C-Jun-amino-terminal kinase-interacting protein 4

Overview
NameC-Jun-amino-terminal kinase-interacting protein 4
Smed IDSMED30031818
Length (bp)3240
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of C-Jun-amino-terminal kinase-interacting protein 4 (SMED30031818) t-SNE clustered cells

Violin plots show distribution of expression levels for C-Jun-amino-terminal kinase-interacting protein 4 (SMED30031818) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of C-Jun-amino-terminal kinase-interacting protein 4 (SMED30031818) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for C-Jun-amino-terminal kinase-interacting protein 4 (SMED30031818) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031818

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30031818h1SMcG0019249 Contig55900newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031818h1SMcG0019249 Contig55900uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
protonephridiaSMED30031818h1SMcG0019248 dd_Smed_v4_4531_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30031818h1SMcG0019248 dd_Smed_v4_4531_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30031818h1SMcG0019248 dd_Smed_v4_4531_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30031818h1SMcG0019248 dd_Smed_v4_4531_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031818h1SMcG0019248 Contig55900newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031818h1SMcG0019248 Contig55900uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30031818h1SMcG0019248 dd_Smed_v4_4531_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. Ensembl Human
Match: MAPK8IP3 (mitogen-activated protein kinase 8 interacting protein 3 [Source:HGNC Symbol;Acc:HGNC:6884])

HSP 1 Score: 113.235 bits (282), Expect = 1.469e-24
Identity = 78/253 (30.83%), Postives = 127/253 (50.20%), Query Frame = 2
Query:  899 SNDHW--MTDCCDGETDCNQVHSNNL----KNPSQFDSSSSYFMDPQDLSQRMNRDHSLETNIVDSDTD------VTDDEFGIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREELRRHSNREADLKGKLAHLEQELKICKEKLIDSQAXXXXXX----------------XXQKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFPEFRESSKPMKAQNSGIWNLFNNLF 1573
            S+D W  + D  D   + +      L     +P+Q   + ++ ++   L   ++   S     VD   D      V DD FG+G+E+  ++ EN  L+ TKNALN+VK+DLI ++D ++ E ++LR EL      +  L+ ++  LE+ELK  K + I ++      +                 +++ F+R EMA +L E+N YKE+LMELQ+AV + EM R  ++ P  +E  K      S IW  F+ LF
Sbjct:  334 SSDEWSDVQDIIDSTPELDMCPETRLDRTGSSPTQGIVNKAFGINTDSLYHELSTAGSEVIGDVDEGADLLGEFSVRDDFFGMGKEVGNLLLENSQLLETKNALNVVKNDLIAKVDQLSGEQEVLRGELEAAKQAKVKLENRIKELEEELKRVKSEAIIARREPKEEAEDVSSYLCTESDKIPMAQRRRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASREHPSVQEKKK------STIWQFFSRLF 580          

HSP 2 Score: 93.2041 bits (230), Expect = 2.191e-18
Identity = 68/159 (42.77%), Postives = 109/159 (68.55%), Query Frame = 2
Query:  149 MTEKVQILANKIYKEFERLISFYGSDVVEYLMPXXXXXXXXXXXXYRDKHTYEIDVELLKEDNCTLNRQYEREKYLKKQSEERVIHXXXXXXXXXXXXXXXXXXXXSSNRTFEVKFRNANETVSRLEEKVEFLKIENQKIYERYTDVLKSHAEQLNKIK 625
            M+E+V  LA  IY+EFERLI  Y  +VV+ LMPL+VN+LENL+ +  +   +E+++ELL+EDN  L  QYEREK L++Q+EE+ I  E A E+EKK L+ ++   E   R  E+K +N  + +SRLEE+   +K E   +++R+T++++++ E + + K
Sbjct:   25 MSERVSGLAGSIYREFERLIHCYDEEVVKELMPLVVNVLENLDSVLSENQEHEVELELLREDNEQLLTQYEREKALRRQAEEKFIEFEDALEQEKKELQIQVEHYEFQTRQLELKAKNYADQISRLEERESEMKKEYNALHQRHTEMIQTYVEHIERSK 183          
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. Ensembl Human
Match: MAPK8IP3 (mitogen-activated protein kinase 8 interacting protein 3 [Source:HGNC Symbol;Acc:HGNC:6884])

HSP 1 Score: 113.235 bits (282), Expect = 1.508e-24
Identity = 78/253 (30.83%), Postives = 127/253 (50.20%), Query Frame = 2
Query:  899 SNDHW--MTDCCDGETDCNQVHSNNL----KNPSQFDSSSSYFMDPQDLSQRMNRDHSLETNIVDSDTD------VTDDEFGIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREELRRHSNREADLKGKLAHLEQELKICKEKLIDSQAXXXXXX----------------XXQKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFPEFRESSKPMKAQNSGIWNLFNNLF 1573
            S+D W  + D  D   + +      L     +P+Q   + ++ ++   L   ++   S     VD   D      V DD FG+G+E+  ++ EN  L+ TKNALN+VK+DLI ++D ++ E ++LR EL      +  L+ ++  LE+ELK  K + I ++      +                 +++ F+R EMA +L E+N YKE+LMELQ+AV + EM R  ++ P  +E  K      S IW  F+ LF
Sbjct:  335 SSDEWSDVQDIIDSTPELDMCPETRLDRTGSSPTQGIVNKAFGINTDSLYHELSTAGSEVIGDVDEGADLLGEFSVRDDFFGMGKEVGNLLLENSQLLETKNALNVVKNDLIAKVDQLSGEQEVLRGELEAAKQAKVKLENRIKELEEELKRVKSEAIIARREPKEEAEDVSSYLCTESDKIPMAQRRRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASREHPSVQEKKK------STIWQFFSRLF 581          

HSP 2 Score: 92.8189 bits (229), Expect = 2.229e-18
Identity = 68/159 (42.77%), Postives = 109/159 (68.55%), Query Frame = 2
Query:  149 MTEKVQILANKIYKEFERLISFYGSDVVEYLMPXXXXXXXXXXXXYRDKHTYEIDVELLKEDNCTLNRQYEREKYLKKQSEERVIHXXXXXXXXXXXXXXXXXXXXSSNRTFEVKFRNANETVSRLEEKVEFLKIENQKIYERYTDVLKSHAEQLNKIK 625
            M+E+V  LA  IY+EFERLI  Y  +VV+ LMPL+VN+LENL+ +  +   +E+++ELL+EDN  L  QYEREK L++Q+EE+ I  E A E+EKK L+ ++   E   R  E+K +N  + +SRLEE+   +K E   +++R+T++++++ E + + K
Sbjct:   25 MSERVSGLAGSIYREFERLIHCYDEEVVKELMPLVVNVLENLDSVLSENQEHEVELELLREDNEQLLTQYEREKALRRQAEEKFIEFEDALEQEKKELQIQVEHYEFQTRQLELKAKNYADQISRLEERESEMKKEYNALHQRHTEMIQTYVEHIERSK 183          
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. Ensembl Human
Match: MAPK8IP3 (mitogen-activated protein kinase 8 interacting protein 3 [Source:HGNC Symbol;Acc:HGNC:6884])

HSP 1 Score: 113.235 bits (282), Expect = 1.591e-24
Identity = 78/253 (30.83%), Postives = 127/253 (50.20%), Query Frame = 2
Query:  899 SNDHW--MTDCCDGETDCNQVHSNNL----KNPSQFDSSSSYFMDPQDLSQRMNRDHSLETNIVDSDTD------VTDDEFGIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREELRRHSNREADLKGKLAHLEQELKICKEKLIDSQAXXXXXX----------------XXQKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFPEFRESSKPMKAQNSGIWNLFNNLF 1573
            S+D W  + D  D   + +      L     +P+Q   + ++ ++   L   ++   S     VD   D      V DD FG+G+E+  ++ EN  L+ TKNALN+VK+DLI ++D ++ E ++LR EL      +  L+ ++  LE+ELK  K + I ++      +                 +++ F+R EMA +L E+N YKE+LMELQ+AV + EM R  ++ P  +E  K      S IW  F+ LF
Sbjct:  342 SSDEWSDVQDIIDSTPELDMCPETRLDRTGSSPTQGIVNKAFGINTDSLYHELSTAGSEVIGDVDEGADLLGEFSVRDDFFGMGKEVGNLLLENSQLLETKNALNVVKNDLIAKVDQLSGEQEVLRGELEAAKQAKVKLENRIKELEEELKRVKSEAIIARREPKEEAEDVSSYLCTESDKIPMAQRRRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASREHPSVQEKKK------STIWQFFSRLF 588          

HSP 2 Score: 92.8189 bits (229), Expect = 2.253e-18
Identity = 68/159 (42.77%), Postives = 109/159 (68.55%), Query Frame = 2
Query:  149 MTEKVQILANKIYKEFERLISFYGSDVVEYLMPXXXXXXXXXXXXYRDKHTYEIDVELLKEDNCTLNRQYEREKYLKKQSEERVIHXXXXXXXXXXXXXXXXXXXXSSNRTFEVKFRNANETVSRLEEKVEFLKIENQKIYERYTDVLKSHAEQLNKIK 625
            M+E+V  LA  IY+EFERLI  Y  +VV+ LMPL+VN+LENL+ +  +   +E+++ELL+EDN  L  QYEREK L++Q+EE+ I  E A E+EKK L+ ++   E   R  E+K +N  + +SRLEE+   +K E   +++R+T++++++ E + + K
Sbjct:   25 MSERVSGLAGSIYREFERLIHCYDEEVVKELMPLVVNVLENLDSVLSENQEHEVELELLREDNEQLLTQYEREKALRRQAEEKFIEFEDALEQEKKELQIQVEHYEFQTRQLELKAKNYADQISRLEERESEMKKEYNALHQRHTEMIQTYVEHIERSK 183          
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. Ensembl Human
Match: MAPK8IP3 (mitogen-activated protein kinase 8 interacting protein 3 [Source:HGNC Symbol;Acc:HGNC:6884])

HSP 1 Score: 110.538 bits (275), Expect = 9.133e-24
Identity = 74/247 (29.96%), Postives = 125/247 (50.61%), Query Frame = 2
Query:  899 SNDHW--MTDCCDGETDCNQVHSNNL----KNPSQFDSSSSYFMDPQDLSQRMNRDHSLETNIVDSDTDVTDDEFGIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREELRRHSNREADLKGKLAHLEQELKICKEKLIDSQAXXXXXX----------------XXQKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFPEFRESSKPMKAQNSGIWNLFNNLF 1573
            S+D W  + D  D   + +      L     +P+Q   + ++ ++   L   ++   S     VD   D+  +  G+G+E+  ++ EN  L+ TKNALN+VK+DLI ++D ++ E ++LR EL      +  L+ ++  LE+ELK  K + I ++      +                 +++ F+R EMA +L E+N YKE+LMELQ+AV + EM R  ++ P  +E  K      S IW  F+ LF
Sbjct:  334 SSDEWSDVQDIIDSTPELDMCPETRLDRTGSSPTQGIVNKAFGINTDSLYHELSTAGSEVIGDVDEGADLLGEFSGMGKEVGNLLLENSQLLETKNALNVVKNDLIAKVDQLSGEQEVLRGELEAAKQAKVKLENRIKELEEELKRVKSEAIIARREPKEEAEDVSSYLCTESDKIPMAQRRRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASREHPSVQEKKK------STIWQFFSRLF 574          

HSP 2 Score: 92.8189 bits (229), Expect = 2.340e-18
Identity = 68/159 (42.77%), Postives = 109/159 (68.55%), Query Frame = 2
Query:  149 MTEKVQILANKIYKEFERLISFYGSDVVEYLMPXXXXXXXXXXXXYRDKHTYEIDVELLKEDNCTLNRQYEREKYLKKQSEERVIHXXXXXXXXXXXXXXXXXXXXSSNRTFEVKFRNANETVSRLEEKVEFLKIENQKIYERYTDVLKSHAEQLNKIK 625
            M+E+V  LA  IY+EFERLI  Y  +VV+ LMPL+VN+LENL+ +  +   +E+++ELL+EDN  L  QYEREK L++Q+EE+ I  E A E+EKK L+ ++   E   R  E+K +N  + +SRLEE+   +K E   +++R+T++++++ E + + K
Sbjct:   25 MSERVSGLAGSIYREFERLIHCYDEEVVKELMPLVVNVLENLDSVLSENQEHEVELELLREDNEQLLTQYEREKALRRQAEEKFIEFEDALEQEKKELQIQVEHYEFQTRQLELKAKNYADQISRLEERESEMKKEYNALHQRHTEMIQTYVEHIERSK 183          
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. Ensembl Human
Match: SPAG9 (sperm associated antigen 9 [Source:HGNC Symbol;Acc:HGNC:14524])

HSP 1 Score: 98.5969 bits (244), Expect = 3.695e-20
Identity = 88/326 (26.99%), Postives = 150/326 (46.01%), Query Frame = 2
Query: 1076 SDTDVTDDEFGIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREELRRHSNREADLKGKLAHLEQELKICKEKLIDSQAXXXXX--------XXXQKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFPEFRE--------------------SSKP------------------MKAQNSGIWNLFN------NLFKKEDELSI-----QMKEKSKSLLSRFKRESDRSQLYSWSVPR-------SLVESELPKRIPIPIKIQTIFEPKDIVICATTGYGSTVGNDSAQYLWCLIQSNTKNNKN 1861
             D D   D  G+GRE++ +I EN  L+ TKNALNIVK+DLI ++D +T E D+L+ EL   + ++A LK +  + E E ++ K +     A +           + ++K F+R EMA +L E+N YKE+LMELQ+AV + EM R  ++ P  +E                    + KP                  +K ++S +  L        +   +E E S+     Q +E+ + + +  ++E  R Q + WS+P+          E+++ K +P+P+ ++ + E                  D++  LWC +  N    K 
Sbjct:  238 GDVDEGADLLGMGREVENLILENTQLLETKNALNIVKNDLIAKVDELTCEKDVLQGEL--EAVKQAKLKLEEKNRELEEELRKARAEAEDARQKAKDDDDSDIPTAQRKRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASRENPAMQEKKRSSIWQFFSRLFSSSSNTTKKPEPPVNLKYNAPTSHVTPSVKKRSSTLSQLPGDKSKAFDFLSEETEASLASRREQKREQYRQVKAHVQKEDGRVQAFGWSLPQKYKQVTNGQGENKM-KNLPVPVYLRPLDE-----------------KDTSMKLWCAVGVNLSGGKT 543          
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. Ensembl Celegans
Match: unc-16 (JNK-interacting protein [Source:UniProtKB/Swiss-Prot;Acc:P34609])

HSP 1 Score: 180.644 bits (457), Expect = 6.046e-46
Identity = 181/593 (30.52%), Postives = 310/593 (52.28%), Query Frame = 2
Query:  149 MTEKVQILANKIYKEFERLISFYGSDVVEYLMPXXXXXXXXXXXXY--RDKHTYEIDVELLKEDNCTLNRQYEREKYLKKQSEERVIHXXXXXXXXXXXXXXXXXXXXSSNRTFEVKFRNANETVSRLEEKVEFLKIENQKIYERYTDVLKSHAEQLNKIKA-------ETCRDISPPFSLSIRDLENRSTKSLIRDLRLKNNIQNSVIIPNKLLDPEHSNPDLNHLHDENFDIFDEKNXXXXXXXXXXHQGETVADILSNDHWMTDCCDGETDCNQVHSNNLKNPSQFDSSSSYFMDPQDLSQRMNRDHSLETNIVDSD---TDVTDDEFGIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREE-LRRHSNREADLKGKLAHLEQELKICKEKLID---SQAXXXXXXXXQKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFPEFRESSKPMKAQNSGIWNLFNNLFKK--------------------------------EDELSIQMKEKSKSLLSRFKRESDRSQLYSWSVPRSLVESELPKRIPIPIKIQTIF--EPKDIVICAT 1777
            M++KVQ +A+ IY+E E +I  +G D V+ LMPL+VN+LE L+  Y  RD+ T E+  E+LKEDN  L  QYEREK L+KQ+E++ I IE     + K L++KI  LES  R  E+K +NA +  SRLEE+    K+E  +++ERY  +L++H + + + K        E  +++  P ++ +R+    +       +R  +++ ++ +  +  +D   +N      H  N D  DE +   + S     Q  + AD L      T     +    +  + + K   + ++  +  +DP++ +  +  D  L  N+VD     + V D   G+GRE++ +I+EN +L+  KNALNIVK+DLIN++D + +EN +LR+E L R    E  ++ ++   E+E+K  K+KL++    Q  ++     +K F+RSEM  +L ++N YKEKLMEL++++ + EM R KK     ++     + ++ GIW  F++L                                    +  + + +E+ K +    K+E  R + Y WS+P   VE+E+   +PIP+  + +   EP   + CAT
Sbjct:    1 MSDKVQTMASAIYRELETMIKVHGEDGVKTLMPLVVNVLEALDLAYLERDEQTAEL--EMLKEDNEQLQTQYEREKALRKQTEQKYIEIEDTLIGQNKELDKKIESLESIMRMLELKAKNATDHASRLEEREVEQKLEFDRLHERYNTLLRTHVDHMERTKYLMGSEKFELMQNMPLP-NMQLRNKMGMAASVDASSIRGVSDLISAHMTQSTTMDVNLAN------HITNEDWQDEFSSDIEPSPRDIPQ--SSADAL------TSPITTKEPTPKREAASPKQSEEEEADETTSVDPKENNDLLGAD--LTGNLVDPAEFASAVNDTFIGMGREVENLIKENSELLDMKNALNIVKNDLINQVDELNSENMILRDENLSRQMVSEK-MQEQITKHEEEIKTLKQKLMEKENEQEEDDVPMAMRKRFTRSEMQRVLMDRNAYKEKLMELEESIKWTEMQRAKKM---QQQQQNVNQKKSGGIWEFFSSLLGDSVTPPASSRGNRASSSRGKMTRSVEYIDPDMISERRAAERREQYKLVREHVKKEDGRIEAYGWSLPN--VEAEV-SSVPIPVCCRPLLDNEPSLKIWCAT 567          
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. Ensembl Celegans
Match: unc-16 (JNK-interacting protein [Source:UniProtKB/Swiss-Prot;Acc:P34609])

