SMED30031822 vs. TrEMBL
Match: A0A0P4VXZ2 (SH3 domain-containing protein OS=Scylla olivacea OX=85551 PE=4 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 9.367e-11
Identity = 72/307 (23.45%), Postives = 129/307 (42.02%), Query Frame = 2
Query:  962 PSKLEFIETVEKIKTCLNLAAAHREIITNPSSEEIINQLFIYLRILADATINHSTGKSDLVIGIKNPQINSSTVKFLTNHLNAENTKFWIILGFNFGFIRGS-SLSHSSRNPIDEFEIKEISNIHEYEQKHHSFTLQRQFQSNNRYMSADSIH--EHEYVTPNSGTKNRR-----YDNSRESPVPLISSDLIYRSFPRLYEPLKKETPFYETENFQYQNVPSHSPNNNCYAHSNNCTWDDRQCRFIDAVRLRNGRIGKVLYDRSVQNYRELGVSSNEIVEILRDHGEMLSVKNALGEIGECPKAIIS 1858
            P + EF++  +K K   NL A  +  I +P++ E+++ LF  L ++ DA+ + + G  +L   + +P + +  V+ LTN L +  T+ W  LG  +   R S   S     P+  F       + + + +  S  L  +  +  +   A+ I   +HE        +        YD+ R  P P +         PR   P   E P     +   ++V             +  T+D  Q R++  ++ R  +I +V Y R+  N +EL V   E +E+L D  +     NA G+    P  I++
Sbjct:  333 PPEREFVDIFQKFKLSFNLLAKLKAHIHDPNAPELVHFLFTPLALIVDASRDSNYG-PNLPGKVLSPLLTADAVELLTNCLTSRETEIWQSLGETWCIPRSSWKYSVPPYQPV--FSNGWAPELAD-DSRDRSSVLASEVATEVKRTRAEDIRSAQHEAEIRQGRLRGDEYSSDFYDSDRREPSPPLGRYYAREDRPRSMTP-PSEYPQAGRSDISQESV-------------DQSTFDKHQQRWLSDLKARGAKIVQVTYPRTANNDKELTVVRGEYLEVLDDSRKWWKAVNARGQAAHVPHTIVT 621          
BLAST of SMED30031822 vs. Ensembl Cavefish
Match: eps8l2 (EPS8 like 2 [Source:NCBI gene;Acc:103026465])

HSP 1 Score: 65.0846 bits (157), Expect = 1.915e-10
Identity = 46/160 (28.75%), Postives = 78/160 (48.75%), Query Frame = 2
Query:  776 PNSLSPLAS-INEELHLLNTHLKEIRHFMNEMFKLIYNAVQEKKRKLQENYNRNEPQPQIVHL----PSKLEFIETVEKIKTCLNLAAAHREIITNPSSEEIINQLFIYLRILADATINHSTGKSDLVIGIKNPQINSSTVKFLTNHLNAENTKFWIILG 1240
            P S   LA  I +++ +LN  L +I  F+  + K      Q  +R       +  P   ++ L    PS++EFI++++K+K   NL A  ++ I NPS+ E+++ LF  L +     +  S G  DL   I +P ++   V FL  HL  +    + +LG
Sbjct:  230 PESYEKLAQYIEKDVQILNCALDDIEIFVARLQKAAEAFAQLNQRNKSRKNKKRGPAEGMLTLRAKPPSEVEFIDSLQKLKLSFNLLAKLKKHIQNPSASELVHFLFGPLEL-----VLQSCGSPDLPRSIISPHLSRDAVDFLRGHLTPKEMTIFELLG 384          
BLAST of SMED30031822 vs. Ensembl Cavefish
Match: eps8l2 (EPS8 like 2 [Source:NCBI gene;Acc:103026465])

HSP 1 Score: 64.6994 bits (156), Expect = 2.048e-10
Identity = 46/160 (28.75%), Postives = 78/160 (48.75%), Query Frame = 2
Query:  776 PNSLSPLAS-INEELHLLNTHLKEIRHFMNEMFKLIYNAVQEKKRKLQENYNRNEPQPQIVHL----PSKLEFIETVEKIKTCLNLAAAHREIITNPSSEEIINQLFIYLRILADATINHSTGKSDLVIGIKNPQINSSTVKFLTNHLNAENTKFWIILG 1240
            P S   LA  I +++ +LN  L +I  F+  + K      Q  +R       +  P   ++ L    PS++EFI++++K+K   NL A  ++ I NPS+ E+++ LF  L +     +  S G  DL   I +P ++   V FL  HL  +    + +LG