HSP 1 Score: 170.244 bits (430), Expect = 1.279e-44
Identity = 157/492 (31.91%), Postives = 267/492 (54.27%), Query Frame = 2
Query:  149 MTEKVQILANKIYKEFERLISFYGSDVVEYLMPXXXXXXXXXXXXY--RDKHTYEIDVELLKEDNCTLNRQYEREKYLKKQSEERVIHXXXXXXXXXXXXXXXXXXXXSSNRTFEVKFRNANETVSRLEEKVEFLKIENQKIYERYTDVLKSHAEQLNKIKAETCRDISPPFSLSIRDLENRSTKSLIRDLRLKNNIQNSVIIPNKLLDPEHSNPDLNHLHDENFDIFDEKNXXXXXXXXXXHQGETVADILSNDHWM----TDCCDGETDCNQVHSNNLKNP-------SQFDSSSSYFMDPQDLSQRMNRDHSLETNIVDSDTDVTDDEFGIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREE-LRRHSNREADLKGKLAHLEQELKICKEKLID---SQAXXXXXXXXQKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFPEFRESSKPMKAQNSGIWNLFNNLF 1573
            M++KVQ +A+ IY+E E +I  +G D V+ LMPL+VN+LE L+  Y  RD+ T E+  E+LKEDN  L  QYEREK L+KQ+E++ I IE     + K L++KI  LES  R  E+K +NA +  SRLEE+    K+E  +++ERY  +L++H + + + K       S  F L    ++N      + +++L+N +  +  +    +       DL   H       D                  +A+ ++N+ W     +D      D  Q  ++ L +P        + +++S    + ++  +  + D     +++ +D  V D   G+GRE++ +I+EN +L+  KNALNIVK+DLIN++D + +EN +LR+E L R    E  ++ ++   E+E+K  K+KL++    Q  ++     +K F+RSEM  +L ++N YKEKLMEL++++ + EM R KK     ++     + ++ GIW  F++L 
Sbjct:   37 MSDKVQTMASAIYRELETMIKVHGEDGVKTLMPLVVNVLEALDLAYLERDEQTAEL--EMLKEDNEQLQTQYEREKALRKQTEQKYIEIEDTLIGQNKELDKKIESLESIMRMLELKAKNATDHASRLEEREVEQKLEFDRLHERYNTLLRTHVDHMERTKYLMG---SEKFEL----MQNMP----LPNMQLRNKMGMAASVDASSI---RGVSDLISAHMTQSTTMDV----------------NLANHITNEDWQDEFSSDIEPSPRDIPQSSADALTSPITTKEPTPKREAASPKQSEEEEADETTSVDPKENNDLLGADLTVNDTFIGMGREVENLIKENSELLDMKNALNIVKNDLINQVDELNSENMILRDENLSRQMVSEK-MQEQITKHEEEIKTLKQKLMEKENEQEEDDVPMAMRKRFTRSEMQRVLMDRNAYKEKLMELEESIKWTEMQRAKKM---QQQQQNVNQKKSGGIWEFFSSLL 492          
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. Ensembl Celegans
Match: unc-16 (JNK-interacting protein [Source:UniProtKB/Swiss-Prot;Acc:P34609])

HSP 1 Score: 169.474 bits (428), Expect = 3.024e-44
Identity = 161/491 (32.79%), Postives = 274/491 (55.80%), Query Frame = 2
Query:  149 MTEKVQILANKIYKEFERLISFYGSDVVEYLMPXXXXXXXXXXXXY--RDKHTYEIDVELLKEDNCTLNRQYEREKYLKKQSEERVIHXXXXXXXXXXXXXXXXXXXXSSNRTFEVKFRNANETVSRLEEKVEFLKIENQKIYERYTDVLKSHAEQLNKIKA-------ETCRDISPPFSLSIRDLENRSTKSLIRDLRLKNNIQNSVIIPNKLLDPEHSNPDLNHLHDENFDIFDEKNXXXXXXXXXXHQGETVADILSNDHWMTDCCDGETDCNQVHSNNLKNPSQFDSSSSYFMDPQDLSQRMNRDHSLETNIVDSD---TDVTDDEFGIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREE-LRRHSNREADLKGKLAHLEQELKICKEKLID---SQAXXXXXXXXQKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFPEFRESSKPMKAQNSGIWNLFNNLF 1573
            M++KVQ +A+ IY+E E +I  +G D V+ LMPL+VN+LE L+  Y  RD+ T E+  E+LKEDN  L  QYEREK L+KQ+E++ I IE     + K L++KI  LES  R  E+K +NA +  SRLEE+    K+E  +++ERY  +L++H + + + K        E  +++  P ++ +R+    +       +R  +++ ++ +  +  +D   +N      H  N D  DE +   + S     Q  + AD L      T     +    +  + + K   + ++  +  +DP++ +  +  D  L  N+VD     + V D   G+GRE++ +I+EN +L+  KNALNIVK+DLIN++D + +EN +LR+E L R    E  ++ ++   E+E+K  K+KL++    Q  ++     +K F+RSEM  +L ++N YKEKLMEL++++ + EM R KK     ++     + ++ GIW  F++L 
Sbjct:   37 MSDKVQTMASAIYRELETMIKVHGEDGVKTLMPLVVNVLEALDLAYLERDEQTAEL--EMLKEDNEQLQTQYEREKALRKQTEQKYIEIEDTLIGQNKELDKKIESLESIMRMLELKAKNATDHASRLEEREVEQKLEFDRLHERYNTLLRTHVDHMERTKYLMGSEKFELMQNMPLP-NMQLRNKMGMAASVDASSIRGVSDLISAHMTQSTTMDVNLAN------HITNEDWQDEFSSDIEPSPRDIPQ--SSADAL------TSPITTKEPTPKREAASPKQSEEEEADETTSVDPKENNDLLGAD--LTGNLVDPAEFASAVNDTFIGMGREVENLIKENSELLDMKNALNIVKNDLINQVDELNSENMILRDENLSRQMVSEK-MQEQITKHEEEIKTLKQKLMEKENEQEEDDVPMAMRKRFTRSEMQRVLMDRNAYKEKLMELEESIKWTEMQRAKKM---QQQQQNVNQKKSGGIWEFFSSLL 504          
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. Ensembl Celegans
Match: unc-16 (JNK-interacting protein [Source:UniProtKB/Swiss-Prot;Acc:P34609])

HSP 1 Score: 166.392 bits (420), Expect = 3.130e-43
Identity = 161/491 (32.79%), Postives = 273/491 (55.60%), Query Frame = 2
Query:  149 MTEKVQILANKIYKEFERLISFYGSDVVEYLMPXXXXXXXXXXXXY--RDKHTYEIDVELLKEDNCTLNRQYEREKYLKKQSEERVIHXXXXXXXXXXXXXXXXXXXXSSNRTFEVKFRNANETVSRLEEKVEFLKIENQKIYERYTDVLKSHAEQLNKIKA-------ETCRDISPPFSLSIRDLENRSTKSLIRDLRLKNNIQNSVIIPNKLLDPEHSNPDLNHLHDENFDIFDEKNXXXXXXXXXXHQGETVADILSNDHWMTDCCDGETDCNQVHSNNLKNPSQFDSSSSYFMDPQDLSQRMNRDHSLETNIVDSDTDVTDDEF---GIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREE-LRRHSNREADLKGKLAHLEQELKICKEKLID---SQAXXXXXXXXQKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFPEFRESSKPMKAQNSGIWNLFNNLF 1573
            M++KVQ +A+ IY+E E +I  +G D V+ LMPL+VN+LE L+  Y  RD+ T E+  E+LKEDN  L  QYEREK L+KQ+E++ I IE     + K L++KI  LES  R  E+K +NA +  SRLEE+    K+E  +++ERY  +L++H + + + K        E  +++  P ++ +R+    +       +R  +++ ++ +  +  +D   +N      H  N D  DE +   + S     Q  + AD L      T     +    +  + + K   + ++  +  +DP++ +  +  D  L  N+VD        EF   G+GRE++ +I+EN +L+  KNALNIVK+DLIN++D + +EN +LR+E L R    E  ++ ++   E+E+K  K+KL++    Q  ++     +K F+RSEM  +L ++N YKEKLMEL++++ + EM R KK     ++     + ++ GIW  F++L 
Sbjct:   37 MSDKVQTMASAIYRELETMIKVHGEDGVKTLMPLVVNVLEALDLAYLERDEQTAEL--EMLKEDNEQLQTQYEREKALRKQTEQKYIEIEDTLIGQNKELDKKIESLESIMRMLELKAKNATDHASRLEEREVEQKLEFDRLHERYNTLLRTHVDHMERTKYLMGSEKFELMQNMPLP-NMQLRNKMGMAASVDASSIRGVSDLISAHMTQSTTMDVNLAN------HITNEDWQDEFSSDIEPSPRDIPQ--SSADAL------TSPITTKEPTPKREAASPKQSEEEEADETTSVDPKENNDLLGAD--LTGNLVDPA------EFASAGMGREVENLIKENSELLDMKNALNIVKNDLINQVDELNSENMILRDENLSRQMVSEK-MQEQITKHEEEIKTLKQKLMEKENEQEEDDVPMAMRKRFTRSEMQRVLMDRNAYKEKLMELEESIKWTEMQRAKKM---QQQQQNVNQKKSGGIWEFFSSLL 498          
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. Ensembl Celegans
Match: unc-16 (JNK-interacting protein [Source:UniProtKB/Swiss-Prot;Acc:P34609])

HSP 1 Score: 109.768 bits (273), Expect = 3.762e-24
Identity = 84/268 (31.34%), Postives = 142/268 (52.99%), Query Frame = 2
Query: 1088 VTDDEFGIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREE-LRRHSNREADLKGKLAHLEQELKICKEKLID---SQAXXXXXXXXQKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFPEFRESSKPMKAQNSGIWNLFNNLFKK--------------------------------EDELSIQMKEKSKSLLSRFKRESDRSQLYSWSVPRSLVESELPKRIPIPIKIQTIF--EPKDIVICAT 1777
            V D   G+GRE++ +I+EN +L+  KNALNIVK+DLIN++D + +EN +LR+E L R    E  ++ ++   E+E+K  K+KL++    Q  ++     +K F+RSEM  +L ++N YKEKLMEL++++ + EM R KK     ++     + ++ GIW  F++L                                    +  + + +E+ K +    K+E  R + Y WS+P   VE+E+   +PIP+  + +   EP   + CAT
Sbjct:   14 VNDTFIGMGREVENLIKENSELLDMKNALNIVKNDLINQVDELNSENMILRDENLSRQMVSE-KMQEQITKHEEEIKTLKQKLMEKENEQEEDDVPMAMRKRFTRSEMQRVLMDRNAYKEKLMELEESIKWTEMQRAKKM---QQQQQNVNQKKSGGIWEFFSSLLGDSVTPPASSRGNRASSSRGKMTRSVEYIDPDMISERRAAERREQYKLVREHVKKEDGRIEAYGWSLPN--VEAEV-SSVPIPVCCRPLLDNEPSLKIWCAT 274          
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. Ensembl Fly
Match: syd (gene:FBgn0024187 transcript:FBtr0076768)

HSP 1 Score: 118.627 bits (296), Expect = 1.568e-26
Identity = 68/167 (40.72%), Postives = 101/167 (60.48%), Query Frame = 2
Query: 1082 TDVTDDEFGIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREELRRHSNREADLKGKLAHLEQELKICKEKLIDS---QAXXXXXXXXQKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFPEFRESSKPMKAQNSGIWNLFNNLF 1573
            +   D+ FG+G+E++ +I EN +L+ATKNALNIVKDDLI ++D +T E +++REEL         L+ +++ LE ELK  KE++      Q   +    ++K F+R EMA++L E+N YKE+LMELQ+AV   E+ R  +        SK        IW  F+NLF
Sbjct:  353 SSANDNYFGMGKEVENLIMENNELLATKNALNIVKDDLIVKVDELTGEVEIVREELNAMQQSRTKLRQRISELEDELKKAKEQVKQQNTEQEENDVPLAQRKRFTRVEMAMVLMERNQYKERLMELQEAVRLTEILRASRTVDNLDRKSK------QSIWKYFSNLF 513          

HSP 2 Score: 100.908 bits (250), Expect = 3.476e-21
Identity = 72/155 (46.45%), Postives = 104/155 (67.10%), Query Frame = 2
Query:  161 VQILANKIYKEFERLISFYGSDVVEYLMPXXXXXXXXXXXXYRDKHTYEIDVELLKEDNCTLNRQYEREKYLKKQSEERVIHXXXXXXXXXXXXXXXXXXXXSSNRTFEVKFRNANETVSRLEEKVEFLKIENQKIYERYTDVLKSHAEQLNKIK 625
            VQ LA  IY+EFER+I+ Y  DVV+ LMPL+VN+LE L+  YR     +++VELL+EDN  L  QYEREK  +KQSE++++  E   E+E K L  ++  +ES  R  E+K +N+ E  SRLEE+   LK E  K++ERYT++ K+H + + + K
Sbjct:   42 VQQLAGSIYQEFERMINRYDEDVVKNLMPLLVNVLECLDASYRINQEQDVEVELLREDNEQLVTQYEREKSARKQSEQKLLEAEDLAEQENKELATRLESVESIVRMLELKHKNSLEHASRLEEREADLKKEYNKLHERYTELFKNHVDYMERTK 196          
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. Ensembl Fly
Match: syd (gene:FBgn0024187 transcript:FBtr0076769)

HSP 1 Score: 118.242 bits (295), Expect = 1.604e-26
Identity = 68/167 (40.72%), Postives = 101/167 (60.48%), Query Frame = 2
Query: 1082 TDVTDDEFGIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREELRRHSNREADLKGKLAHLEQELKICKEKLIDS---QAXXXXXXXXQKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFPEFRESSKPMKAQNSGIWNLFNNLF 1573
            +   D+ FG+G+E++ +I EN +L+ATKNALNIVKDDLI ++D +T E +++REEL         L+ +++ LE ELK  KE++      Q   +    ++K F+R EMA++L E+N YKE+LMELQ+AV   E+ R  +        SK        IW  F+NLF
Sbjct:  320 SSANDNYFGMGKEVENLIMENNELLATKNALNIVKDDLIVKVDELTGEVEIVREELNAMQQSRTKLRQRISELEDELKKAKEQVKQQNTEQEENDVPLAQRKRFTRVEMAMVLMERNQYKERLMELQEAVRLTEILRASRTVDNLDRKSK------QSIWKYFSNLF 480          

HSP 2 Score: 101.679 bits (252), Expect = 2.436e-21
Identity = 73/163 (44.79%), Postives = 107/163 (65.64%), Query Frame = 2
Query:  137 LNNGMTEKVQILANKIYKEFERLISFYGSDVVEYLMPXXXXXXXXXXXXYRDKHTYEIDVELLKEDNCTLNRQYEREKYLKKQSEERVIHXXXXXXXXXXXXXXXXXXXXSSNRTFEVKFRNANETVSRLEEKVEFLKIENQKIYERYTDVLKSHAEQLNKIK 625
            +N  +   VQ LA  IY+EFER+I+ Y  DVV+ LMPL+VN+LE L+  YR     +++VELL+EDN  L  QYEREK  +KQSE++++  E   E+E K L  ++  +ES  R  E+K +N+ E  SRLEE+   LK E  K++ERYT++ K+H + + + K
Sbjct:    1 MNEQVVSIVQQLAGSIYQEFERMINRYDEDVVKNLMPLLVNVLECLDASYRINQEQDVEVELLREDNEQLVTQYEREKSARKQSEQKLLEAEDLAEQENKELATRLESVESIVRMLELKHKNSLEHASRLEEREADLKKEYNKLHERYTELFKNHVDYMERTK 163          
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. Ensembl Fly
Match: syd (gene:FBgn0024187 transcript:FBtr0300412)

HSP 1 Score: 118.242 bits (295), Expect = 1.625e-26
Identity = 68/167 (40.72%), Postives = 101/167 (60.48%), Query Frame = 2
Query: 1082 TDVTDDEFGIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREELRRHSNREADLKGKLAHLEQELKICKEKLIDS---QAXXXXXXXXQKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFPEFRESSKPMKAQNSGIWNLFNNLF 1573
            +   D+ FG+G+E++ +I EN +L+ATKNALNIVKDDLI ++D +T E +++REEL         L+ +++ LE ELK  KE++      Q   +    ++K F+R EMA++L E+N YKE+LMELQ+AV   E+ R  +        SK        IW  F+NLF
Sbjct:  353 SSANDNYFGMGKEVENLIMENNELLATKNALNIVKDDLIVKVDELTGEVEIVREELNAMQQSRTKLRQRISELEDELKKAKEQVKQQNTEQEENDVPLAQRKRFTRVEMAMVLMERNQYKERLMELQEAVRLTEILRASRTVDNLDRKSK------QSIWKYFSNLF 513          

HSP 2 Score: 100.908 bits (250), Expect = 3.577e-21
Identity = 72/155 (46.45%), Postives = 104/155 (67.10%), Query Frame = 2
Query:  161 VQILANKIYKEFERLISFYGSDVVEYLMPXXXXXXXXXXXXYRDKHTYEIDVELLKEDNCTLNRQYEREKYLKKQSEERVIHXXXXXXXXXXXXXXXXXXXXSSNRTFEVKFRNANETVSRLEEKVEFLKIENQKIYERYTDVLKSHAEQLNKIK 625
            VQ LA  IY+EFER+I+ Y  DVV+ LMPL+VN+LE L+  YR     +++VELL+EDN  L  QYEREK  +KQSE++++  E   E+E K L  ++  +ES  R  E+K +N+ E  SRLEE+   LK E  K++ERYT++ K+H + + + K
Sbjct:   42 VQQLAGSIYQEFERMINRYDEDVVKNLMPLLVNVLECLDASYRINQEQDVEVELLREDNEQLVTQYEREKSARKQSEQKLLEAEDLAEQENKELATRLESVESIVRMLELKHKNSLEHASRLEEREADLKKEYNKLHERYTELFKNHVDYMERTK 196          
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. Ensembl Fly
Match: syd (gene:FBgn0024187 transcript:FBtr0332790)

HSP 1 Score: 118.242 bits (295), Expect = 1.674e-26
Identity = 68/167 (40.72%), Postives = 101/167 (60.48%), Query Frame = 2
Query: 1082 TDVTDDEFGIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREELRRHSNREADLKGKLAHLEQELKICKEKLIDS---QAXXXXXXXXQKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFPEFRESSKPMKAQNSGIWNLFNNLF 1573
            +   D+ FG+G+E++ +I EN +L+ATKNALNIVKDDLI ++D +T E +++REEL         L+ +++ LE ELK  KE++      Q   +    ++K F+R EMA++L E+N YKE+LMELQ+AV   E+ R  +        SK        IW  F+NLF
Sbjct:  346 SSANDNYFGMGKEVENLIMENNELLATKNALNIVKDDLIVKVDELTGEVEIVREELNAMQQSRTKLRQRISELEDELKKAKEQVKQQNTEQEENDVPLAQRKRFTRVEMAMVLMERNQYKERLMELQEAVRLTEILRASRTVDNLDRKSK------QSIWKYFSNLF 506          