Sbjct:  228 PESYEKLAQYIEKDVQILNCALDDIEIFVARLQKAAEAFAQLNQRNKSRKNKKRGPAEGMLTLRAKPPSEVEFIDSLQKLKLSFNLLAKLKKHIQNPSASELVHFLFGPLEL-----VLQSCGSPDLPRSIISPHLSRDAVDFLRGHLTPKEMTIFELLG 382          
BLAST of SMED30031822 vs. Ensembl Cavefish
Match: eps8l2 (EPS8 like 2 [Source:NCBI gene;Acc:103026465])

HSP 1 Score: 64.6994 bits (156), Expect = 2.095e-10
Identity = 46/160 (28.75%), Postives = 78/160 (48.75%), Query Frame = 2
Query:  776 PNSLSPLAS-INEELHLLNTHLKEIRHFMNEMFKLIYNAVQEKKRKLQENYNRNEPQPQIVHL----PSKLEFIETVEKIKTCLNLAAAHREIITNPSSEEIINQLFIYLRILADATINHSTGKSDLVIGIKNPQINSSTVKFLTNHLNAENTKFWIILG 1240
            P S   LA  I +++ +LN  L +I  F+  + K      Q  +R       +  P   ++ L    PS++EFI++++K+K   NL A  ++ I NPS+ E+++ LF  L +     +  S G  DL   I +P ++   V FL  HL  +    + +LG
Sbjct:  205 PESYEKLAQYIEKDVQILNCALDDIEIFVARLQKAAEAFAQLNQRNKSRKNKKRGPAEGMLTLRAKPPSEVEFIDSLQKLKLSFNLLAKLKKHIQNPSASELVHFLFGPLEL-----VLQSCGSPDLPRSIISPHLSRDAVDFLRGHLTPKEMTIFELLG 359          
BLAST of SMED30031822 vs. Ensembl Cavefish
Match: eps8l1a (eps8 like 1a [Source:ZFIN;Acc:ZDB-GENE-050306-14])

HSP 1 Score: 63.5438 bits (153), Expect = 4.326e-10
Identity = 32/96 (33.33%), Postives = 52/96 (54.17%), Query Frame = 2
Query:  962 PSKLEFIETVEKIKTCLNLAAAHREIITNPSSEEIINQLFIYLRILADATINHSTGKSDLVIGIKNPQINSSTVKFLTNHLNAENTKFWIILGFNF 1249
            PS  EF++  +KIK   +L    +  I+ PSSEE+++ LF+ L +L       +TG  D+  G+ +P + S  V  L  +L+ E  + W  LG N+
Sbjct:  123 PSGQEFVDIFQKIKYSFSLLGRLKNEISKPSSEELLHHLFVPLDLLV-----KTTGGPDMAAGVSSPALTSGAVGLLQQNLSQEERELWESLGPNW 213          
BLAST of SMED30031822 vs. Ensembl Cavefish
Match: eps8a (epidermal growth factor receptor pathway substrate 8 [Source:NCBI gene;Acc:103047627])

HSP 1 Score: 55.8398 bits (133), Expect = 1.325e-7
Identity = 40/159 (25.16%), Postives = 74/159 (46.54%), Query Frame = 2
Query:  797 ASINEELHLLNTHLKEIRHFMNEMFKLIYNAVQEKKRKLQENYNRNEPQPQIVHL----PSKLEFIETVEKIKTCLNLAAAHREIITNPSSEEIINQLFIYLRILADATINHSTGKSDLVIGIKNPQINSSTVKFLTNHLNAENTKFWIILGFNFGFIR 1261
            A ++ ++ +LN  L +I HF+ ++ K      +  KRK  +   +  P   ++ L    P + EF++  +K K   NL    +  I NPS+ ++++ LF  LR+     + H++G  DL   +  P +    + FL +    E    W+ LG  +   R
Sbjct:  263 ARVDRDVQILNHILDDIEHFVTKLQKAAEAFNELSKRKKSKKSKKKGPGEGMLTLRAKPPGQEEFVDCFQKFKHAFNLLGKLKNHIQNPSAVDLVHFLFTPLRM-----VIHTSGGVDLAKSVVVPLLTREAIDFLHSAGTPEERHLWVTLGDGWTKCR 416          
BLAST of SMED30031822 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010635.1 (pep scaffold:Pmarinus_7.0:GL476906:83540:115491:1 gene:ENSPMAG00000009631.1 transcript:ENSPMAT00000010635.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.003 bits (149), Expect = 2.880e-10
Identity = 33/101 (32.67%), Postives = 50/101 (49.50%), Query Frame = 2
Query:  962 PSKLEFIETVEKIKTCLNLAAAHREIITNPSSEEIINQLFIYLRILADATINHSTGKSDLVIGIKNPQINSSTVKFLTNHLNAENTKFWIILGFNFGFIRG 1264
            P   EF++ ++K K   NL A  + II NPS+EE+I  LF  L++     I H+ G  D+V  + +P +    +  L    N E  K W+ LG  +   R 
Sbjct:  306 PPPEEFVDILQKFKYGFNLLARLKGIIDNPSAEEMITSLFPPLQM-----ILHACGGLDMVRCVASPLLTRQAIDILNTSTNPEQRKLWLSLGNAWSVTRA 401          
BLAST of SMED30031822 vs. Ensembl Medaka
Match: EPS8L2 (EPS8 like 2 [Source:NCBI gene;Acc:101169604])

HSP 1 Score: 67.781 bits (164), Expect = 2.398e-11
Identity = 44/150 (29.33%), Postives = 77/150 (51.33%), Query Frame = 2
Query:  803 INEELHLLNTHLKEIRHFMNEMFKLIYNAVQEKKRKLQENYNRNEPQPQIVHL----PSKLEFIETVEKIKTCLNLAAAHREIITNPSSEEIINQLFIYLRILADATINHSTGKSDLVIGIKNPQINSSTVKFLTNHLNAENTKFWIILG 1240
            I +++ +LN  L +I  F+  + K      Q K+R   +   +  P   ++ L    PS+ EFI++++K+K  LNL    R+ I NP++ E+++ LF  L +     +  + G  DL   I +P ++  TV FL  HL  + T  + +LG
Sbjct:  240 IEKDVQILNCALDDIEIFVARLQKAAEAFSQLKQRNKSKKNKKKGPAEGMLTLRAKPPSEAEFIDSLQKLKLALNLLTKLRKHIQNPNASELVHFLFGPLEL-----VLQTCGSPDLARSIISPHLSKDTVDFLRGHLTPKETTIFELLG 384          
BLAST of SMED30031822 vs. Ensembl Medaka
Match: EPS8L2 (EPS8 like 2 [Source:NCBI gene;Acc:101169604])

HSP 1 Score: 67.781 bits (164), Expect = 2.400e-11
Identity = 44/150 (29.33%), Postives = 77/150 (51.33%), Query Frame = 2
Query:  803 INEELHLLNTHLKEIRHFMNEMFKLIYNAVQEKKRKLQENYNRNEPQPQIVHL----PSKLEFIETVEKIKTCLNLAAAHREIITNPSSEEIINQLFIYLRILADATINHSTGKSDLVIGIKNPQINSSTVKFLTNHLNAENTKFWIILG 1240
            I +++ +LN  L +I  F+  + K      Q K+R   +   +  P   ++ L    PS+ EFI++++K+K  LNL    R+ I NP++ E+++ LF  L +     +  + G  DL   I +P ++  TV FL  HL  + T  + +LG
Sbjct:  241 IEKDVQILNCALDDIEIFVARLQKAAEAFSQLKQRNKSKKNKKKGPAEGMLTLRAKPPSEAEFIDSLQKLKLALNLLTKLRKHIQNPNASELVHFLFGPLEL-----VLQTCGSPDLARSIISPHLSKDTVDFLRGHLTPKETTIFELLG 385          
BLAST of SMED30031822 vs. Ensembl Medaka
Match: EPS8L2 (EPS8 like 2 [Source:NCBI gene;Acc:101169604])

HSP 1 Score: 67.3958 bits (163), Expect = 2.973e-11
Identity = 44/150 (29.33%), Postives = 77/150 (51.33%), Query Frame = 2
Query:  803 INEELHLLNTHLKEIRHFMNEMFKLIYNAVQEKKRKLQENYNRNEPQPQIVHL----PSKLEFIETVEKIKTCLNLAAAHREIITNPSSEEIINQLFIYLRILADATINHSTGKSDLVIGIKNPQINSSTVKFLTNHLNAENTKFWIILG 1240
            I +++ +LN  L +I  F+  + K      Q K+R   +   +  P   ++ L    PS+ EFI++++K+K  LNL    R+ I NP++ E+++ LF  L +     +  + G  DL   I +P ++  TV FL  HL  + T  + +LG