HSP 2 Score: 107.457 bits (267), Expect = 4.083e-23
Identity = 77/165 (46.67%), Postives = 111/165 (67.27%), Query Frame = 2
Query:  131 ENLNNGMTEKVQILANKIYKEFERLISFYGSDVVEYLMPXXXXXXXXXXXXYRDKHTYEIDVELLKEDNCTLNRQYEREKYLKKQSEERVIHXXXXXXXXXXXXXXXXXXXXSSNRTFEVKFRNANETVSRLEEKVEFLKIENQKIYERYTDVLKSHAEQLNKIK 625
            E+ N  M+EKVQ LA  IY+EFER+I+ Y  DVV+ LMPL+VN+LE L+  YR     +++VELL+EDN  L  QYEREK  +KQSE++++  E   E+E K L  ++  +ES  R  E+K +N+ E  SRLEE+   LK E  K++ERYT++ K+H + + + K
Sbjct:   25 EDNNMVMSEKVQQLAGSIYQEFERMINRYDEDVVKNLMPLLVNVLECLDASYRINQEQDVEVELLREDNEQLVTQYEREKSARKQSEQKLLEAEDLAEQENKELATRLESVESIVRMLELKHKNSLEHASRLEEREADLKKEYNKLHERYTELFKNHVDYMERTK 189          
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. Ensembl Fly
Match: syd (gene:FBgn0024187 transcript:FBtr0332792)

HSP 1 Score: 118.242 bits (295), Expect = 1.735e-26
Identity = 68/167 (40.72%), Postives = 101/167 (60.48%), Query Frame = 2
Query: 1082 TDVTDDEFGIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREELRRHSNREADLKGKLAHLEQELKICKEKLIDS---QAXXXXXXXXQKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFPEFRESSKPMKAQNSGIWNLFNNLF 1573
            +   D+ FG+G+E++ +I EN +L+ATKNALNIVKDDLI ++D +T E +++REEL         L+ +++ LE ELK  KE++      Q   +    ++K F+R EMA++L E+N YKE+LMELQ+AV   E+ R  +        SK        IW  F+NLF
Sbjct:  346 SSANDNYFGMGKEVENLIMENNELLATKNALNIVKDDLIVKVDELTGEVEIVREELNAMQQSRTKLRQRISELEDELKKAKEQVKQQNTEQEENDVPLAQRKRFTRVEMAMVLMERNQYKERLMELQEAVRLTEILRASRTVDNLDRKSK------QSIWKYFSNLF 506          

HSP 2 Score: 107.457 bits (267), Expect = 4.195e-23
Identity = 77/165 (46.67%), Postives = 111/165 (67.27%), Query Frame = 2
Query:  131 ENLNNGMTEKVQILANKIYKEFERLISFYGSDVVEYLMPXXXXXXXXXXXXYRDKHTYEIDVELLKEDNCTLNRQYEREKYLKKQSEERVIHXXXXXXXXXXXXXXXXXXXXSSNRTFEVKFRNANETVSRLEEKVEFLKIENQKIYERYTDVLKSHAEQLNKIK 625
            E+ N  M+EKVQ LA  IY+EFER+I+ Y  DVV+ LMPL+VN+LE L+  YR     +++VELL+EDN  L  QYEREK  +KQSE++++  E   E+E K L  ++  +ES  R  E+K +N+ E  SRLEE+   LK E  K++ERYT++ K+H + + + K
Sbjct:   25 EDNNMVMSEKVQQLAGSIYQEFERMINRYDEDVVKNLMPLLVNVLECLDASYRINQEQDVEVELLREDNEQLVTQYEREKSARKQSEQKLLEAEDLAEQENKELATRLESVESIVRMLELKHKNSLEHASRLEEREADLKKEYNKLHERYTELFKNHVDYMERTK 189          
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. Ensembl Zebrafish
Match: mapk8ip3 (mitogen-activated protein kinase 8 interacting protein 3 [Source:ZFIN;Acc:ZDB-GENE-090303-6])

HSP 1 Score: 111.694 bits (278), Expect = 2.380e-24
Identity = 80/234 (34.19%), Postives = 124/234 (52.99%), Query Frame = 2
Query: 1088 VTDDEFGIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREELRRHSNREADLKGKLAHLEQELK-ICKEKLIDSQAXXXXXX-------------XXQKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFPEFRESSKPMKAQNSGIWNLFNNLFK--------KEDELSIQMKEKSKSLLSRFKRESDRSQLYSWSVPRSLVESELPKRIPI 1723
            V DD FG+G+E++ ++ EN+ L+ TKNALNIVK+DLI ++D +++E ++LREEL      +  +  ++  LE+ELK +  E L  SQ S++                 +++ F+R EMA +L E+N YKE+LMELQ+AV + EM R  ++ P   E  K +      IW  F  LF         K    S+ +  KS S     +R   RSQ        + +   LP+ +P+
Sbjct:  395 VRDDFFGMGKEVENLLTENKQLLETKNALNIVKNDLIAKVDELSSEQEVLREELESVKQSKTKVDQRVKELEEELKRLRAEALGASQDSKDEGGEDYSSPLQDDVTMTQRRRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASRESPPLPEKKKSI------IWQFFARLFSSSASPPPVKRPYTSVNIHYKSPSPAGYNQR---RSQTMCQISTSTCIREFLPEEMPV 619          

HSP 2 Score: 93.2041 bits (230), Expect = 1.395e-18
Identity = 69/159 (43.40%), Postives = 109/159 (68.55%), Query Frame = 2
Query:  149 MTEKVQILANKIYKEFERLISFYGSDVVEYLMPXXXXXXXXXXXXYRDKHTYEIDVELLKEDNCTLNRQYEREKYLKKQSEERVIHXXXXXXXXXXXXXXXXXXXXSSNRTFEVKFRNANETVSRLEEKVEFLKIENQKIYERYTDVLKSHAEQLNKIK 625
            M+E+V  LA+ IY+EFERLI  Y  +VV+ LMPL+VN+LENL+ +  +   +E+++ELLKEDN  L  QYEREK L+KQ+EE+ I  E A E +KK L+  +  LE   +  E+K +N  + +SRLEE+   +K E   +++R+T++++++ E + + K
Sbjct:   19 MSERVTGLASSIYQEFERLIKTYDEEVVKELMPLVVNVLENLDSVLTENQEHEVELELLKEDNEQLITQYEREKALRKQAEEKFIEFEDALEADKKDLQTTVETLELQAKQLELKSKNYADQISRLEERESDMKKEYNALHQRHTEMIQTYVEHIERSK 177          
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. Ensembl Zebrafish
Match: mapk8ip3 (mitogen-activated protein kinase 8 interacting protein 3 [Source:ZFIN;Acc:ZDB-GENE-090303-6])

HSP 1 Score: 110.538 bits (275), Expect = 5.310e-24
Identity = 68/176 (38.64%), Postives = 104/176 (59.09%), Query Frame = 2
Query: 1088 VTDDEFGIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREELRRHSNREADLKGKLAHLEQELK-ICKEKLIDSQAXXXXXX-------------XXQKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFPEFRESSKPMKAQNSGIWNLFNNLF 1573
            V DD FG+G+E++ ++ EN+ L+ TKNALNIVK+DLI ++D +++E ++LREEL      +  +  ++  LE+ELK +  E L  SQ S++                 +++ F+R EMA +L E+N YKE+LMELQ+AV + EM R  ++ P   E  K +      IW  F  LF
Sbjct:  375 VRDDFFGMGKEVENLLTENKQLLETKNALNIVKNDLIAKVDELSSEQEVLREELESVKQSKTKVDQRVKELEEELKRLRAEALGASQDSKDEGGEDYSSPLQDDVTMTQRRRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASRESPPLPEKKKSI------IWQFFARLF 544          

HSP 2 Score: 92.4337 bits (228), Expect = 1.918e-18
Identity = 69/159 (43.40%), Postives = 109/159 (68.55%), Query Frame = 2
Query:  149 MTEKVQILANKIYKEFERLISFYGSDVVEYLMPXXXXXXXXXXXXYRDKHTYEIDVELLKEDNCTLNRQYEREKYLKKQSEERVIHXXXXXXXXXXXXXXXXXXXXSSNRTFEVKFRNANETVSRLEEKVEFLKIENQKIYERYTDVLKSHAEQLNKIK 625
            M+E+V  LA+ IY+EFERLI  Y  +VV+ LMPL+VN+LENL+ +  +   +E+++ELLKEDN  L  QYEREK L+KQ+EE+ I  E A E +KK L+  +  LE   +  E+K +N  + +SRLEE+   +K E   +++R+T++++++ E + + K
Sbjct:   18 MSERVTGLASSIYQEFERLIKTYDEEVVKELMPLVVNVLENLDSVLTENQEHEVELELLKEDNEQLITQYEREKALRKQAEEKFIEFEDALEADKKDLQTTVETLELQAKQLELKSKNYADQISRLEERESDMKKEYNALHQRHTEMIQTYVEHIERSK 176          
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. Ensembl Zebrafish
Match: SPAG9 (sperm associated antigen 9b [Source:NCBI gene;Acc:100333761])

HSP 1 Score: 109.383 bits (272), Expect = 1.332e-23
Identity = 94/349 (26.93%), Postives = 158/349 (45.27%), Query Frame = 2
Query: 1076 SDTDVTDDEFGIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREELRRHSNREADLKGKLAHLEQELKICKEKLIDSQAXXXX------XXXXQKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFPEFRE---SSKPMKAQ-------------NSGIWNLFNNLFKKEDELSIQMKEKSKS------------LLSR--------------FKRESDRSQLYSWSVP-------RSLVESELPKRIPIPIKIQTIFEPKDIVICATTGYGSTVGNDSAQYLWCLIQSNTKNNK----------NYYLQQMCLTEKVPELTNKYSIS 1927
             D D   D  G+GRE++ +I EN  L+ TKNALN+VK+DLI R+D +  E D+L+ E+      +  L+ +   LE ELK  + ++ +++            + ++K F+R EMA +L E+N YKE+LMELQ+AV + EM R  K+ P   E   S+ P+ +              N+   ++  ++ K+   L+    +KSK+            ++SR               ++E  R Q Y WS+P           +S++ K +P+P+ ++ + E                  D++  LWC    N    K          + + + +   E+VP  T K S S
Sbjct:  226 GDVDEGADLLGMGREVEHLIHENTQLLETKNALNVVKNDLIARVDELVCEKDVLQGEIEVLKQTKDKLEERNKELEDELKKVRAEMEETKVETKGDDDSDVPTAQRKRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASKENPALSEKKKSTSPLSSPQSKKPEAPVNMKYNAPSSHVVPSVKKRSSTLAQLPSDKSKAFDFLNEEAEVETVVSRREQKRAQYRQVKAHVQKEDGRMQAYGWSLPPKYKVANGGQADSKI-KNLPVPVYLRPLDE-----------------KDASMKLWCAAGVNLSGGKTRDGGSIVGASVFYKDVSGGERVPISTGKKSGS 556          
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. Ensembl Zebrafish
Match: SPAG9 (sperm associated antigen 9b [Source:NCBI gene;Acc:100333761])

HSP 1 Score: 108.997 bits (271), Expect = 1.851e-23
Identity = 94/349 (26.93%), Postives = 158/349 (45.27%), Query Frame = 2
Query: 1076 SDTDVTDDEFGIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREELRRHSNREADLKGKLAHLEQELKICKEKLIDSQAXXXX------XXXXQKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFPEFRE---SSKPMKAQ-------------NSGIWNLFNNLFKKEDELSIQMKEKSKS------------LLSR--------------FKRESDRSQLYSWSVP-------RSLVESELPKRIPIPIKIQTIFEPKDIVICATTGYGSTVGNDSAQYLWCLIQSNTKNNK----------NYYLQQMCLTEKVPELTNKYSIS 1927
             D D   D  G+GRE++ +I EN  L+ TKNALN+VK+DLI R+D +  E D+L+ E+      +  L+ +   LE ELK  + ++ +++            + ++K F+R EMA +L E+N YKE+LMELQ+AV + EM R  K+ P   E   S+ P+ +              N+   ++  ++ K+   L+    +KSK+            ++SR               ++E  R Q Y WS+P           +S++ K +P+P+ ++ + E                  D++  LWC    N    K          + + + +   E+VP  T K S S
Sbjct:  373 GDVDEGADLLGMGREVEHLIHENTQLLETKNALNVVKNDLIARVDELVCEKDVLQGEIEVLKQTKDKLEERNKELEDELKKVRAEMEETKVETKGDDDSDVPTAQRKRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASKENPALSEKKKSTSPLSSPQSKKPEAPVNMKYNAPSSHVVPSVKKRSSTLAQLPSDKSKAFDFLNEEAEVETVVSRREQKRAQYRQVKAHVQKEDGRMQAYGWSLPPKYKVANGGQADSKI-KNLPVPVYLRPLDE-----------------KDASMKLWCAAGVNLSGGKTRDGGSIVGASVFYKDVSGGERVPISTGKKSGS 703          

HSP 2 Score: 100.908 bits (250), Expect = 5.540e-21
Identity = 71/159 (44.65%), Postives = 110/159 (69.18%), Query Frame = 2
Query:  149 MTEKVQILANKIYKEFERLISFYGSDVVEYLMPXXXXXXXXXXXXYRDKHTYEIDVELLKEDNCTLNRQYEREKYLKKQSEERVIHXXXXXXXXXXXXXXXXXXXXSSNRTFEVKFRNANETVSRLEEKVEFLKIENQKIYERYTDVLKSHAEQLNKIK 625
            M+E+V  LA+ IY+EFER+I  Y  DVV+ LMPL+V +LENL+ ++ +   +E+++ELLKEDN  L  QYEREK L+K +EER I  E + E++KKAL+ ++ +LE+  R  E K +N  + + RLEE+   LK E   +++R+T+++ S+ E L + K
Sbjct:   19 MSERVSGLASSIYREFERMIGRYDEDVVKELMPLVVAVLENLDSVFAENQEHEVELELLKEDNEQLVTQYEREKALRKNAEERYIEYEDSQEQDKKALQTRVQLLEAQTRQMEFKTKNCTDQIGRLEEREAELKKEYNALHQRHTEMIHSYMEHLERSK 177          
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. Ensembl Zebrafish
Match: SPAG9 (sperm associated antigen 9b [Source:NCBI gene;Acc:100333761])

HSP 1 Score: 108.612 bits (270), Expect = 2.589e-23
Identity = 94/349 (26.93%), Postives = 158/349 (45.27%), Query Frame = 2
Query: 1076 SDTDVTDDEFGIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREELRRHSNREADLKGKLAHLEQELKICKEKLIDSQAXXXX------XXXXQKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFPEFRE---SSKPMKAQ-------------NSGIWNLFNNLFKKEDELSIQMKEKSKS------------LLSR--------------FKRESDRSQLYSWSVP-------RSLVESELPKRIPIPIKIQTIFEPKDIVICATTGYGSTVGNDSAQYLWCLIQSNTKNNK----------NYYLQQMCLTEKVPELTNKYSIS 1927
             D D   D  G+GRE++ +I EN  L+ TKNALN+VK+DLI R+D +  E D+L+ E+      +  L+ +   LE ELK  + ++ +++            + ++K F+R EMA +L E+N YKE+LMELQ+AV + EM R  K+ P   E   S+ P+ +              N+   ++  ++ K+   L+    +KSK+            ++SR               ++E  R Q Y WS+P           +S++ K +P+P+ ++ + E                  D++  LWC    N    K          + + + +   E+VP  T K S S
Sbjct:  382 GDVDEGADLLGMGREVEHLIHENTQLLETKNALNVVKNDLIARVDELVCEKDVLQGEIEVLKQTKDKLEERNKELEDELKKVRAEMEETKVETKGDDDSDVPTAQRKRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASKENPALSEKKKSTSPLSSPQSKKPEAPVNMKYNAPSSHVVPSVKKRSSTLAQLPSDKSKAFDFLNEEAEVETVVSRREQKRAQYRQVKAHVQKEDGRMQAYGWSLPPKYKVANGGQADSKI-KNLPVPVYLRPLDE-----------------KDASMKLWCAAGVNLSGGKTRDGGSIVGASVFYKDVSGGERVPISTGKKSGS 712          

HSP 2 Score: 100.908 bits (250), Expect = 5.740e-21
Identity = 71/159 (44.65%), Postives = 110/159 (69.18%), Query Frame = 2
Query:  149 MTEKVQILANKIYKEFERLISFYGSDVVEYLMPXXXXXXXXXXXXYRDKHTYEIDVELLKEDNCTLNRQYEREKYLKKQSEERVIHXXXXXXXXXXXXXXXXXXXXSSNRTFEVKFRNANETVSRLEEKVEFLKIENQKIYERYTDVLKSHAEQLNKIK 625
            M+E+V  LA+ IY+EFER+I  Y  DVV+ LMPL+V +LENL+ ++ +   +E+++ELLKEDN  L  QYEREK L+K +EER I  E + E++KKAL+ ++ +LE+  R  E K +N  + + RLEE+   LK E   +++R+T+++ S+ E L + K
Sbjct:   19 MSERVSGLASSIYREFERMIGRYDEDVVKELMPLVVAVLENLDSVFAENQEHEVELELLKEDNEQLVTQYEREKALRKNAEERYIEYEDSQEQDKKALQTRVQLLEAQTRQMEFKTKNCTDQIGRLEEREAELKKEYNALHQRHTEMIHSYMEHLERSK 177          
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. Ensembl Xenopus
Match: cldn2 (claudin 2 [Source:Xenbase;Acc:XB-GENE-994508])

HSP 1 Score: 187.963 bits (476), Expect = 8.412e-48
Identity = 169/526 (32.13%), Postives = 273/526 (51.90%), Query Frame = 2
Query:  149 MTEKVQILANKIYKEFERLISFYGSDVVEYLMPXXXXXXXXXXXXYRDKHTYEIDVELLKEDNCTLNRQYEREKYLKKQSEERVIHXXXXXXXXXXXXXXXXXXXXSSNRTFEVKFRNANETVSRLEEKVEFLKIENQKIYERYTDVLKSHAEQLNKIKAETCRDISP-------------PFSLSIRDLEN----------RSTKSLIRDLRLKNNIQNSVIIPNKLLDPEHSN--PDLNHLHDENFDIFDEKNXXXXXXXXXXHQGETVA-DILSNDHW--MTDCCDGETDCNQVHSNNLK----NPSQFDSSSSYFMDPQDLSQRMNRDHSLETNIVDSDTD------VTDDEFGIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREELRRHSNREADLKGKLAHLEQELKICKEKLI-------------DSQAXXXXXXXXQKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFPEFRESSKPMKAQNSGIWNLFNNLF 1573
            M+E+V  LAN IY+EFERLI  Y  +VV+ LMPL+VN+LENL+ +  +   +E+++ELLKEDN  L  QYEREK L+KQ+EE+ I  E A E+EKK L+ ++  LE   R  E+K +N  + +SRLEE+   LK E   +++R+T++++++ E + + K +     S              P SL++  L +           S  +       K+N   S + P+  + P H +  P  ++          EK    +    ++ +   V+  + S+D W  + D  D   + +      L+    +P+Q   + ++ ++   L   ++   S     VD   D      V DD FG+G+E+  ++ EN  L+ TKNALN+VK+DLI +LD +T E ++L+ EL      +  ++ ++  LE+ELK  K + I              S   +N    +++ F+R EMA +L E+N YKE+LMELQ+AV + EM R  ++ P  +E  K      S IW  F+ LF
Sbjct:   22 MSERVSGLANSIYREFERLIRCYDEEVVKELMPLVVNVLENLDAVLTENQEHEVELELLKEDNEQLLTQYEREKALRKQAEEKFIEFEDALEQEKKDLQYQVETLEFQGRQMELKTKNYADQISRLEERESELKKEYNALHQRHTEMIQTYVEHIERSKLQQVAGNSQSDGGVTGRSRKERPTSLNVFPLADGMDEMSESGQSSVAATPSTTGTKSNTPTSSV-PSAAVTPLHESLQPPQDYGMTGKAKRSREKRHSHNMEVQVTQEMRNVSIGMGSSDEWSDVQDIIDSTPELDMCQDPRLERTGNSPTQGIVNKAFGINTDSLYHELSTAGSEVIGDVDEGADLLGEFSVRDDFFGMGKEVGNLLLENSQLLETKNALNVVKNDLIAKLDQLTGEQEVLKGELEATKQAKVKMETRVKELEEELKRVKSEAIVALQEPKEEVEESSSPLQDNIPIAQRRRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASREHPSVQEKKK------STIWQFFSRLF 540          
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. Ensembl Xenopus
Match: cldn2 (claudin 2 [Source:Xenbase;Acc:XB-GENE-994508])

HSP 1 Score: 185.267 bits (469), Expect = 6.465e-47
Identity = 164/502 (32.67%), Postives = 267/502 (53.19%), Query Frame = 2
Query:  149 MTEKVQILANKIYKEFERLISFYGSDVVEYLMPXXXXXXXXXXXXYRDKHTYEIDVELLKEDNCTLNRQYEREKYLKKQSEERVIHXXXXXXXXXXXXXXXXXXXXSSNRTFEVKFRNANETVSRLEEKVEFLKIENQKIYERYTDVLKSHAE-----QLNKIKAETCRDISPPFSLSIRDLENRSTKSLIRDLRLKNNIQNSVIIPNKLLDPEHSN--PDLNHLHDENFDIFDEKNXXXXXXXXXXHQGETVA-DILSNDHW--MTDCCDGETDCNQVHSNNLK----NPSQFDSSSSYFMDPQDLSQRMNRDHSLETNIVDSDTDVTDDEFGIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREELRRHSNREADLKGKLAHLEQELKICKEKLI-------------DSQAXXXXXXXXQKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFPEFRESSKPMKAQNSGIWNLFNNLF 1573
            M+E+V  LAN IY+EFERLI  Y  +VV+ LMPL+VN+LENL+ +  +   +E+++ELLKEDN  L  QYEREK L+KQ+EE+ I  E A E+EKK L+ ++  LE   R  E+K +N  + +SRLEE+   LK E   +++R+T++++++ E     +L ++   +  D     S S +     S  +       K+N   S + P+  + P H +  P  ++          EK    +    ++ +   V+  + S+D W  + D  D   + +      L+    +P+Q   + ++ ++   L   +    S   + V  D D   D  G+G+E+  ++ EN  L+ TKNALN+VK+DLI +LD +T E ++L+ EL      +  ++ ++  LE+ELK  K + I              S   +N    +++ F+R EMA +L E+N YKE+LMELQ+AV + EM R  ++ P  +E  K      S IW  F+ LF
Sbjct:   21 MSERVSGLANSIYREFERLIRCYDEEVVKELMPLVVNVLENLDAVLTENQEHEVELELLKEDNEQLLTQYEREKALRKQAEEKFIEFEDALEQEKKDLQYQVETLEFQGRQMELKTKNYADQISRLEERESELKKEYNALHQRHTEMIQTYVEHIERSKLQQVAGNSQSDGGDEMSESGQS----SVAATPSTTGTKSNTPTSSV-PSAAVTPLHESLQPPQDYGMTGKAKRSREKRHSHNMEVQVTQEMRNVSIGMGSSDEWSDVQDIIDSTPELDMCQDPRLERTGNSPTQGIVNKAFGINTDSLYHEL----STAGSEVIGDVDEGADLLGMGKEVGNLLLENSQLLETKNALNVVKNDLIAKLDQLTGEQEVLKGELEATKQAKVKMETRVKELEEELKRVKSEAIVALQEPKEEVEESSSPLQDNIPIAQRRRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASREHPSVQEKKK------STIWQFFSRLF 507          
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. Ensembl Xenopus
Match: cldn2 (claudin 2 [Source:Xenbase;Acc:XB-GENE-994508])

HSP 1 Score: 184.882 bits (468), Expect = 7.954e-47
Identity = 169/534 (31.65%), Postives = 273/534 (51.12%), Query Frame = 2
Query:  149 MTEKVQILANKIYKEFERLISFYGSDVVEYLMPXXXXXXXXXXXXYRDKHTYEIDVELLKEDNCTLNRQYEREKYLKKQSEERVIHXXXXXXXXXXXXXXXXXXXXSSNRTFEVKFRNANETVSRLEEKVEFLKIENQKIYERYTDVLKSHAEQLNKIKAETCRDISP---------------------PFSLSIRDLEN----------RSTKSLIRDLRLKNNIQNSVIIPNKLLDPEHSN--PDLNHLHDENFDIFDEKNXXXXXXXXXXHQGETVA-DILSNDHW--MTDCCDGETDCNQVHSNNLK----NPSQFDSSSSYFMDPQDLSQRMNRDHSLETNIVDSDTD------VTDDEFGIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREELRRHSNREADLKGKLAHLEQELKICKEKLI-------------DSQAXXXXXXXXQKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFPEFRESSKPMKAQNSGIWNLFNNLF 1573
            M+E+V  LAN IY+EFERLI  Y  +VV+ LMPL+VN+LENL+ +  +   +E+++ELLKEDN  L  QYEREK L+KQ+EE+ I  E A E+EKK L+ ++  LE   R  E+K +N  + +SRLEE+   LK E   +++R+T++++++ E + + K +     S                      P SL++  L +           S  +       K+N   S + P+  + P H +  P  ++          EK    +    ++ +   V+  + S+D W  + D  D   + +      L+    +P+Q   + ++ ++   L   ++   S     VD   D      V DD FG+G+E+  ++ EN  L+ TKNALN+VK+DLI +LD +T E ++L+ EL      +  ++ ++  LE+ELK  K + I              S   +N    +++ F+R EMA +L E+N YKE+LMELQ+AV + EM R  ++ P  +E  K      S IW  F+ LF
Sbjct:   22 MSERVSGLANSIYREFERLIRCYDEEVVKELMPLVVNVLENLDAVLTENQEHEVELELLKEDNEQLLTQYEREKALRKQAEEKFIEFEDALEQEKKDLQYQVETLEFQGRQMELKTKNYADQISRLEERESELKKEYNALHQRHTEMIQTYVEHIERSKLQQVAGNSQSDGGVTGRSHRQSWRKSRKERPTSLNVFPLADGMDEMSESGQSSVAATPSTTGTKSNTPTSSV-PSAAVTPLHESLQPPQDYGMTGKAKRSREKRHSHNMEVQVTQEMRNVSIGMGSSDEWSDVQDIIDSTPELDMCQDPRLERTGNSPTQGIVNKAFGINTDSLYHELSTAGSEVIGDVDEGADLLGEFSVRDDFFGMGKEVGNLLLENSQLLETKNALNVVKNDLIAKLDQLTGEQEVLKGELEATKQAKVKMETRVKELEEELKRVKSEAIVALQEPKEEVEESSSPLQDNIPIAQRRRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASREHPSVQEKKK------STIWQFFSRLF 548          
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. Ensembl Xenopus
Match: cldn2 (claudin 2 [Source:Xenbase;Acc:XB-GENE-994508])

HSP 1 Score: 182.57 bits (462), Expect = 4.205e-46
Identity = 165/528 (31.25%), Postives = 271/528 (51.33%), Query Frame = 2
Query:  149 MTEKVQILANKIYKEFERLISFYGSDVVEYLMPXXXXXXXXXXXXYRDKHTYEIDVELLKEDNCTLNRQYEREKYLKKQSEERVIHXXXXXXXXXXXXXXXXXXXXSSNRTFEVKFRNANETVSRLEEKVEFLKIENQKIYERYTDVLKSHAEQLNKIKAETCRDISP---------------------PFSLSIRDLEN----------RSTKSLIRDLRLKNNIQNSVIIPNKLLDPEHSN--PDLNHLHDENFDIFDEKNXXXXXXXXXXHQGETVA-DILSNDHW--MTDCCDGETDCNQVHSNNLK----NPSQFDSSSSYFMDPQDLSQRMNRDHSLETNIVDSDTDVTDDEFGIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREELRRHSNREADLKGKLAHLEQELKICKEKLI-------------DSQAXXXXXXXXQKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFPEFRESSKPMKAQNSGIWNLFNNLF 1573
            M+E+V  LAN IY+EFERLI  Y  +VV+ LMPL+VN+LENL+ +  +   +E+++ELLKEDN  L  QYEREK L+KQ+EE+ I  E A E+EKK L+ ++  LE   R  E+K +N  + +SRLEE+   LK E   +++R+T++++++ E + + K +     S                      P SL++  L +           S  +       K+N   S + P+  + P H +  P  ++          EK    +    ++ +   V+  + S+D W  + D  D   + +      L+    +P+Q   + ++ ++   L   ++   S     VD   D+  +  G+G+E+  ++ EN  L+ TKNALN+VK+DLI +LD +T E ++L+ EL      +  ++ ++  LE+ELK  K + I              S   +N    +++ F+R EMA +L E+N YKE+LMELQ+AV + EM R  ++ P  +E  K      S IW  F+ LF
Sbjct:   22 MSERVSGLANSIYREFERLIRCYDEEVVKELMPLVVNVLENLDAVLTENQEHEVELELLKEDNEQLLTQYEREKALRKQAEEKFIEFEDALEQEKKDLQYQVETLEFQGRQMELKTKNYADQISRLEERESELKKEYNALHQRHTEMIQTYVEHIERSKLQQVAGNSQSDGGVTGRSHRQSWRKSRKERPTSLNVFPLADGMDEMSESGQSSVAATPSTTGTKSNTPTSSV-PSAAVTPLHESLQPPQDYGMTGKAKRSREKRHSHNMEVQVTQEMRNVSIGMGSSDEWSDVQDIIDSTPELDMCQDPRLERTGNSPTQGIVNKAFGINTDSLYHELSTAGSEVIGDVDEGADLLGEFSGMGKEVGNLLLENSQLLETKNALNVVKNDLIAKLDQLTGEQEVLKGELEATKQAKVKMETRVKELEEELKRVKSEAIVALQEPKEEVEESSSPLQDNIPIAQRRRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASREHPSVQEKKK------STIWQFFSRLF 542          
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. Ensembl Xenopus
Match: cldn2 (claudin 2 [Source:Xenbase;Acc:XB-GENE-994508])

HSP 1 Score: 108.612 bits (270), Expect = 2.994e-23
Identity = 65/184 (35.33%), Postives = 99/184 (53.80%), Query Frame = 2
Query: 1070 VDSDTDVTDDEFGIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREELRRHSNREADLKGKLAHLEQELKICKEKLIDSQAXXXXXX----------------XXQKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFPEFRESSKPMKAQNSGIWNLFNNLF 1573
            V  D D   D  G+G+E+  ++ EN  L+ TKNALN+VK+DLI +LD +T E ++L+ EL      +  ++ ++  LE+ELK  K + I +                         +++ F+R EMA +L E+N YKE+LMELQ+AV + EM R  ++ P  +E  K      S IW  F+ LF
Sbjct:  395 VIGDVDEGADLLGMGKEVGNLLLENSQLLETKNALNVVKNDLIAKLDQLTGEQEVLKGELEATKQAKVKMETRVKELEEELKRVKSEAIVALQEPKEEVEEVGISLTCFSDNIPIAQRRRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASREHPSVQEKKK------STIWQFFSRLF 572          

HSP 2 Score: 97.4413 bits (241), Expect = 8.075e-20
Identity = 73/159 (45.91%), Postives = 111/159 (69.81%), Query Frame = 2
Query:  149 MTEKVQILANKIYKEFERLISFYGSDVVEYLMPXXXXXXXXXXXXYRDKHTYEIDVELLKEDNCTLNRQYEREKYLKKQSEERVIHXXXXXXXXXXXXXXXXXXXXSSNRTFEVKFRNANETVSRLEEKVEFLKIENQKIYERYTDVLKSHAEQLNKIK 625
            M+E+V  LAN IY+EFERLI  Y  +VV+ LMPL+VN+LENL+ +  +   +E+++ELLKEDN  L  QYEREK L+KQ+EE+ I  E A E+EKK L+ ++  LE   R  E+K +N  + +SRLEE+   LK E   +++R+T++++++ E + + K
Sbjct:   22 MSERVSGLANSIYREFERLIRCYDEEVVKELMPLVVNVLENLDAVLTENQEHEVELELLKEDNEQLLTQYEREKALRKQAEEKFIEFEDALEQEKKDLQYQVETLEFQGRQMELKTKNYADQISRLEERESELKKEYNALHQRHTEMIQTYVEHIERSK 180          
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. Ensembl Mouse
Match: Mapk8ip3 (mitogen-activated protein kinase 8 interacting protein 3 [Source:MGI Symbol;Acc:MGI:1353598])

HSP 1 Score: 179.489 bits (454), Expect = 3.048e-45
Identity = 162/534 (30.34%), Postives = 268/534 (50.19%), Query Frame = 2
Query:  149 MTEKVQILANKIYKEFERLISFYGSDVVEYLMPXXXXXXXXXXXXYRDKHTYEIDVELLKEDNCTLNRQYEREKYLKKQSEERVIHXXXXXXXXXXXXXXXXXXXXSSNRTFEVKFRNANETVSRLEEKVEFLKIENQKIYERYTDVLKSHAEQLNKIKAE------------TCRDISPPFSLSIRDLEN-------------RSTKSLIRDLRLKNNIQNSVIIPNKLLDPEHSNPDLNHLHD------ENFDIFDEKNXXXXXXXXXXHQGETVADILSNDHW--MTDCCDGETDCNQVHSNNLK----NPSQFDSSSSYFMDPQDLSQRMNRDHSLETNIVDSDTD------VTDDEFGIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREELRRHSNREADLKGKLAHLEQELKICKEKLIDSQAXXXX----------------XXXXQKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFPEFRESSKPMKAQNSGIWNLFNNLF 1573
            M+E+V  LA  IY+EFERLI  Y  +VV+ LMPL+VN+LENL+ +  +   +E+++ELL+EDN  L  QYEREK L+KQ+EE+ I  E A E+EKK L+ ++   E   R  E+K +N  + +SRLEE+   +K E   +++R+T++++++ E + + K +              R    P SL++  L +              S  +       K+N   S + P+  + P   N  L  L D       N    +++N ++               + S+D W  + D  D   + +      L+    +P+Q   + ++ ++   L   ++   S     VD   D      V DD FG+G+E+  ++ EN  L+ TKNALN+VK+DLI ++D ++ E ++L+ EL      +  L+ ++  LE+ELK  K + + ++                        +++ F+R EMA +L E+N YKE+LMELQ+AV + EM R  ++ P  +E  K      S IW  F+ LF
Sbjct:   25 MSERVSGLAGSIYREFERLIHCYDEEVVKELMPLVVNVLENLDSVLSENQEHEVELELLREDNEQLLTQYEREKALRKQAEEKFIEFEDALEQEKKELQIQVEHYEFQTRQLELKAKNYADQISRLEERESEMKKEYNALHQRHTEMIQTYVEHIERSKMQQVGGSGQTESSLPGRRKERPTSLNVFPLADGMCPNDEMSESGQSSAAATPSTTGTKSNTPTSSV-PSAAVTP--LNESLQPLGDYVSVTKNNKQAREKRNSRNMEVQVTQEMRNVSIGMGSSDEWSDVQDIIDSTPELDVCPETRLERTGSSPTQGIVNKAFGINTDSLYHELSTAGSEVIGDVDEGADLLGEFSVRDDFFGMGKEVGNLLLENSQLLETKNALNVVKNDLIAKVDQLSGEQEVLKGELEAAKQAKVKLENRIKELEEELKRVKSEAVTARREPREEVEDVSSYLCTELDKIPMAQRRRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASREHPSVQEKKK------STIWQFFSRLF 549          
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. Ensembl Mouse
Match: Mapk8ip3 (mitogen-activated protein kinase 8 interacting protein 3 [Source:MGI Symbol;Acc:MGI:1353598])

HSP 1 Score: 178.333 bits (451), Expect = 6.201e-45
Identity = 161/535 (30.09%), Postives = 267/535 (49.91%), Query Frame = 2
Query:  149 MTEKVQILANKIYKEFERLISFYGSDVVEYLMPXXXXXXXXXXXXYRDKHTYEIDVELLKEDNCTLNRQYEREKYLKKQSEERVIHXXXXXXXXXXXXXXXXXXXXSSNRTFEVKFRNANETVSRLEEKVEFLKIENQKIYERYTDVLKSHAEQLNKIKAETCRDISP-------------PFSLSIRDLEN-------------RSTKSLIRDLRLKNNIQNSVIIPNKLLDPEHSNPDLNHLHD------ENFDIFDEKNXXXXXXXXXXHQGETVADILSNDHW--MTDCCDGETDCNQVHSNNLK----NPSQFDSSSSYFMDPQDLSQRMNRDHSLETNIVDSDTD------VTDDEFGIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREELRRHSNREADLKGKLAHLEQELKICKEKLIDSQAXXXX----------------XXXXQKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFPEFRESSKPMKAQNSGIWNLFNNLF 1573
            M+E+V  LA  IY+EFERLI  Y  +VV+ LMPL+VN+LENL+ +  +   +E+++ELL+EDN  L  QYEREK L+KQ+EE+ I  E A E+EKK L+ ++   E   R  E+K +N  + +SRLEE+   +K E   +++R+T++++++ E + + K +                    P SL++  L +              S  +       K+N   S + P+  + P   N  L  L D       N    +++N ++               + S+D W  + D  D   + +      L+    +P+Q   + ++ ++   L   ++   S     VD   D      V DD FG+G+E+  ++ EN  L+ TKNALN+VK+DLI ++D ++ E ++L+ EL      +  L+ ++  LE+ELK  K + + ++                        +++ F+R EMA +L E+N YKE+LMELQ+AV + EM R  ++ P  +E  K      S IW  F+ LF
Sbjct:   25 MSERVSGLAGSIYREFERLIHCYDEEVVKELMPLVVNVLENLDSVLSENQEHEVELELLREDNEQLLTQYEREKALRKQAEEKFIEFEDALEQEKKELQIQVEHYEFQTRQLELKAKNYADQISRLEERESEMKKEYNALHQRHTEMIQTYVEHIERSKMQQVGGSGQTESSLPGRSRKERPTSLNVFPLADGMCPNDEMSESGQSSAAATPSTTGTKSNTPTSSV-PSAAVTP--LNESLQPLGDYVSVTKNNKQAREKRNSRNMEVQVTQEMRNVSIGMGSSDEWSDVQDIIDSTPELDVCPETRLERTGSSPTQGIVNKAFGINTDSLYHELSTAGSEVIGDVDEGADLLGEFSVRDDFFGMGKEVGNLLLENSQLLETKNALNVVKNDLIAKVDQLSGEQEVLKGELEAAKQAKVKLENRIKELEEELKRVKSEAVTARREPREEVEDVSSYLCTELDKIPMAQRRRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASREHPSVQEKKK------STIWQFFSRLF 550          
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. Ensembl Mouse
Match: Mapk8ip3 (mitogen-activated protein kinase 8 interacting protein 3 [Source:MGI Symbol;Acc:MGI:1353598])