Sbjct:  213 IEKDVQILNCALDDIEIFVARLQKAAEAFSQLKQRNKSKKNKKKGPAEGMLTLRAKPPSEAEFIDSLQKLKLALNLLTKLRKHIQNPNASELVHFLFGPLEL-----VLQTCGSPDLARSIISPHLSKDTVDFLRGHLTPKETTIFELLG 357          
BLAST of SMED30031822 vs. Ensembl Medaka
Match: eps8l1b (epidermal growth factor receptor kinase substrate 8-like protein 1 [Source:NCBI gene;Acc:101168497])

HSP 1 Score: 58.9214 bits (141), Expect = 1.186e-8
Identity = 30/100 (30.00%), Postives = 50/100 (50.00%), Query Frame = 2
Query:  962 PSKLEFIETVEKIKTCLNLAAAHREIITNPSSEEIINQLFIYLRILADATINHSTGKSDLVIGIKNPQINSSTVKFLTNHLNAENTKFWIILGFNFGFIR 1261
            P   EF+E  +K K C +L A  +  I +PSSEE+++ +F  L ++       +TG   +   + +P + +S +  L   LN E  + W  LG N+   R
Sbjct:  105 PQAEEFVEIFQKFKYCFSLLARLKSTIVSPSSEELVHHVFKPLDMMV-----KTTGGPAMGAAVSSPAMTNSAISLLQETLNEEEKQLWTSLGPNWTHPR 199          
BLAST of SMED30031822 vs. Ensembl Medaka
Match: eps8l1b (epidermal growth factor receptor kinase substrate 8-like protein 1 [Source:NCBI gene;Acc:101168497])

HSP 1 Score: 58.5362 bits (140), Expect = 1.609e-8
Identity = 30/100 (30.00%), Postives = 50/100 (50.00%), Query Frame = 2
Query:  962 PSKLEFIETVEKIKTCLNLAAAHREIITNPSSEEIINQLFIYLRILADATINHSTGKSDLVIGIKNPQINSSTVKFLTNHLNAENTKFWIILGFNFGFIR 1261
            P   EF+E  +K K C +L A  +  I +PSSEE+++ +F  L ++       +TG   +   + +P + +S +  L   LN E  + W  LG N+   R
Sbjct:  251 PQAEEFVEIFQKFKYCFSLLARLKSTIVSPSSEELVHHVFKPLDMMV-----KTTGGPAMGAAVSSPAMTNSAISLLQETLNEEEKQLWTSLGPNWTHPR 345          
BLAST of SMED30031822 vs. Planmine SMEST
Match: SMESG000077258.1 (SMESG000077258.1)

HSP 1 Score: 1179.08 bits (3049), Expect = 0.000e+0
Identity = 588/596 (98.66%), Postives = 592/596 (99.33%), Query Frame = 2
Query:   95 IARFNVDVLAVYISEDETPVPMSEAFNLLKQRLASKTPPKFERCIMQIWNKNHETFSIVFKSKEKNKVLETIDINSMGNPSCSEIPIGNYERQSLVFLPLLNKNNVAELFIIHPNSVTSQDVVLKLSRLLEYRLNPSPNSKPNEHESIHSLNLGNTYTSKSKDNGSVHTRNMDNSLRSKPRENGNFYTLNYESKENNDRSDTKXXXXXXXXXXXXWYGKLDSVNTLQPNSLSPLASINEELHLLNTHLKEIRHFMNEMFKLIYNAVQEKKRKLQENYNRNEPQPQIVHLPSKLEFIETVEKIKTCLNLAAAHREIITNPSSEEIINQLFIYLRILADATINHSTGKSDLVIGIKNPQINSSTVKFLTNHLNAENTKFWIILGFNFGFIRGSSLSHSSRNPIDEFEIKEISNIHEYEQKHHSFTLQRQFQSNNRYMSADSIHEHEYVTPNSGTKNRRYDNSRESPVPLISSDLIYRSFPRLYEPLKKETPFYETENFQYQNVPSHSPNNNCYAHSNNCTWDDRQCRFIDAVRLRNGRIGKVLYDRSVQNYRELGVSSNEIVEILRDHGEMLSVKNALGEIGECPKAIISEIQNNYVN 1882