HSP 1 Score: 176.792 bits (447), Expect = 2.306e-44
Identity = 163/543 (30.02%), Postives = 270/543 (49.72%), Query Frame = 2
Query:  149 MTEKVQILANKIYKEFERLISFYGSDVVEYLMPXXXXXXXXXXXXYRDKHTYEIDVELLKEDNCTLNRQYEREKYLKKQSEERVIHXXXXXXXXXXXXXXXXXXXXSSNRTFEVKFRNANETVSRLEEKVEFLKIENQKIYERYTDVLKSHAEQLNKIKAE----------TCRDISP-----------PFSLSIRDLEN-------------RSTKSLIRDLRLKNNIQNSVIIPNKLLDPEHSNPDLNHLHD------ENFDIFDEKNXXXXXXXXXXHQGETVADILSNDHW--MTDCCDGETDCNQVHSNNLK----NPSQFDSSSSYFMDPQDLSQRMNRDHSLETNIVDSDTD------VTDDEFGIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREELRRHSNREADLKGKLAHLEQELKICKEKLIDSQAXXXX----------------XXXXQKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFPEFRESSKPMKAQNSGIWNLFNNLF 1573
            M+E+V  LA  IY+EFERLI  Y  +VV+ LMPL+VN+LENL+ +  +   +E+++ELL+EDN  L  QYEREK L+KQ+EE+ I  E A E+EKK L+ ++   E   R  E+K +N  + +SRLEE+   +K E   +++R+T++++++ E + + K +          +    SP           P SL++  L +              S  +       K+N   S + P+  + P   N  L  L D       N    +++N ++               + S+D W  + D  D   + +      L+    +P+Q   + ++ ++   L   ++   S     VD   D      V DD FG+G+E+  ++ EN  L+ TKNALN+VK+DLI ++D ++ E ++L+ EL      +  L+ ++  LE+ELK  K + + ++                        +++ F+R EMA +L E+N YKE+LMELQ+AV + EM R  ++ P  +E  K      S IW  F+ LF
Sbjct:   25 MSERVSGLAGSIYREFERLIHCYDEEVVKELMPLVVNVLENLDSVLSENQEHEVELELLREDNEQLLTQYEREKALRKQAEEKFIEFEDALEQEKKELQIQVEHYEFQTRQLELKAKNYADQISRLEERESEMKKEYNALHQRHTEMIQTYVEHIERSKMQQVGGSGQTESSLPGRSPRQSWRKSRKERPTSLNVFPLADGMCPNDEMSESGQSSAAATPSTTGTKSNTPTSSV-PSAAVTP--LNESLQPLGDYVSVTKNNKQAREKRNSRNMEVQVTQEMRNVSIGMGSSDEWSDVQDIIDSTPELDVCPETRLERTGSSPTQGIVNKAFGINTDSLYHELSTAGSEVIGDVDEGADLLGEFSVRDDFFGMGKEVGNLLLENSQLLETKNALNVVKNDLIAKVDQLSGEQEVLKGELEAAKQAKVKLENRIKELEEELKRVKSEAVTARREPREEVEDVSSYLCTELDKIPMAQRRRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASREHPSVQEKKK------STIWQFFSRLF 558          
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. Ensembl Mouse
Match: Mapk8ip3 (mitogen-activated protein kinase 8 interacting protein 3 [Source:MGI Symbol;Acc:MGI:1353598])

HSP 1 Score: 176.022 bits (445), Expect = 3.501e-44
Identity = 157/529 (29.68%), Postives = 265/529 (50.09%), Query Frame = 2
Query:  149 MTEKVQILANKIYKEFERLISFYGSDVVEYLMPXXXXXXXXXXXXYRDKHTYEIDVELLKEDNCTLNRQYEREKYLKKQSEERVIHXXXXXXXXXXXXXXXXXXXXSSNRTFEVKFRNANETVSRLEEKVEFLKIENQKIYERYTDVLKSHAEQLNKIKAETCRDISP-------------PFSLSIRDLEN-------------RSTKSLIRDLRLKNNIQNSVIIPNKLLDPEHSNPDLNHLHD------ENFDIFDEKNXXXXXXXXXXHQGETVADILSNDHW--MTDCCDGETDCNQVHSNNLK----NPSQFDSSSSYFMDPQDLSQRMNRDHSLETNIVDSDTDVTDDEFGIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREELRRHSNREADLKGKLAHLEQELKICKEKLIDSQAXXXX----------------XXXXQKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFPEFRESSKPMKAQNSGIWNLFNNLF 1573
            M+E+V  LA  IY+EFERLI  Y  +VV+ LMPL+VN+LENL+ +  +   +E+++ELL+EDN  L  QYEREK L+KQ+EE+ I  E A E+EKK L+ ++   E   R  E+K +N  + +SRLEE+   +K E   +++R+T++++++ E + + K +                    P SL++  L +              S  +       K+N   S + P+  + P   N  L  L D       N    +++N ++               + S+D W  + D  D   + +      L+    +P+Q   + ++ ++   L   ++   S     VD   D+  +  G+G+E+  ++ EN  L+ TKNALN+VK+DLI ++D ++ E ++L+ EL      +  L+ ++  LE+ELK  K + + ++                        +++ F+R EMA +L E+N YKE+LMELQ+AV + EM R  ++ P  +E  K      S IW  F+ LF
Sbjct:   25 MSERVSGLAGSIYREFERLIHCYDEEVVKELMPLVVNVLENLDSVLSENQEHEVELELLREDNEQLLTQYEREKALRKQAEEKFIEFEDALEQEKKELQIQVEHYEFQTRQLELKAKNYADQISRLEERESEMKKEYNALHQRHTEMIQTYVEHIERSKMQQVGGSGQTESSLPGRSRKERPTSLNVFPLADGMCPNDEMSESGQSSAAATPSTTGTKSNTPTSSV-PSAAVTP--LNESLQPLGDYVSVTKNNKQAREKRNSRNMEVQVTQEMRNVSIGMGSSDEWSDVQDIIDSTPELDVCPETRLERTGSSPTQGIVNKAFGINTDSLYHELSTAGSEVIGDVDEGADLLGEFSGMGKEVGNLLLENSQLLETKNALNVVKNDLIAKVDQLSGEQEVLKGELEAAKQAKVKLENRIKELEEELKRVKSEAVTARREPREEVEDVSSYLCTELDKIPMAQRRRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASREHPSVQEKKK------STIWQFFSRLF 544          
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. Ensembl Mouse
Match: Mapk8ip3 (mitogen-activated protein kinase 8 interacting protein 3 [Source:MGI Symbol;Acc:MGI:1353598])

HSP 1 Score: 112.849 bits (281), Expect = 1.240e-24
Identity = 66/207 (31.88%), Postives = 114/207 (55.07%), Query Frame = 2
Query:  974 NPSQFDSSSSYFMDPQDLSQRMNRDHSLETNIVDSDTDVTDDEFGIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREELRRHSNREADLKGKLAHLEQELKICKEKLIDSQAXXXX-------XXXXQKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFPEFRESSKPMKAQNSGIWNLFNNLF 1573
            +P+Q   + ++ ++   L   ++   S     VD   D+  +  G+G+E+  ++ EN  L+ TKNALN+VK+DLI ++D ++ E ++L+ EL      +  L+ ++  LE+ELK  K + + ++               +++ F+R EMA +L E+N YKE+LMELQ+AV + EM R  ++ P  +E  K      S IW  F+ LF
Sbjct:  366 SPTQGIVNKAFGINTDSLYHELSTAGSEVIGDVDEGADLLGEFSGMGKEVGNLLLENSQLLETKNALNVVKNDLIAKVDQLSGEQEVLKGELEAAKQAKVKLENRIKELEEELKRVKSEAVTARREPREEVEDDKIPMAQRRRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASREHPSVQEKKK------STIWQFFSRLF 566          

HSP 2 Score: 93.9745 bits (232), Expect = 7.399e-19
Identity = 69/159 (43.40%), Postives = 109/159 (68.55%), Query Frame = 2
Query:  149 MTEKVQILANKIYKEFERLISFYGSDVVEYLMPXXXXXXXXXXXXYRDKHTYEIDVELLKEDNCTLNRQYEREKYLKKQSEERVIHXXXXXXXXXXXXXXXXXXXXSSNRTFEVKFRNANETVSRLEEKVEFLKIENQKIYERYTDVLKSHAEQLNKIK 625
            M+E+V  LA  IY+EFERLI  Y  +VV+ LMPL+VN+LENL+ +  +   +E+++ELL+EDN  L  QYEREK L+KQ+EE+ I  E A E+EKK L+ ++   E   R  E+K +N  + +SRLEE+   +K E   +++R+T++++++ E + + K
Sbjct:   25 MSERVSGLAGSIYREFERLIHCYDEEVVKELMPLVVNVLENLDSVLSENQEHEVELELLREDNEQLLTQYEREKALRKQAEEKFIEFEDALEQEKKELQIQVEHYEFQTRQLELKAKNYADQISRLEERESEMKKEYNALHQRHTEMIQTYVEHIERSK 183          
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. UniProt/SwissProt
Match: sp|Q29EP6|JIP3_DROPS (JNK-interacting protein 3 OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=syd PE=3 SV=2)

HSP 1 Score: 119.398 bits (298), Expect = 8.050e-26
Identity = 68/167 (40.72%), Postives = 103/167 (61.68%), Query Frame = 2
Query: 1082 TDVTDDEFGIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREELRRHSNREADLKGKLAHLEQELKICKEKLIDS---QAXXXXXXXXQKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFPEFRESSKPMKAQNSGIWNLFNNLF 1573
            +   D+ FG+G+E++ +I EN +L+ATKNALNIVKDDLI ++D +T E +++REEL         L+ +++ LE+ELK  KE++      Q   +    ++K F+R EMA++L E+N YKE+LMELQ+AV   E+ R  +      + SK        IW  F+NLF
Sbjct:  356 SSANDNYFGMGKEVENLIMENNELLATKNALNIVKDDLIVKVDELTGEVEIVREELSAMQQSRTKLRQRISELEEELKKTKEQVKQQNTEQEENDVPLAQRKRFTRVEMAMVLMERNQYKERLMELQEAVRLTEILRASRTVDNLDKKSK------QSIWKYFSNLF 516          

HSP 2 Score: 100.138 bits (248), Expect = 7.648e-20
Identity = 72/162 (44.44%), Postives = 107/162 (66.05%), Query Frame = 2
Query:  140 NNGMTEKVQILANKIYKEFERLISFYGSDVVEYLMPXXXXXXXXXXXXYRDKHTYEIDVELLKEDNCTLNRQYEREKYLKKQSEERVIHXXXXXXXXXXXXXXXXXXXXSSNRTFEVKFRNANETVSRLEEKVEFLKIENQKIYERYTDVLKSHAEQLNKIK 625
            N+ +   VQ LA  IY+EFER+I+ Y  DVV+ LMPL+VN+LE L+  YR     ++++ELL+EDN  L  QYEREK  +KQSE++++  E   E+E K L  ++  +ES  R  E+K +N+ E  SRLEE+   LK E  K++ERYT++ K+H + + + K
Sbjct:   35 NDQVVSIVQQLAGSIYQEFERMINRYDEDVVKNLMPLLVNVLECLDASYRINQEQDVELELLREDNEQLVTQYEREKSARKQSEQKLLEAEDLAEQENKELATRLESVESIVRMLELKHKNSLEHASRLEERETDLKKEYNKLHERYTELFKNHVDYMERTK 196          
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. UniProt/SwissProt
Match: sp|Q9GQF1|JIP3_DROME (JNK-interacting protein 3 OS=Drosophila melanogaster OX=7227 GN=syd PE=1 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 1.572e-25
Identity = 68/167 (40.72%), Postives = 101/167 (60.48%), Query Frame = 2
Query: 1082 TDVTDDEFGIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREELRRHSNREADLKGKLAHLEQELKICKEKLIDS---QAXXXXXXXXQKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFPEFRESSKPMKAQNSGIWNLFNNLF 1573
            +   D+ FG+G+E++ +I EN +L+ATKNALNIVKDDLI ++D +T E +++REEL         L+ +++ LE ELK  KE++      Q   +    ++K F+R EMA++L E+N YKE+LMELQ+AV   E+ R  +        SK        IW  F+NLF
Sbjct:  353 SSANDNYFGMGKEVENLIMENNELLATKNALNIVKDDLIVKVDELTGEVEIVREELNAMQQSRTKLRQRISELEDELKKAKEQVKQQNTEQEENDVPLAQRKRFTRVEMAMVLMERNQYKERLMELQEAVRLTEILRASRTVDNLDRKSK------QSIWKYFSNLF 513          

HSP 2 Score: 100.908 bits (250), Expect = 3.484e-20
Identity = 72/155 (46.45%), Postives = 104/155 (67.10%), Query Frame = 2
Query:  161 VQILANKIYKEFERLISFYGSDVVEYLMPXXXXXXXXXXXXYRDKHTYEIDVELLKEDNCTLNRQYEREKYLKKQSEERVIHXXXXXXXXXXXXXXXXXXXXSSNRTFEVKFRNANETVSRLEEKVEFLKIENQKIYERYTDVLKSHAEQLNKIK 625
            VQ LA  IY+EFER+I+ Y  DVV+ LMPL+VN+LE L+  YR     +++VELL+EDN  L  QYEREK  +KQSE++++  E   E+E K L  ++  +ES  R  E+K +N+ E  SRLEE+   LK E  K++ERYT++ K+H + + + K
Sbjct:   42 VQQLAGSIYQEFERMINRYDEDVVKNLMPLLVNVLECLDASYRINQEQDVEVELLREDNEQLVTQYEREKSARKQSEQKLLEAEDLAEQENKELATRLESVESIVRMLELKHKNSLEHASRLEEREADLKKEYNKLHERYTELFKNHVDYMERTK 196          
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. UniProt/SwissProt
Match: sp|Q9UPT6|JIP3_HUMAN (C-Jun-amino-terminal kinase-interacting protein 3 OS=Homo sapiens OX=9606 GN=MAPK8IP3 PE=1 SV=3)

HSP 1 Score: 113.235 bits (282), Expect = 7.054e-24
Identity = 78/253 (30.83%), Postives = 127/253 (50.20%), Query Frame = 2
Query:  899 SNDHW--MTDCCDGETDCNQVHSNNL----KNPSQFDSSSSYFMDPQDLSQRMNRDHSLETNIVDSDTD------VTDDEFGIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREELRRHSNREADLKGKLAHLEQELKICKEKLIDSQAXXXXXX----------------XXQKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFPEFRESSKPMKAQNSGIWNLFNNLF 1573
            S+D W  + D  D   + +      L     +P+Q   + ++ ++   L   ++   S     VD   D      V DD FG+G+E+  ++ EN  L+ TKNALN+VK+DLI ++D ++ E ++LR EL      +  L+ ++  LE+ELK  K + I ++      +                 +++ F+R EMA +L E+N YKE+LMELQ+AV + EM R  ++ P  +E  K      S IW  F+ LF
Sbjct:  334 SSDEWSDVQDIIDSTPELDMCPETRLDRTGSSPTQGIVNKAFGINTDSLYHELSTAGSEVIGDVDEGADLLGEFSVRDDFFGMGKEVGNLLLENSQLLETKNALNVVKNDLIAKVDQLSGEQEVLRGELEAAKQAKVKLENRIKELEEELKRVKSEAIIARREPKEEAEDVSSYLCTESDKIPMAQRRRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASREHPSVQEKKK------STIWQFFSRLF 580          

HSP 2 Score: 93.2041 bits (230), Expect = 1.052e-17
Identity = 68/159 (42.77%), Postives = 109/159 (68.55%), Query Frame = 2
Query:  149 MTEKVQILANKIYKEFERLISFYGSDVVEYLMPXXXXXXXXXXXXYRDKHTYEIDVELLKEDNCTLNRQYEREKYLKKQSEERVIHXXXXXXXXXXXXXXXXXXXXSSNRTFEVKFRNANETVSRLEEKVEFLKIENQKIYERYTDVLKSHAEQLNKIK 625
            M+E+V  LA  IY+EFERLI  Y  +VV+ LMPL+VN+LENL+ +  +   +E+++ELL+EDN  L  QYEREK L++Q+EE+ I  E A E+EKK L+ ++   E   R  E+K +N  + +SRLEE+   +K E   +++R+T++++++ E + + K
Sbjct:   25 MSERVSGLAGSIYREFERLIHCYDEEVVKELMPLVVNVLENLDSVLSENQEHEVELELLREDNEQLLTQYEREKALRRQAEEKFIEFEDALEQEKKELQIQVEHYEFQTRQLELKAKNYADQISRLEERESEMKKEYNALHQRHTEMIQTYVEHIERSK 183          
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. UniProt/SwissProt
Match: sp|E9PSK7|JIP3_RAT (C-Jun-amino-terminal kinase-interacting protein 3 OS=Rattus norvegicus OX=10116 GN=Mapk8ip3 PE=1 SV=2)

HSP 1 Score: 112.849 bits (281), Expect = 9.445e-24
Identity = 66/207 (31.88%), Postives = 114/207 (55.07%), Query Frame = 2
Query:  974 NPSQFDSSSSYFMDPQDLSQRMNRDHSLETNIVDSDTDVTDDEFGIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREELRRHSNREADLKGKLAHLEQELKICKEKLIDSQAXXXX-------XXXXQKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFPEFRESSKPMKAQNSGIWNLFNNLF 1573
            +P+Q   + ++ ++   L   ++   S     VD   D+  +  G+G+E+  ++ EN  L+ TKNALN+VK+DLI ++D ++ E ++L+ EL      +  L+ ++  LE+ELK  K + + ++               +++ F+R EMA +L E+N YKE+LMELQ+AV + EM R  ++ P  +E  K      S IW  F+ LF
Sbjct:  366 SPTQGIVNKAFGINTDSLYHELSTAGSEVIGDVDEGADLLGEFSGMGKEVGNLLLENSQLLETKNALNVVKNDLIAKVDQLSGEQEVLKGELEAAKQAKVKLENRIKELEEELKRVKSEAVTARREPREEVEDDKIPMAQRRRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASREHPSVQEKKK------STIWQFFSRLF 566          