            IARFNVDVLAVYISEDETPVPMSEAFNLLKQRLASKTPPKFERCIMQIWNKNHETFSIVFKSKEKNKVLETIDINSMGNPSCSEIPIGNYERQSLVFLPLLNKNNVAELFIIHPNSVTSQDVVLKLSRLLEYRLNPS NSKPNEHESIHSLNLGNTYTSKSKDNGSVHT+NMDNSLRSKPRENGNFYTLNYESKENNDRSDTKSIYSISSNFINNWYGKLDSVNTLQPNSLSPLASI+EELHLLNTHLKEIRHFMNEMFKLIYNAVQEKKRKLQENYNRNEPQPQIVHLPSKLEFIETVEKIKTCLNLAAAHREIITNPSSEEIINQLFIYLRILADATINHSTGKSDLVIGIKNPQINSSTVKFLTNHLNAENTKFWIILGFNFGFIRGSS SH SRNPIDEFEIKEISNIHEYEQKHHSFTLQRQFQSNNRYMSADSIHEHEYVTPNSGTKNR+YDN RESPVPLISSDLIYRSFPRLYEPLKKETPFYETENFQYQNVPSHSPNN+CYAHSNNCTWDDRQCRFIDAVRLRNGRIGKVLYDRSVQNYRELGVSSNEIVEILRDHGEMLSVKNALGEIGECPKAIISEIQNNYVN
Sbjct:   18 IARFNVDVLAVYISEDETPVPMSEAFNLLKQRLASKTPPKFERCIMQIWNKNHETFSIVFKSKEKNKVLETIDINSMGNPSCSEIPIGNYERQSLVFLPLLNKNNVAELFIIHPNSVTSQDVVLKLSRLLEYRLNPSTNSKPNEHESIHSLNLGNTYTSKSKDNGSVHTKNMDNSLRSKPRENGNFYTLNYESKENNDRSDTKSIYSISSNFINNWYGKLDSVNTLQPNSLSPLASIHEELHLLNTHLKEIRHFMNEMFKLIYNAVQEKKRKLQENYNRNEPQPQIVHLPSKLEFIETVEKIKTCLNLAAAHREIITNPSSEEIINQLFIYLRILADATINHSTGKSDLVIGIKNPQINSSTVKFLTNHLNAENTKFWIILGFNFGFIRGSSPSHISRNPIDEFEIKEISNIHEYEQKHHSFTLQRQFQSNNRYMSADSIHEHEYVTPNSGTKNRKYDNHRESPVPLISSDLIYRSFPRLYEPLKKETPFYETENFQYQNVPSHSPNNSCYAHSNNCTWDDRQCRFIDAVRLRNGRIGKVLYDRSVQNYRELGVSSNEIVEILRDHGEMLSVKNALGEIGECPKAIISEIQNNYVN 613          
The following BLAST results are available for this feature:
BLAST of SMED30031822 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EPS8L23.141e-929.41EPS8 like 2 [Source:HGNC Symbol;Acc:HGNC:21296][more]
EPS8L23.141e-929.41EPS8 like 2 [Source:HGNC Symbol;Acc:HGNC:21296][more]
EPS8L23.385e-929.41EPS8 like 2 [Source:HGNC Symbol;Acc:HGNC:21296][more]
EPS8L23.385e-929.41EPS8 like 2 [Source:HGNC Symbol;Acc:HGNC:21296][more]
EPS8L23.385e-929.41EPS8 like 2 [Source:HGNC Symbol;Acc:HGNC:21296][more]
back to top
BLAST of SMED30031822 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30031822 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30031822 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eps8l1b1.827e-1131.36eps8 like 1b [Source:ZFIN;Acc:ZDB-GENE-050506-143][more]
eps8l1b7.787e-1131.36eps8 like 1b [Source:ZFIN;Acc:ZDB-GENE-050506-143][more]
eps8l1a1.748e-1027.22eps8 like 1a [Source:ZFIN;Acc:ZDB-GENE-050306-14][more]
eps8l1a1.906e-1026.88eps8 like 1a [Source:ZFIN;Acc:ZDB-GENE-050306-14][more]
eps8l1a4.239e-1032.08eps8 like 1a [Source:ZFIN;Acc:ZDB-GENE-050306-14][more]
back to top
BLAST of SMED30031822 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EPS8L24.289e-827.85EPS8-like 2 [Source:NCBI gene;Acc:100489749][more]
EPS8L24.443e-827.85EPS8-like 2 [Source:NCBI gene;Acc:100489749][more]
EPS8L24.896e-827.85EPS8-like 2 [Source:NCBI gene;Acc:100489749][more]
eps82.377e-726.88epidermal growth factor receptor pathway substrate... [more]