HSP 2 Score: 93.9745 bits (232), Expect = 5.088e-18
Identity = 69/159 (43.40%), Postives = 109/159 (68.55%), Query Frame = 2
Query:  149 MTEKVQILANKIYKEFERLISFYGSDVVEYLMPXXXXXXXXXXXXYRDKHTYEIDVELLKEDNCTLNRQYEREKYLKKQSEERVIHXXXXXXXXXXXXXXXXXXXXSSNRTFEVKFRNANETVSRLEEKVEFLKIENQKIYERYTDVLKSHAEQLNKIK 625
            M+E+V  LA  IY+EFERLI  Y  +VV+ LMPL+VN+LENL+ +  +   +E+++ELL+EDN  L  QYEREK L+KQ+EE+ I  E A E+EKK L+ ++   E   R  E+K +N  + +SRLEE+   +K E   +++R+T++++++ E + + K
Sbjct:   25 MSERVSGLAGSIYREFERLIHCYDEEVVKELMPLVVNVLENLDSVLSENQEHEVELELLREDNEQLLTQYEREKALRKQAEEKFIEFEDALEQEKKELQIQVEHYEFQTRQLELKAKNYADQISRLEERESEMKKEYNALHQRHTEMIQTYVEHIERSK 183          
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. UniProt/SwissProt
Match: sp|Q9ESN9|JIP3_MOUSE (C-Jun-amino-terminal kinase-interacting protein 3 OS=Mus musculus OX=10090 GN=Mapk8ip3 PE=1 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 1.584e-23
Identity = 70/222 (31.53%), Postives = 116/222 (52.25%), Query Frame = 2
Query:  974 NPSQFDSSSSYFMDPQDLSQRMNRDHSLETNIVDSDTD------VTDDEFGIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREELRRHSNREADLKGKLAHLEQELKICKEKLIDSQAXXXX----------------XXXXQKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFPEFRESSKPMKAQNSGIWNLFNNLF 1573
            +P+Q   + ++ ++   L   ++   S     VD   D      V DD FG+G+E+  ++ EN  L+ TKNALN+VK+DLI ++D ++ E ++L+ EL      +  L+ ++  LE+ELK  K + + ++                        +++ F+R EMA +L E+N YKE+LMELQ+AV + EM R  ++ P  +E  K      S IW  F+ LF
Sbjct:  366 SPTQGIVNKAFGINTDSLYHELSTAGSEVIGDVDEGADLLGEFSVRDDFFGMGKEVGNLLLENSQLLETKNALNVVKNDLIAKVDQLSGEQEVLKGELEAAKQAKVKLENRIKELEEELKRVKSEAVTARREPREEVEDVSSYLCTELDKIPMAQRRRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASREHPSVQEKKK------STIWQFFSRLF 581          

HSP 2 Score: 93.9745 bits (232), Expect = 4.943e-18
Identity = 69/159 (43.40%), Postives = 109/159 (68.55%), Query Frame = 2
Query:  149 MTEKVQILANKIYKEFERLISFYGSDVVEYLMPXXXXXXXXXXXXYRDKHTYEIDVELLKEDNCTLNRQYEREKYLKKQSEERVIHXXXXXXXXXXXXXXXXXXXXSSNRTFEVKFRNANETVSRLEEKVEFLKIENQKIYERYTDVLKSHAEQLNKIK 625
            M+E+V  LA  IY+EFERLI  Y  +VV+ LMPL+VN+LENL+ +  +   +E+++ELL+EDN  L  QYEREK L+KQ+EE+ I  E A E+EKK L+ ++   E   R  E+K +N  + +SRLEE+   +K E   +++R+T++++++ E + + K
Sbjct:   25 MSERVSGLAGSIYREFERLIHCYDEEVVKELMPLVVNVLENLDSVLSENQEHEVELELLREDNEQLLTQYEREKALRKQAEEKFIEFEDALEQEKKELQIQVEHYEFQTRQLELKAKNYADQISRLEERESEMKKEYNALHQRHTEMIQTYVEHIERSK 183          
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. TrEMBL
Match: A0A1I7SQR8 (Uncharacterized protein OS=Bursaphelenchus xylophilus OX=6326 PE=4 SV=1)

HSP 1 Score: 205.297 bits (521), Expect = 5.254e-50
Identity = 191/602 (31.73%), Postives = 312/602 (51.83%), Query Frame = 2
Query:  149 MTEKVQILANKIYKEFERLISFYGSDVVEYLMPXXXXXXXXXXXXYRDKHTYEIDVELLKEDNCTLNRQYEREKYLKKQSEERVIHXXXXXXXXXXXXXXXXXXXXSSNRTFEVKFRNANETVSRLEEKVEFLKIENQKIYERYTDVLKSHAEQLNKIKAETCRDISPPFSL--SIRDLENRSTKSLIRDLRLKNNIQNSVIIPNKLLDPEHSNPDL-NHLHDENFDIFDEKNXXXXXXXXXXHQGETVADILSNDHWMTDCCDGETDCNQVHSNNLKNPSQFDSSSSYFMDPQD-LSQRMNRDHSLETNIVDSDTDVTDDEFGIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREELRRHSNREADLKGKLAHLEQELKICKEKLIDSQAXXXX--XXXXQKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFPEFRESSKPMKAQNSGIWNLFNNLFKKE---------------------------DELSIQMKEKS------KSLLSRFKRESD-RSQLYSWSVPRSLVESELPKRIPIPIKIQTIF--EPKDIVICATTG--YGSTVGNDSAQYL 1822
            M+EKVQ+LA+ IYKE E +I  YG + V+ LMPL+VN+LE+L+  Y DK  + +DVE+LKE+N  L  QYERE+  +KQ +++ + +E    ++ + LE K+  LE + R  E+K RNAN+ V+R EE+   L+ E  K++ERY D++++H E + + K     D    F +  S+    NR   +   D+ ++    + +I    +    H++ +L NH+  E  D  DE              G+   D+L++     D  D + +  Q          Q D+  S   +P D LS  +                      G+GRE+D +I+EN +L+ TKNALN+VK+DLI ++D +++EN++LR+EL      +A    K+  LEQE+K  KEK+ + Q  E       ++K F+R EMA +L E+N YKEKLMELQ+AV Y EM RVKK       + +P +++   IW+ F+ LF +                            D  ++Q K KS      K++    K++ + R++ Y WS+P +  +++  + +P+P+  + +   +P   + CA+    YG    N   +Y+
Sbjct:  111 MSEKVQMLASSIYKELEMMIKKYGEESVKELMPLVVNVLESLDTAYVDKDEHAVDVEMLKEENEQLLNQYERERQTRKQQDQKYLELEEVLTDQNRELEGKVEQLEGNIRVLELKARNANDHVARCEEREAELRTEYDKLHERYNDLIRTHIEHVERTKYLMGPD---KFDMMQSLPSNHNRGGMAASVDVNVRG--ISDLISATHMTQSTHASVNLANHISMEK-DFHDEF-------------GQDTEDLLNSSR--KDGQDAKEELEQAE-------GQPDTQRSEEEEPDDGLSAELT---------------------GMGREVDNLIKENTELLETKNALNVVKNDLIAQVDQLSSENEVLRDELNSMEISKAKNAEKIKELEQEIKTLKEKINEEQPDEQEDIPMAQRKRFTRVEMARVLMERNQYKEKLMELQEAVKYTEMQRVKKL------NHQPSQSKGR-IWDFFSGLFGETPVPTPSKRPQRSSSQVRKQRLTRTFDIDMDNVQEKRKSERRQQYKAVSQHMKKDDESRTRAYGWSIPVT-SDNQTVQHVPVPVCCRPLLDQQPSLRIWCASGSVLYGGK--NTDGEYI 653          
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. TrEMBL
Match: A0A0A9WK50 (JNK-interacting protein 3 OS=Lygus hesperus OX=30085 GN=syd_4 PE=4 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 1.730e-49
Identity = 180/527 (34.16%), Postives = 272/527 (51.61%), Query Frame = 2
Query:  149 MTEKVQILANKIYKEFERLISFYGSDVVEYLMPXXXXXXXXXXXXYRDKHTYEIDVELLKEDNCTLNRQYEREKYLKKQSEERVIHXXXXXXXXXXXXXXXXXXXXSSNRTFEVKFRNANETVSRLEEKVEFLKIENQKIYERYTDVLKSHAEQLNKIKAETCRD--------------------ISPPFSLSIRDLENRSTKSLIRDLRLKNNIQNSVIIPNKLLDPEHSNPDLNHLHDENFDIFDEKNXXXXXXXXXXHQGETVA----DILSNDHWMTDCCDGETDCNQVHSNNLKNPSQFDSSSSY----------------FMDPQDLSQRMNRDHSLETNIV---DSDTDVTDDEFGIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREELRRHSNREADLKGKLAHLEQELKICKEKLIDSQAXXX-----XXXXXQKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFPEFRESSKPMKAQNSGIWNLFNNLFKKED 1585
            M++KVQ LA  IY+EFE++I+ Y  DVV+YLMPL+VN+LE+L+  Y +   + +++ELL+EDN  L  QYEREK L+K S+++++ +E   E E+K    KI  LES  R  E+K +N+++ V RLEEK +  K E  K++ERYT++ K+H + + + K  +  D                     S P S   + LEN    SL R      N  +    P     P  SN     L +E   + + ++D S    S     ET++    D+           D   DC     N    P    +  S                 F D + L + M+    +    V   D  + V D+ +G+GRE++ +I EN +L+ATKNALNIVKDDLI ++D +T+E ++LREE R+ S   A  K K+A LE E+K  KE L  ++ +++         ++K F+R EMA +L E+N YKE+ MELQ+AV + EM R  +  P+  + SK        +W  F++LF   D
Sbjct:   16 MSDKVQSLAGSIYQEFEKMIAKYDEDVVKYLMPLVVNVLESLDLSYSENQEHLVELELLREDNEQLVTQYEREKQLRKASDQKLLEVEDLIEFERKEKNGKIESLESIVRMLELKAKNSSDHVYRLEEKEQESKKEYNKLHERYTELFKTHMDLIERTKLLSSGDRLDVHSRQRVPSLPFSQMNRSSGPVSFGFQSLENSQMSSLAR------NSASPGEFPTVPSSPPESNHSATSLRNELEVVENTEDDTSLREVSEKGWSETLSPNSKDV---------SPDSSDDCPPPARNWASPPVTTPTGRSTTKKEQRSGNTLYQELSFQDAEALGE-MDEGADITGGWVHPGDYASSVNDNFYGMGREVENLIMENNELLATKNALNIVKDDLIIKVDELTSEQEILREENRQISALNARYKQKIADLEAEIKKMKEDLEGAKTNKSDDEEDVPMAQRKRFTRVEMARVLMERNQYKERFMELQEAVRFTEMMRASRNDPDLDKKSK------QSVWKFFSSLFSSND 520          
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. TrEMBL
Match: A0A182YJ26 (Uncharacterized protein OS=Anopheles stephensi OX=30069 PE=4 SV=1)

HSP 1 Score: 203.371 bits (516), Expect = 1.929e-49
Identity = 178/529 (33.65%), Postives = 270/529 (51.04%), Query Frame = 2
Query:  149 MTEKVQILANKIYKEFERLISFYGSDVVEYLMPXXXXXXXXXXXXYRDKHTYEIDVELLKEDNCTLNRQYEREKYLKKQSEERVIHXXXXXXXXXXXXXXXXXXXXSSNRTFEVKFRNANETVSRLEEKVEFLKIENQKIYERYTDVLKSHAEQLNKIKAETCRDI-SPPFSLSIR-DLENRSTKSLIRDLRLKN----NIQNSVIIPNKLL------DPEHSNPDL-NHLHDENFDIFDEKNXXXXXXXXXXHQGETVADILSNDHWMTDCCDGETDCN--QVHSNNLKNPSQFDSSSSYFMDPQDLSQRMNRDHSLETNIVDSDTDVTDDEFGIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREELRRHSNREADLKGKLAHLEQELKICKEKL-------IDSQAXXXXXXXXQKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFPEFRESSKPMKAQNSGIWNLFNNLFKKEDELSIQMKEKSKSLLSRFKRESDRSQLYS 1669
            M+EKVQ LA  IY+EFER+I  Y  DVV+ LMPL+VN+LE L+  Y+     ++++ELL+EDN  L  QYEREK  +KQSE++++  E   E+E K L  ++  LES  R  E+K +N+ +  SRLEE+   LK E  K++ERYT++ K+H + + + K        S   S S R D+       ++R     +    +++NS ++  + L       P+   P L N +  +  +  +E +  + +         T A +L +         G+T     Q  +N L     F           +L    N       +  D  +   D+ FG+G+E++ +I EN +L+ATKNALNIVKDDLI ++D +T E ++LREEL         LK K+  LE+ELK  K ++        D +   +    ++K F+R EMA +L E+N YKE+ MELQDAV + EM R  +      + SK       GIW  F+NLF   D  +    E    L  R+   S +SQ + 
Sbjct:   23 MSEKVQSLAGSIYQEFERMIQRYDEDVVKTLMPLLVNVLECLDSAYQTNQEQDVELELLREDNEQLVTQYEREKNARKQSEQKLLETEDLAEQENKELASRLESLESIVRMLELKHKNSMDHASRLEERESELKKEYSKLHERYTELFKTHVDYMERTKLMMGNSTHSQAGSASERLDVSRSRLMPMMRSTGPVSYGFASLENSTMLDTETLCSEEDSGPDSGPPSLQNEIETKATEKVEEVDSATTAPADGMATSSTTAKVLQSPTSGGGGVSGKTTTKKEQRSANTLYQELSFQD--------DNLESEENEITGAWVHPGDYASSANDNFFGMGKEVENLIMENNELLATKNALNIVKDDLIVKVDELTGEIEILREELNAVILARNKLKAKVTELEEELKKTKAQVKQASASATDQEEEGDVPMAQRKRFTRVEMARVLMERNQYKERFMELQDAVRWTEMMRASR-VENLDKKSK------QGIWKFFSNLFSSNDRPT---NESPGRLHQRYGGVSAQSQAHG 533          
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. TrEMBL
Match: A0A0A9WTG8 (JNK-interacting protein 3 OS=Lygus hesperus OX=30085 GN=syd_3 PE=4 SV=1)

HSP 1 Score: 197.208 bits (500), Expect = 4.103e-49
Identity = 180/527 (34.16%), Postives = 272/527 (51.61%), Query Frame = 2
Query:  149 MTEKVQILANKIYKEFERLISFYGSDVVEYLMPXXXXXXXXXXXXYRDKHTYEIDVELLKEDNCTLNRQYEREKYLKKQSEERVIHXXXXXXXXXXXXXXXXXXXXSSNRTFEVKFRNANETVSRLEEKVEFLKIENQKIYERYTDVLKSHAEQLNKIKAETCRD--------------------ISPPFSLSIRDLENRSTKSLIRDLRLKNNIQNSVIIPNKLLDPEHSNPDLNHLHDENFDIFDEKNXXXXXXXXXXHQGETVA----DILSNDHWMTDCCDGETDCNQVHSNNLKNPSQFDSSSSY----------------FMDPQDLSQRMNRDHSLETNIV---DSDTDVTDDEFGIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREELRRHSNREADLKGKLAHLEQELKICKEKLIDSQAXXX-----XXXXXQKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFPEFRESSKPMKAQNSGIWNLFNNLFKKED 1585
            M++KVQ LA  IY+EFE++I+ Y  DVV+YLMPL+VN+LE+L+  Y +   + +++ELL+EDN  L  QYEREK L+K S+++++ +E   E E+K    KI  LES  R  E+K +N+++ V RLEEK +  K E  K++ERYT++ K+H + + + K  +  D                     S P S   + LEN    SL R      N  +    P     P  SN     L +E   + + ++D S    S     ET++    D+           D   DC     N    P    +  S                 F D + L + M+    +    V   D  + V D+ +G+GRE++ +I EN +L+ATKNALNIVKDDLI ++D +T+E ++LREE R+ S   A  K K+A LE E+K  KE L  ++ +++         ++K F+R EMA +L E+N YKE+ MELQ+AV + EM R  +  P+  + SK        +W  F++LF   D
Sbjct:   16 MSDKVQSLAGSIYQEFEKMIAKYDEDVVKYLMPLVVNVLESLDLSYSENQEHLVELELLREDNEQLVTQYEREKQLRKASDQKLLEVEDLIEFERKEKNGKIESLESIVRMLELKAKNSSDHVYRLEEKEQESKKEYNKLHERYTELFKTHMDLIERTKLLSSGDRLDVHSRQRVPSLPFSQMNRSSGPVSFGFQSLENSQMSSLAR------NSASPGEFPTVPSSPPESNHSATSLRNELEVVENTEDDTSLREVSEKGWSETLSPNSKDV---------SPDSSDDCPPPARNWASPPVTTPTGRSTTKKEQRSGNTLYQELSFQDAEALGE-MDEGADITGGWVHPGDYASSVNDNFYGMGREVENLIMENNELLATKNALNIVKDDLIIKVDELTSEQEILREENRQISALNARYKQKIADLEAEIKKMKEDLEGAKTNKSDDEEDVPMAQRKRFTRVEMARVLMERNQYKERFMELQEAVRFTEMMRASRNDPDLDKKSK------QSVWKFFSSLFSSND 520          
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. TrEMBL
Match: A0A0A9WG44 (JNK-interacting protein 3 OS=Lygus hesperus OX=30085 GN=syd_13 PE=4 SV=1)