eps82.408e-731.68epidermal growth factor receptor pathway substrate... [more]
back to top
BLAST of SMED30031822 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Eps8l23.143e-930.00EPS8-like 2 [Source:MGI Symbol;Acc:MGI:2138828][more]
Eps81.697e-828.13epidermal growth factor receptor pathway substrate... [more]
Eps82.077e-828.13epidermal growth factor receptor pathway substrate... [more]
Eps82.077e-828.13epidermal growth factor receptor pathway substrate... [more]
Eps82.077e-828.13epidermal growth factor receptor pathway substrate... [more]
back to top
BLAST of SMED30031822 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|F1M3L7|EPS8_RAT2.435e-1024.50Epidermal growth factor receptor kinase substrate ... [more]
sp|Q5R4H4|EPS8_PONAB1.230e-822.25Epidermal growth factor receptor kinase substrate ... [more]
sp|Q9H6S3|ES8L2_HUMAN1.625e-829.41Epidermal growth factor receptor kinase substrate ... [more]
sp|Q12929|EPS8_HUMAN1.779e-822.25Epidermal growth factor receptor kinase substrate ... [more]
sp|Q99K30|ES8L2_MOUSE2.198e-830.00Epidermal growth factor receptor kinase substrate ... [more]
back to top
BLAST of SMED30031822 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1IH223.564e-1222.73SH3 domain-containing protein OS=Strigamia maritim... [more]
T1PA311.875e-1121.35Phosphotyrosine-binding protein OS=Musca domestica... [more]
A0A1I8M9412.720e-1121.35SH3 domain-containing protein OS=Musca domestica O... [more]
A0A0P4W5F07.638e-1123.45SH3 domain-containing protein OS=Scylla olivacea O... [more]
A0A0P4VXZ29.367e-1123.45SH3 domain-containing protein OS=Scylla olivacea O... [more]
back to top
BLAST of SMED30031822 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eps8l21.915e-1028.75EPS8 like 2 [Source:NCBI gene;Acc:103026465][more]
eps8l22.048e-1028.75EPS8 like 2 [Source:NCBI gene;Acc:103026465][more]
eps8l22.095e-1028.75EPS8 like 2 [Source:NCBI gene;Acc:103026465][more]
eps8l1a4.326e-1033.33eps8 like 1a [Source:ZFIN;Acc:ZDB-GENE-050306-14][more]
eps8a1.325e-725.16epidermal growth factor receptor pathway substrate... [more]
back to top
BLAST of SMED30031822 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000010635.12.880e-1032.67pep scaffold:Pmarinus_7.0:GL476906:83540:115491:1 ... [more]
back to top
BLAST of SMED30031822 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30031822 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30031822 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EPS8L22.398e-1129.33EPS8 like 2 [Source:NCBI gene;Acc:101169604][more]
EPS8L22.400e-1129.33EPS8 like 2 [Source:NCBI gene;Acc:101169604][more]
EPS8L22.973e-1129.33EPS8 like 2 [Source:NCBI gene;Acc:101169604][more]
eps8l1b1.186e-830.00epidermal growth factor receptor kinase substrate ... [more]
eps8l1b1.609e-830.00epidermal growth factor receptor kinase substrate ... [more]
back to top
BLAST of SMED30031822 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000077258.10.000e+098.66SMESG000077258.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031822 ID=SMED30031822|Name=SMED30031822|organism=Schmidtea mediterranea sexual|type=transcript|length=2052bp
AATTTACAAAAATATTTCAAGTAGACGTTAAAGAAAAAATAAAATGACGA
GTGCTAAAACTACCAAAAAAAAGTCAGAAAAAAATGTAAAGAAAATTGCT
AGATTTAACGTGGATGTATTAGCAGTTTATATATCAGAAGATGAAACTCC
AGTTCCAATGTCAGAAGCTTTTAATTTATTAAAACAACGCTTAGCCAGTA
AAACTCCGCCTAAGTTCGAAAGATGTATTATGCAAATTTGGAACAAAAAT
CACGAAACCTTTAGTATTGTTTTCAAATCCAAAGAAAAAAATAAGGTGTT
AGAAACCATTGACATAAACTCAATGGGAAACCCATCTTGCAGTGAAATAC
CAATTGGAAATTACGAAAGACAAAGTTTAGTTTTTCTACCGCTGTTAAAC
AAAAATAATGTTGCTGAACTTTTTATAATTCATCCTAACAGCGTTACTTC
TCAAGACGTAGTTTTGAAACTTTCAAGGTTGCTAGAATACCGACTAAATC
CAAGTCCCAACTCTAAACCAAATGAACATGAAAGCATTCATTCACTAAAT
CTTGGAAACACTTATACATCAAAATCCAAAGACAATGGAAGCGTTCACAC
TAGAAATATGGATAATAGTTTGAGATCAAAACCAAGGGAGAATGGAAATT
TCTATACATTAAACTATGAATCAAAAGAAAATAATGATAGAAGTGACACG
AAAAGTATCTATAGCATATCCTCGAATTTTATTAACAATTGGTATGGAAA
ATTGGACTCTGTCAACACTCTTCAACCGAATTCTCTGTCACCTCTAGCCA
GTATAAACGAAGAACTTCATTTATTGAATACCCACCTTAAAGAGATTCGA
CACTTCATGAATGAGATGTTCAAATTGATATATAATGCAGTGCAAGAAAA
GAAAAGAAAATTACAAGAAAACTATAATAGAAATGAACCTCAACCTCAAA
TTGTACATCTTCCATCAAAATTAGAATTCATAGAAACTGTAGAAAAAATT
AAAACCTGCCTTAATTTGGCAGCTGCTCACAGAGAAATAATTACCAATCC
CTCCTCTGAAGAGATAATAAATCAATTATTTATTTATTTAAGAATATTAG
CAGATGCAACCATCAACCATTCAACCGGAAAATCGGATTTAGTGATTGGC
ATCAAAAATCCCCAAATCAATTCGAGCACTGTGAAATTTCTTACGAATCA
TTTAAACGCAGAAAACACAAAATTCTGGATAATTCTTGGATTCAATTTCG
GTTTCATAAGGGGGAGTTCTCTGAGCCACAGCAGTAGAAATCCAATTGAT
GAATTTGAAATTAAAGAAATTTCTAATATTCATGAATATGAACAAAAACA
TCACTCCTTTACACTTCAGCGGCAATTTCAGTCGAACAACCGCTATATGA
GTGCGGATTCGATTCATGAACATGAATATGTTACTCCAAACAGCGGAACA
AAAAATCGAAGGTATGATAATTCTCGAGAAAGTCCGGTTCCTCTTATTAG
CAGTGATTTGATATACCGAAGTTTTCCTAGACTTTATGAGCCATTGAAAA
AAGAAACACCTTTCTATGAAACTGAAAATTTTCAATATCAGAATGTTCCA
TCCCATTCTCCCAATAATAATTGTTATGCTCATTCTAACAATTGTACATG
GGATGACCGACAGTGCCGATTTATAGATGCTGTTCGACTCAGAAACGGAA
GAATTGGAAAGGTTCTTTATGACAGATCGGTTCAGAATTACCGAGAATTG
GGGGTCAGCAGCAATGAGATCGTGGAAATTCTGAGAGATCATGGTGAAAT
GTTATCAGTGAAAAATGCCCTTGGTGAAATCGGAGAATGTCCAAAAGCTA
TCATCTCGGAAATACAAAATAATTATGTGAATTAATTTAGTATTTTGCTA