HSP 1 Score: 193.741 bits (491), Expect = 1.926e-48
Identity = 178/520 (34.23%), Postives = 268/520 (51.54%), Query Frame = 2
Query:  149 MTEKVQILANKIYKEFERLISFYGSDVVEYLMPXXXXXXXXXXXXYRDKHTYEIDVELLKEDNCTLNRQYEREKYLKKQSEERVIHXXXXXXXXXXXXXXXXXXXXSSNRTFEVKFRNANETVSRLEEKVEFLKIENQKIYERYTDVLKSHAEQLNKIKAETCRD--------------------ISPPFSLSIRDLENRSTKSLIRDLRLKNNIQNSVIIPNKLLDPEHSNPDLNHLHDENFDIFDEKNXXXXXXXXXXHQGETVA----DILSNDHWMTDCCDGETDCNQVHSNNLKNPSQFDSSSSYFMDPQ----DLSQRMNRDHSLETNIVDSDTDVTDD--------EFGIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREELRRHSNREADLKGKLAHLEQELKICKEKLIDSQAXXX-----XXXXXQKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFPEFRESSKPMKAQNSGIWNLFNNLFKKED 1585
            M++KVQ LA  IY+EFE++I+ Y  DVV+YLMPL+VN+LE+L+  Y +   + +++ELL+EDN  L  QYEREK L+K S+++++ +E   E E+K    KI  LES  R  E+K +N+++ V RLEEK +  K E  K++ERYT++ K+H + + + K  +  D                     S P S   + LEN    SL R      N  +    P     P  SN     L +E   + + ++D S    S     ET++    D+           D   DC     N    P    +  S     Q     L Q ++   +     +D   D+T            G+GRE++ +I EN +L+ATKNALNIVKDDLI ++D +T+E ++LREE R+ S   A  K K+A LE E+K  KE L  ++ +++         ++K F+R EMA +L E+N YKE+ MELQ+AV + EM R  +  P+  + SK        +W  F++LF   D
Sbjct:   16 MSDKVQSLAGSIYQEFEKMIAKYDEDVVKYLMPLVVNVLESLDLSYSENQEHLVELELLREDNEQLVTQYEREKQLRKASDQKLLEVEDLIEFERKEKNGKIESLESIVRMLELKAKNSSDHVYRLEEKEQESKKEYNKLHERYTELFKTHMDLIERTKLLSSGDRLDVHSRQRVPSLPFSQMNRSSGPVSFGFQSLENSQMSSLAR------NSASPGEFPTVPSSPPESNHSATSLRNELEVVENTEDDTSLREVSEKGWSETLSPNSKDV---------SPDSSDDCPPPARNWASPPVTTPTGRSTTKKEQRSGNTLYQELSFQDAEALGEMDEGADITGGWVHPGDYASSGMGREVENLIMENNELLATKNALNIVKDDLIIKVDELTSEQEILREENRQISALNARYKQKIADLEAEIKKMKEDLEGAKTNKSDDEEDVPMAQRKRFTRVEMARVLMERNQYKERFMELQEAVRFTEMMRASRNDPDLDKKSK------QSVWKFFSSLFSSND 514          
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. Ensembl Cavefish
Match: mapk8ip3 (mitogen-activated protein kinase 8 interacting protein 3 [Source:NCBI gene;Acc:103035578])

HSP 1 Score: 113.62 bits (283), Expect = 5.452e-25
Identity = 71/184 (38.59%), Postives = 109/184 (59.24%), Query Frame = 2
Query: 1070 VDSDTD--VTDDEFGIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREELRRHSNREADLKGKLAHLEQELK-ICKEKLIDSQ-------------AXXXXXXXXQKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFPEFRESSKPMKAQNSGIWNLFNNLF 1573
            VDS  +  V DD FG+G+E++ ++ EN+ L+ TKNALNIVK+DLI ++D ++ E ++LREEL      +  +  ++  LE+ELK +  E L  SQ               ++ +  +++ F+R EMA +L E+N YKE+LMELQ+AV + EM R  ++ P+ +E  K      S IW  F  LF
Sbjct:  393 VDSGAELLVRDDFFGMGKEVENLLTENKQLLETKNALNIVKNDLIAKVDELSGEQEVLREELEAVKQSKNKVDSRVKELEEELKRLRAEALGASQDSKDEGGEDYSSTLQDDVAMTQRRRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASRESPQMQEKKK------STIWQFFARLF 570          

HSP 2 Score: 95.1301 bits (235), Expect = 2.962e-19
Identity = 71/159 (44.65%), Postives = 110/159 (69.18%), Query Frame = 2
Query:  149 MTEKVQILANKIYKEFERLISFYGSDVVEYLMPXXXXXXXXXXXXYRDKHTYEIDVELLKEDNCTLNRQYEREKYLKKQSEERVIHXXXXXXXXXXXXXXXXXXXXSSNRTFEVKFRNANETVSRLEEKVEFLKIENQKIYERYTDVLKSHAEQLNKIK 625
            M+E+V  LAN IY+EFERLI  Y  +VV+ LMPL+VN+LENL+ +  +   +E+++ELLKEDN  L  QYEREK L+KQ+EE+ I  E A E EKK L+ ++  LE   +  E+K +N  + +SRLEE+   +K E   +++R+T++++++ E + + K
Sbjct:   21 MSERVSGLANSIYREFERLIRSYDEEVVKELMPLVVNVLENLDAVLTENQEHEVELELLKEDNEQLITQYEREKALRKQAEEKFIEFEDALEAEKKDLQSQVDFLELQGKQLELKTKNYADQISRLEEREGDMKKEYNALHQRHTEMIQTYVEHIERSK 179          
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. Ensembl Cavefish
Match: mapk8ip3 (mitogen-activated protein kinase 8 interacting protein 3 [Source:NCBI gene;Acc:103035578])

HSP 1 Score: 112.849 bits (281), Expect = 8.823e-25
Identity = 68/176 (38.64%), Postives = 105/176 (59.66%), Query Frame = 2
Query: 1088 VTDDEFGIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREELRRHSNREADLKGKLAHLEQELK-ICKEKLIDSQ-------------AXXXXXXXXQKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFPEFRESSKPMKAQNSGIWNLFNNLF 1573
            V DD FG+G+E++ ++ EN+ L+ TKNALNIVK+DLI ++D ++ E ++LREEL      +  +  ++  LE+ELK +  E L  SQ               ++ +  +++ F+R EMA +L E+N YKE+LMELQ+AV + EM R  ++ P+ +E  K      S IW  F  LF
Sbjct:  405 VRDDFFGMGKEVENLLTENKQLLETKNALNIVKNDLIAKVDELSGEQEVLREELEAVKQSKNKVDSRVKELEEELKRLRAEALGASQDSKDEGGEDYSSTLQDDVAMTQRRRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASRESPQMQEKKK------STIWQFFARLF 574          

HSP 2 Score: 95.1301 bits (235), Expect = 2.830e-19
Identity = 71/159 (44.65%), Postives = 110/159 (69.18%), Query Frame = 2
Query:  149 MTEKVQILANKIYKEFERLISFYGSDVVEYLMPXXXXXXXXXXXXYRDKHTYEIDVELLKEDNCTLNRQYEREKYLKKQSEERVIHXXXXXXXXXXXXXXXXXXXXSSNRTFEVKFRNANETVSRLEEKVEFLKIENQKIYERYTDVLKSHAEQLNKIK 625
            M+E+V  LAN IY+EFERLI  Y  +VV+ LMPL+VN+LENL+ +  +   +E+++ELLKEDN  L  QYEREK L+KQ+EE+ I  E A E EKK L+ ++  LE   +  E+K +N  + +SRLEE+   +K E   +++R+T++++++ E + + K
Sbjct:   21 MSERVSGLANSIYREFERLIRSYDEEVVKELMPLVVNVLENLDAVLTENQEHEVELELLKEDNEQLITQYEREKALRKQAEEKFIEFEDALEAEKKDLQSQVDFLELQGKQLELKTKNYADQISRLEEREGDMKKEYNALHQRHTEMIQTYVEHIERSK 179          
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. Ensembl Cavefish
Match: mapk8ip3 (mitogen-activated protein kinase 8 interacting protein 3 [Source:NCBI gene;Acc:103035578])

HSP 1 Score: 112.849 bits (281), Expect = 9.509e-25
Identity = 68/176 (38.64%), Postives = 105/176 (59.66%), Query Frame = 2
Query: 1088 VTDDEFGIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREELRRHSNREADLKGKLAHLEQELK-ICKEKLIDSQ-------------AXXXXXXXXQKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFPEFRESSKPMKAQNSGIWNLFNNLF 1573
            V DD FG+G+E++ ++ EN+ L+ TKNALNIVK+DLI ++D ++ E ++LREEL      +  +  ++  LE+ELK +  E L  SQ               ++ +  +++ F+R EMA +L E+N YKE+LMELQ+AV + EM R  ++ P+ +E  K      S IW  F  LF
Sbjct:  405 VRDDFFGMGKEVENLLTENKQLLETKNALNIVKNDLIAKVDELSGEQEVLREELEAVKQSKNKVDSRVKELEEELKRLRAEALGASQDSKDEGGEDYSSTLQDDVAMTQRRRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASRESPQMQEKKK------STIWQFFARLF 574          

HSP 2 Score: 95.1301 bits (235), Expect = 2.755e-19
Identity = 71/159 (44.65%), Postives = 110/159 (69.18%), Query Frame = 2
Query:  149 MTEKVQILANKIYKEFERLISFYGSDVVEYLMPXXXXXXXXXXXXYRDKHTYEIDVELLKEDNCTLNRQYEREKYLKKQSEERVIHXXXXXXXXXXXXXXXXXXXXSSNRTFEVKFRNANETVSRLEEKVEFLKIENQKIYERYTDVLKSHAEQLNKIK 625
            M+E+V  LAN IY+EFERLI  Y  +VV+ LMPL+VN+LENL+ +  +   +E+++ELLKEDN  L  QYEREK L+KQ+EE+ I  E A E EKK L+ ++  LE   +  E+K +N  + +SRLEE+   +K E   +++R+T++++++ E + + K
Sbjct:   21 MSERVSGLANSIYREFERLIRSYDEEVVKELMPLVVNVLENLDAVLTENQEHEVELELLKEDNEQLITQYEREKALRKQAEEKFIEFEDALEAEKKDLQSQVDFLELQGKQLELKTKNYADQISRLEEREGDMKKEYNALHQRHTEMIQTYVEHIERSK 179          
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. Ensembl Cavefish
Match: mapk8ip3 (mitogen-activated protein kinase 8 interacting protein 3 [Source:NCBI gene;Acc:103035578])

HSP 1 Score: 112.849 bits (281), Expect = 9.661e-25
Identity = 68/176 (38.64%), Postives = 105/176 (59.66%), Query Frame = 2
Query: 1088 VTDDEFGIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREELRRHSNREADLKGKLAHLEQELK-ICKEKLIDSQ-------------AXXXXXXXXQKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFPEFRESSKPMKAQNSGIWNLFNNLF 1573
            V DD FG+G+E++ ++ EN+ L+ TKNALNIVK+DLI ++D ++ E ++LREEL      +  +  ++  LE+ELK +  E L  SQ               ++ +  +++ F+R EMA +L E+N YKE+LMELQ+AV + EM R  ++ P+ +E  K      S IW  F  LF
Sbjct:  405 VRDDFFGMGKEVENLLTENKQLLETKNALNIVKNDLIAKVDELSGEQEVLREELEAVKQSKNKVDSRVKELEEELKRLRAEALGASQDSKDEGGEDYSSTLQDDVAMTQRRRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASRESPQMQEKKK------STIWQFFARLF 574          

HSP 2 Score: 95.1301 bits (235), Expect = 2.567e-19
Identity = 71/159 (44.65%), Postives = 110/159 (69.18%), Query Frame = 2
Query:  149 MTEKVQILANKIYKEFERLISFYGSDVVEYLMPXXXXXXXXXXXXYRDKHTYEIDVELLKEDNCTLNRQYEREKYLKKQSEERVIHXXXXXXXXXXXXXXXXXXXXSSNRTFEVKFRNANETVSRLEEKVEFLKIENQKIYERYTDVLKSHAEQLNKIK 625
            M+E+V  LAN IY+EFERLI  Y  +VV+ LMPL+VN+LENL+ +  +   +E+++ELLKEDN  L  QYEREK L+KQ+EE+ I  E A E EKK L+ ++  LE   +  E+K +N  + +SRLEE+   +K E   +++R+T++++++ E + + K
Sbjct:   21 MSERVSGLANSIYREFERLIRSYDEEVVKELMPLVVNVLENLDAVLTENQEHEVELELLKEDNEQLITQYEREKALRKQAEEKFIEFEDALEAEKKDLQSQVDFLELQGKQLELKTKNYADQISRLEEREGDMKKEYNALHQRHTEMIQTYVEHIERSK 179          
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. Ensembl Cavefish
Match: mapk8ip3 (mitogen-activated protein kinase 8 interacting protein 3 [Source:NCBI gene;Acc:103035578])

HSP 1 Score: 109.768 bits (273), Expect = 8.659e-24
Identity = 67/182 (36.81%), Postives = 107/182 (58.79%), Query Frame = 2
Query: 1070 VDSDTDVTDDEFGIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREELRRHSNREADLKGKLAHLEQELK-ICKEKLIDSQ-------------AXXXXXXXXQKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFPEFRESSKPMKAQNSGIWNLFNNLF 1573
            VDS  ++  +  G+G+E++ ++ EN+ L+ TKNALNIVK+DLI ++D ++ E ++LREEL      +  +  ++  LE+ELK +  E L  SQ               ++ +  +++ F+R EMA +L E+N YKE+LMELQ+AV + EM R  ++ P+ +E  K      S IW  F  LF
Sbjct:  393 VDSGAELLGEFSGMGKEVENLLTENKQLLETKNALNIVKNDLIAKVDELSGEQEVLREELEAVKQSKNKVDSRVKELEEELKRLRAEALGASQDSKDEGGEDYSSTLQDDVAMTQRRRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASRESPQMQEKKK------STIWQFFARLF 568          

HSP 2 Score: 95.1301 bits (235), Expect = 2.837e-19
Identity = 71/159 (44.65%), Postives = 110/159 (69.18%), Query Frame = 2
Query:  149 MTEKVQILANKIYKEFERLISFYGSDVVEYLMPXXXXXXXXXXXXYRDKHTYEIDVELLKEDNCTLNRQYEREKYLKKQSEERVIHXXXXXXXXXXXXXXXXXXXXSSNRTFEVKFRNANETVSRLEEKVEFLKIENQKIYERYTDVLKSHAEQLNKIK 625
            M+E+V  LAN IY+EFERLI  Y  +VV+ LMPL+VN+LENL+ +  +   +E+++ELLKEDN  L  QYEREK L+KQ+EE+ I  E A E EKK L+ ++  LE   +  E+K +N  + +SRLEE+   +K E   +++R+T++++++ E + + K
Sbjct:   21 MSERVSGLANSIYREFERLIRSYDEEVVKELMPLVVNVLENLDAVLTENQEHEVELELLKEDNEQLITQYEREKALRKQAEEKFIEFEDALEAEKKDLQSQVDFLELQGKQLELKTKNYADQISRLEEREGDMKKEYNALHQRHTEMIQTYVEHIERSK 179          
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. Ensembl Nematostella
Match: EDO47039 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNC5])

HSP 1 Score: 161.77 bits (408), Expect = 2.274e-40
Identity = 156/512 (30.47%), Postives = 258/512 (50.39%), Query Frame = 2
Query:  119 SSDNENLNNGMTEKVQILANKIYKEFERLISFYGSDVVEYLMPXXXXXXXXXXXXYRDKHTYEIDVELLKEDNCTLNRQYEREKYLKKQSEERVIHXXXXXXXXXXXXXXXXXXXXSSNRTFEVKFRNANETVSRLEEKVEFLKIENQKIYERYTDVLKSHAEQLNKIKAETCRDISPP----------FSLSIRDLENRSTKSLIRDLRLKN------NIQNSVIIPNK----LLDPEHSNPDLNHLHDENFDIFDEKNXXXXXXXXXXHQGETVADILSNDHWMTDCC---DGETDCNQVHSNNLKNPSQFDSSSSYFMDPQDLSQRMNRDHSLETNIVDSDTDVTDDEFGIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREELRRHSNREADLKGKLAHLEQELKICK---EKLIDSQAXXXXXXXXQKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFP-EFRESSKPMKAQNSGIWNLFNNLF 1573
            SS  E     M+E+V  LAN IY EFER+I  Y  DVV  LMPL+V++LE L+  Y D +   +++E+L +DN  L  QYEREK L+K +E R + IE   E EK+  E+ I  LE  NR  E + ++  + V RLEE++  +K E   +++R+++V++ + E++ + +  +      P            LS      +S  + +  L + N      ++ N  I+  +    +L P  S+  L  +  +   I     +                  LS  + +T+      G +  N+  S +L+N  +  ++SS F    +LS       S E +++    D   D   +GRE++ +++EN++LV  KN L   K+DL+ RL+ ++N+ +++ EEL+     +  +  ++   E ELK  K   EK   +    + S+  +K F+R EMA +L E+N YKE+LMELQ+AV + EM R  K+   E ++  K      S IW  F+NLF
Sbjct:   13 SSGEEGGTTVMSERVSNLANSIYSEFERMIQKYDQDVVSGLMPLMVSVLEQLDSAYGDNNEQLVELEILSDDNEQLITQYEREKQLRKLAENRYLEIEDQIEAEKRNAEKDIESLEHDNRGLEARIKSYQDHVERLEERISEMKREYGSLHQRHSEVVQHYMERIERAEKRSIASTETPQKGLNRYLHMLKLSSSTGLEKSQGANVDGLDVNNSTCSISDVDNLPIVSAREAANMLTPGSSDVSLTGISKDAAAILASTPE------------------LSGSNVVTEVARREKGSSSANRPVSLDLENLPEGVAASSLF---AELS-------SEEPDVI-GQMDTGADIIAMGRELENVMKENKELVTVKNKLETQKNDLLKRLEELSNDKEVMTEELKSLQEVKQRMNIRVTECEHELKRTKHEAEKATVALKEASVSAAHRKRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASKERNLELQQKKK------SSIWKFFSNLF 489          
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. Ensembl Medaka
Match: mapk8ip3 (mitogen-activated protein kinase 8 interacting protein 3 [Source:NCBI gene;Acc:101157621])

HSP 1 Score: 175.637 bits (444), Expect = 3.362e-44
Identity = 158/521 (30.33%), Postives = 265/521 (50.86%), Query Frame = 2
Query:  149 MTEKVQILANKIYKEFERLISFYGSDVVEYLMPXXXXXXXXXXXXYRDKHTYEIDVELLKEDNCTLNRQYEREKYLKKQSEERVIHXXXXXXXXXXXXXXXXXXXXSSNRTFEVKFRNANETVSRLEEKVEFLKIENQKIYERYTDVLKSHAEQLNKIKAETCRDIS--------------PPFSLSIR--------DLENRSTKSLIRDLRLKNNIQNSVIIPNKLLDPEHSNPDLNHLHDENFDIFDEKNXXXXXXXXXXHQGETVA--------DILSNDHW--MTDCCDGETDCNQVHSNNLKNPSQFDSSSSYFMDPQDLSQRMNRDHSLETNIVDSDTDVTDDEFGIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREELRRHSNREADLKGKLAHLEQELKICKEKLIDSQAXXX--------------XXXXXQKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFPEFRESSKPMKAQNSGIWNLFNNLF 1573
            M+E+V  +AN IY+EFERLI  Y  +VV+ LMPL+VN+LENL+ +  +   +E+++ELLKEDN  L  QYEREK L+KQ+EE+ I  E A E EKK L+ ++  LE   +  E+K +N ++ ++RLEE+   LK E   +++R+T++++++ E + + K +     S              PP SLS+           E+ S  +       K+N   S + P+  + P +       L   +FD+    N +        +    V+         + S+D W    +  D   +          +P Q   + ++ ++   L   +    S     VD+  ++  +  G+G+E++ ++ EN+ L+ TKNALNIVK+DLI ++D ++ E ++LREEL      +  +  ++  LE+E+K  K + + +                    +  +++ F+R EMA +L E+N YKE+LMELQ+AV + EM R  ++ P  +E  K      S IW  F  LF
Sbjct:   19 MSERVSGMANSIYREFERLIRSYDEEVVKELMPLVVNVLENLDAVLIENQEHEVELELLKEDNEQLITQYEREKALRKQAEEKFIEFEDALEAEKKDLQMQVEFLELQGKQLELKTKNYSDQITRLEERESDLKKEYNALHQRHTEMIQTYVEHIERSKLQQAGSNSQSEGTGCGRTKAERPP-SLSLYPSGEGMEDGSESDSVAATPSSTGSKSNTPTSSV-PSATVTPINEG----FLLQSDFDMVPAGNRRKSGKRLSRNMEVQVSQETRNVSIGMGSSDEWSEFQEIIDSTPELEHSVYGGGNSPCQGIVNEAFGINTDSLYHEIKDAKSDIIGDVDAGAELLGEFSGMGKEVENLLTENKQLLETKNALNIVKNDLIAKVDELSGEQEVLREELEAVRQSKNKVDARIKELEEEIKRLKAEALGASRDSKDEGDDFSSPIQDGDMTMTQRRRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASRESPPIQEKKK------STIWQFFARLF 527          
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. Ensembl Medaka
Match: mapk8ip3 (mitogen-activated protein kinase 8 interacting protein 3 [Source:NCBI gene;Acc:101157621])