AATGCCAGTTTCAAAATTTAATATCAAAACAAAACGAAAGTGAAACTTTT
TATTTTAGTTTCAAATAACAATATTTCGGTGGCAGAAAATATCGATTTTA
TGCGATACATTTTTTTATTTTAATAAAATAAATTATATAATTGTAAAAAA
AA
back to top

protein sequence of SMED30031822-orf-1

>SMED30031822-orf-1 ID=SMED30031822-orf-1|Name=SMED30031822-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=614bp
MTSAKTTKKKSEKNVKKIARFNVDVLAVYISEDETPVPMSEAFNLLKQRL
ASKTPPKFERCIMQIWNKNHETFSIVFKSKEKNKVLETIDINSMGNPSCS
EIPIGNYERQSLVFLPLLNKNNVAELFIIHPNSVTSQDVVLKLSRLLEYR
LNPSPNSKPNEHESIHSLNLGNTYTSKSKDNGSVHTRNMDNSLRSKPREN
GNFYTLNYESKENNDRSDTKSIYSISSNFINNWYGKLDSVNTLQPNSLSP
LASINEELHLLNTHLKEIRHFMNEMFKLIYNAVQEKKRKLQENYNRNEPQ
PQIVHLPSKLEFIETVEKIKTCLNLAAAHREIITNPSSEEIINQLFIYLR
ILADATINHSTGKSDLVIGIKNPQINSSTVKFLTNHLNAENTKFWIILGF
NFGFIRGSSLSHSSRNPIDEFEIKEISNIHEYEQKHHSFTLQRQFQSNNR
YMSADSIHEHEYVTPNSGTKNRRYDNSRESPVPLISSDLIYRSFPRLYEP
LKKETPFYETENFQYQNVPSHSPNNNCYAHSNNCTWDDRQCRFIDAVRLR
NGRIGKVLYDRSVQNYRELGVSSNEIVEILRDHGEMLSVKNALGEIGECP
KAIISEIQNNYVN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR039801EPS8-like
Vocabulary: molecular function
TermDefinition
GO:0003779actin binding
GO:0035591signaling adaptor activity
GO:0048365Rac GTPase binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005886plasma membrane
GO:0005903brush border
GO:0005938cell cortex
GO:0014069postsynaptic density
GO:0016020membrane
GO:0017146NMDA selective glutamate receptor complex
GO:0030054cell junction
GO:0030426growth cone
GO:0031982vesicle
GO:0032420stereocilium
GO:0032587ruffle membrane
GO:0042995cell projection
GO:0043005neuron projection
GO:0045202synapse
GO:0070062extracellular exosome
Vocabulary: biological process
TermDefinition
GO:0008344adult locomotory behavior
GO:0008360regulation of cell shape
GO:0009967positive regulation of signal transduction
GO:0010458exit from mitosis
GO:0016601Rac protein signal transduction
GO:0030832regulation of actin filament length
GO:0031532actin cytoskeleton reorganization
GO:0036336dendritic cell migration
GO:0048149behavioral response to ethanol
GO:0051016barbed-end actin filament capping
GO:0051017actin filament bundle assembly
GO:0051764actin crosslink formation
GO:0070358actin polymerization-dependent cell motility
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:2.30.30.40coord: 550..611
e-value: 9.0E-6
score: 27.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 155..201
IPR039801Epidermal growth factor receptor kinase substrate 8-likePANTHERPTHR12287EPIDERMAL GROWTH FACTOR RECEPTOR KINASE SUBSTRATE EPS8-RELATED PROTEINcoord: 240..608