HSP 1 Score: 175.637 bits (444), Expect = 3.590e-44
Identity = 158/521 (30.33%), Postives = 265/521 (50.86%), Query Frame = 2
Query:  149 MTEKVQILANKIYKEFERLISFYGSDVVEYLMPXXXXXXXXXXXXYRDKHTYEIDVELLKEDNCTLNRQYEREKYLKKQSEERVIHXXXXXXXXXXXXXXXXXXXXSSNRTFEVKFRNANETVSRLEEKVEFLKIENQKIYERYTDVLKSHAEQLNKIKAETCRDIS--------------PPFSLSIR--------DLENRSTKSLIRDLRLKNNIQNSVIIPNKLLDPEHSNPDLNHLHDENFDIFDEKNXXXXXXXXXXHQGETVA--------DILSNDHW--MTDCCDGETDCNQVHSNNLKNPSQFDSSSSYFMDPQDLSQRMNRDHSLETNIVDSDTDVTDDEFGIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREELRRHSNREADLKGKLAHLEQELKICKEKLIDSQAXXX--------------XXXXXQKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFPEFRESSKPMKAQNSGIWNLFNNLF 1573
            M+E+V  +AN IY+EFERLI  Y  +VV+ LMPL+VN+LENL+ +  +   +E+++ELLKEDN  L  QYEREK L+KQ+EE+ I  E A E EKK L+ ++  LE   +  E+K +N ++ ++RLEE+   LK E   +++R+T++++++ E + + K +     S              PP SLS+           E+ S  +       K+N   S + P+  + P +       L   +FD+    N +        +    V+         + S+D W    +  D   +          +P Q   + ++ ++   L   +    S     VD+  ++  +  G+G+E++ ++ EN+ L+ TKNALNIVK+DLI ++D ++ E ++LREEL      +  +  ++  LE+E+K  K + + +                    +  +++ F+R EMA +L E+N YKE+LMELQ+AV + EM R  ++ P  +E  K      S IW  F  LF
Sbjct:   19 MSERVSGMANSIYREFERLIRSYDEEVVKELMPLVVNVLENLDAVLIENQEHEVELELLKEDNEQLITQYEREKALRKQAEEKFIEFEDALEAEKKDLQMQVEFLELQGKQLELKTKNYSDQITRLEERESDLKKEYNALHQRHTEMIQTYVEHIERSKLQQAGSNSQSEGTGCGRTKAERPP-SLSLYPSGEGMEDGSESDSVAATPSSTGSKSNTPTSSV-PSATVTPINEG----FLLQSDFDMVPAGNRRKSGKRLSRNMEVQVSQETRNVSIGMGSSDEWSEFQEIIDSTPELEHSVYGGGNSPCQGIVNEAFGINTDSLYHEIKDAKSDIIGDVDAGAELLGEFSGMGKEVENLLTENKQLLETKNALNIVKNDLIAKVDELSGEQEVLREELEAVRQSKNKVDARIKELEEEIKRLKAEALGASRDSKDEGDDFSSPIQDGDMTMTQRRRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASRESPPIQEKKK------STIWQFFARLF 527          
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. Ensembl Medaka
Match: mapk8ip3 (mitogen-activated protein kinase 8 interacting protein 3 [Source:NCBI gene;Acc:101157621])

HSP 1 Score: 174.481 bits (441), Expect = 8.929e-44
Identity = 158/521 (30.33%), Postives = 266/521 (51.06%), Query Frame = 2
Query:  149 MTEKVQILANKIYKEFERLISFYGSDVVEYLMPXXXXXXXXXXXXYRDKHTYEIDVELLKEDNCTLNRQYEREKYLKKQSEERVIHXXXXXXXXXXXXXXXXXXXXSSNRTFEVKFRNANETVSRLEEKVEFLKIENQKIYERYTDVLKSHAEQLNKIKAETCRDIS--------------PPFSLSIR--------DLENRSTKSLIRDLRLKNNIQNSVIIPNKLLDPEHSNPDLNHLHDENFDIFDEKNXXXXXXXXXXHQGETVA--------DILSNDHW--MTDCCDGETDCNQVHSNNLKNPSQFDSSSSYFMDPQDLSQRMNRDHSLETNIVDSDTDVTDDEFGIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREELRRHSNREADLKGKLAHLEQELKICKEKLIDSQAXXX--------------XXXXXQKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFPEFRESSKPMKAQNSGIWNLFNNLF 1573
            M+E+V  +AN IY+EFERLI  Y  +VV+ LMPL+VN+LENL+ +  +   +E+++ELLKEDN  L  QYEREK L+KQ+EE+ I  E A E EKK L+ ++  LE   +  E+K +N ++ ++RLEE+   LK E   +++R+T++++++ E + + K +     S              PP SLS+           E+ S  +       K+N   S + P+  + P +       L   +FD+    N +        +    V+         + S+D W    +  D   +          +P Q   + ++ ++   L   +      +++I+  D D   +  G+G+E++ ++ EN+ L+ TKNALNIVK+DLI ++D ++ E ++LREEL      +  +  ++  LE+E+K  K + + +                    +  +++ F+R EMA +L E+N YKE+LMELQ+AV + EM R  ++ P  +E  K      S IW  F  LF
Sbjct:   19 MSERVSGMANSIYREFERLIRSYDEEVVKELMPLVVNVLENLDAVLIENQEHEVELELLKEDNEQLITQYEREKALRKQAEEKFIEFEDALEAEKKDLQMQVEFLELQGKQLELKTKNYSDQITRLEERESDLKKEYNALHQRHTEMIQTYVEHIERSKLQQAGSNSQSEGTGCGRTKAERPP-SLSLYPSGEGMEDGSESDSVAATPSSTGSKSNTPTSSV-PSATVTPINEG----FLLQSDFDMVPAGNRRKSGKRLSRNMEVQVSQETRNVSIGMGSSDEWSEFQEIIDSTPELEHSVYGGGNSPCQGIVNEAFGINTDSLYHEIK---DAKSDII-GDVDAGAELLGMGKEVENLLTENKQLLETKNALNIVKNDLIAKVDELSGEQEVLREELEAVRQSKNKVDARIKELEEEIKRLKAEALGASRDSKDEGDDFSSPIQDGDMTMTQRRRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASRESPPIQEKKK------STIWQFFARLF 523          
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. Ensembl Medaka
Match: ENSORLT00000028893.1 (pep primary_assembly:ASM223467v1:8:13379366:13393011:1 gene:ENSORLG00000027081.1 transcript:ENSORLT00000028893.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 99.7525 bits (247), Expect = 1.116e-22
Identity = 82/226 (36.28%), Postives = 134/226 (59.29%), Query Frame = 2
Query:  125 DNENLNNGMTEKVQILANKIYKEFERLISFYGSDVVEYLMPXXXXXXXXXXXXYRDKHTYEIDVELLKEDNCTLNRQYEREKYLKKQSEERVIHXXXXXXXXXXXXXXXXXXXXSSNRTFEVKFRNANETVSRLEEKVEFLKIENQKIYERYTDVLKSHAEQLNKIKAETCRDISP-----------PFSLS-----------IRDLENRSTKSLIRDLRLKNNIQ 736
            D+   +  M+E+V  LA+ IY+EFERLI  Y  DVV+ LMPL+V +LENL+ ++ +   +E+++ELLKEDN  L  QYEREK L+K +EER +  E  +E+EKK L+  +  +ES +R  E+K +N ++ +SRLEE+   LK +   +++R+++++ ++ E + +IK +   + S            P SL            I DL+N++  S     RL ++ Q
Sbjct:   11 DDPGTSAMMSERVSGLASSIYREFERLIGKYDEDVVKELMPLVVAVLENLDSVFAENQEHEVELELLKEDNEQLITQYEREKALRKHAEERFMEFEDTHEQEKKDLQNHVDRMESHSRQLELKIKNYSDQISRLEERELELKKDFNTLHQRHSEMIHNYMEHVERIKMQQVSETSESSAVGRVRRERPLSLGIFPSSGRTSLIIPDLQNKAETSATEGWRLTDSSQ 236          
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. Ensembl Medaka
Match: mapk8ip3 (mitogen-activated protein kinase 8 interacting protein 3 [Source:NCBI gene;Acc:101157621])

HSP 1 Score: 103.219 bits (256), Expect = 9.842e-22
Identity = 53/132 (40.15%), Postives = 89/132 (67.42%), Query Frame = 2
Query: 1106 GIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREELRRHSNREADLKGKLAHLEQELKICKEKLIDSQAXXXXXXXXQKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFP 1501
            G+G+E++ ++ EN+ L+ TKNALNIVK+DLI ++D ++ E ++LREEL      +  +  ++  LE+E+K  K + + +     +  ++++ F+R EMA +L E+N YKE+LMELQ+AV + EM R K+  P
Sbjct:  398 GMGKEVENLLTENKQLLETKNALNIVKNDLIAKVDELSGEQEVLREELEAVRQSKNKVDARIKELEEEIKRLKAEALGASRDSKDEGDDRRRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRRKRSPP 529          

HSP 2 Score: 93.5893 bits (231), Expect = 8.124e-19
Identity = 70/159 (44.03%), Postives = 111/159 (69.81%), Query Frame = 2
Query:  149 MTEKVQILANKIYKEFERLISFYGSDVVEYLMPXXXXXXXXXXXXYRDKHTYEIDVELLKEDNCTLNRQYEREKYLKKQSEERVIHXXXXXXXXXXXXXXXXXXXXSSNRTFEVKFRNANETVSRLEEKVEFLKIENQKIYERYTDVLKSHAEQLNKIK 625
            M+E+V  +AN IY+EFERLI  Y  +VV+ LMPL+VN+LENL+ +  +   +E+++ELLKEDN  L  QYEREK L+KQ+EE+ I  E A E EKK L+ ++  LE   +  E+K +N ++ ++RLEE+   LK E   +++R+T++++++ E + + K
Sbjct:   19 MSERVSGMANSIYREFERLIRSYDEEVVKELMPLVVNVLENLDAVLIENQEHEVELELLKEDNEQLITQYEREKALRKQAEEKFIEFEDALEAEKKDLQMQVEFLELQGKQLELKTKNYSDQITRLEERESDLKKEYNALHQRHTEMIQTYVEHIERSK 177          
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. Planmine SMEST
Match: SMESG000027094.1 (SMESG000027094.1)

HSP 1 Score: 1975.29 bits (5116), Expect = 0.000e+0
Identity = 1031/1031 (100.00%), Postives = 1031/1031 (100.00%), Query Frame = 2
Query:   74 MNKHLREQICDKRHKSSDNENLNNGMTEKVQILANKIYKEFERLISFYGSDVVEYLMPXXXXXXXXXXXXYRDKHTYEIDVELLKEDNCTLNRQYEREKYLKKQSEERVIHXXXXXXXXXXXXXXXXXXXXSSNRTFEVKFRNANETVSRLEEKVEFLKIENQKIYERYTDVLKSHAEQLNKIKAETCRDISPPFSLSIRDLENRSTKSLIRDLRLKNNIQNSVIIPNKLLDPEHSNPDLNHLHDENFDIFDEKNXXXXXXXXXXHQGETVADILSNDHWMTDCCDGETDCNQVHSNNLKNPSQFDSSSSYFMDPQDLSQRMNRDHSLETNIVDSDTDVTDDEFGIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREELRRHSNREADLKGKLAHLEQELKICKEKLIDSQAXXXXXXXXQKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFPEFRESSKPMKAQNSGIWNLFNNLFKKEDELSIQMKEKSKSLLSRFKRESDRSQLYSWSVPRSLVESELPKRIPIPIKIQTIFEPKDIVICATTGYGSTVGNDSAQYLWCLIQSNTKNNKNYYLQQMCLTEKVPELTNKYSISLQFLTTPFTMTEVPAINLATKHFSSLICGNENKSIVKINEMTQNRNQSEISEIDKKRKIFQTKLQMKSKIKHNLGSKTIWFACEKNQIVIYVLFDNNKIESRMAIVTMDSEVDFIRYNFGRVFVIEKNGSFGIFELNKEMNHWELNQCLLIDVTGGLPISDLCCDSSSFRLWIGSSISCCIMDLSTLDTLKMLQVMEESQLSDYCSSIESMILIEKYSLMLFSISRLGILLGYDLKNLQYKVLLDLKPSVFELIEPIQGIEKSTLSLFHLIVDDERIWMTTDCGMIIVVTLDTLVCHLKNQSGKTTKFKCSLQTDKVYISSHAFAQCIKIISLLEYSNTSLCLKNVNSIKRFTGKNDLNGNPKEKPRTELEEDLSTSVKTYYMMTAIGSSYVNLNCPMMESVHPSNHAIIWKS 3166
            MNKHLREQICDKRHKSSDNENLNNGMTEKVQILANKIYKEFERLISFYGSDVVEYLMPLIVNILENLEELYRDKHTYEIDVELLKEDNCTLNRQYEREKYLKKQSEERVIHIEYAYEEEKKALEEKIIILESSNRTFEVKFRNANETVSRLEEKVEFLKIENQKIYERYTDVLKSHAEQLNKIKAETCRDISPPFSLSIRDLENRSTKSLIRDLRLKNNIQNSVIIPNKLLDPEHSNPDLNHLHDENFDIFDEKNDKSDSSDSMSHQGETVADILSNDHWMTDCCDGETDCNQVHSNNLKNPSQFDSSSSYFMDPQDLSQRMNRDHSLETNIVDSDTDVTDDEFGIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREELRRHSNREADLKGKLAHLEQELKICKEKLIDSQASENNSSNEQKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFPEFRESSKPMKAQNSGIWNLFNNLFKKEDELSIQMKEKSKSLLSRFKRESDRSQLYSWSVPRSLVESELPKRIPIPIKIQTIFEPKDIVICATTGYGSTVGNDSAQYLWCLIQSNTKNNKNYYLQQMCLTEKVPELTNKYSISLQFLTTPFTMTEVPAINLATKHFSSLICGNENKSIVKINEMTQNRNQSEISEIDKKRKIFQTKLQMKSKIKHNLGSKTIWFACEKNQIVIYVLFDNNKIESRMAIVTMDSEVDFIRYNFGRVFVIEKNGSFGIFELNKEMNHWELNQCLLIDVTGGLPISDLCCDSSSFRLWIGSSISCCIMDLSTLDTLKMLQVMEESQLSDYCSSIESMILIEKYSLMLFSISRLGILLGYDLKNLQYKVLLDLKPSVFELIEPIQGIEKSTLSLFHLIVDDERIWMTTDCGMIIVVTLDTLVCHLKNQSGKTTKFKCSLQTDKVYISSHAFAQCIKIISLLEYSNTSLCLKNVNSIKRFTGKNDLNGNPKEKPRTELEEDLSTSVKTYYMMTAIGSSYVNLNCPMMESVHPSNHAIIWKS
Sbjct:    1 MNKHLREQICDKRHKSSDNENLNNGMTEKVQILANKIYKEFERLISFYGSDVVEYLMPLIVNILENLEELYRDKHTYEIDVELLKEDNCTLNRQYEREKYLKKQSEERVIHIEYAYEEEKKALEEKIIILESSNRTFEVKFRNANETVSRLEEKVEFLKIENQKIYERYTDVLKSHAEQLNKIKAETCRDISPPFSLSIRDLENRSTKSLIRDLRLKNNIQNSVIIPNKLLDPEHSNPDLNHLHDENFDIFDEKNDKSDSSDSMSHQGETVADILSNDHWMTDCCDGETDCNQVHSNNLKNPSQFDSSSSYFMDPQDLSQRMNRDHSLETNIVDSDTDVTDDEFGIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREELRRHSNREADLKGKLAHLEQELKICKEKLIDSQASENNSSNEQKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFPEFRESSKPMKAQNSGIWNLFNNLFKKEDELSIQMKEKSKSLLSRFKRESDRSQLYSWSVPRSLVESELPKRIPIPIKIQTIFEPKDIVICATTGYGSTVGNDSAQYLWCLIQSNTKNNKNYYLQQMCLTEKVPELTNKYSISLQFLTTPFTMTEVPAINLATKHFSSLICGNENKSIVKINEMTQNRNQSEISEIDKKRKIFQTKLQMKSKIKHNLGSKTIWFACEKNQIVIYVLFDNNKIESRMAIVTMDSEVDFIRYNFGRVFVIEKNGSFGIFELNKEMNHWELNQCLLIDVTGGLPISDLCCDSSSFRLWIGSSISCCIMDLSTLDTLKMLQVMEESQLSDYCSSIESMILIEKYSLMLFSISRLGILLGYDLKNLQYKVLLDLKPSVFELIEPIQGIEKSTLSLFHLIVDDERIWMTTDCGMIIVVTLDTLVCHLKNQSGKTTKFKCSLQTDKVYISSHAFAQCIKIISLLEYSNTSLCLKNVNSIKRFTGKNDLNGNPKEKPRTELEEDLSTSVKTYYMMTAIGSSYVNLNCPMMESVHPSNHAIIWKS 1031          
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. Planmine SMEST
Match: SMESG000027094.1 (SMESG000027094.1)

HSP 1 Score: 1937.92 bits (5019), Expect = 0.000e+0
Identity = 1018/1088 (93.57%), Postives = 1020/1088 (93.75%), Query Frame = 2
Query:   74 MNKHLREQICDKRHKSSDNENLNNGMTEKVQILANKIYKEFERLISFYGSDVVEYLMPXXXXXXXXXXXXYRDKHTYEIDVELLKEDNCTLNRQYEREKYLKKQSEERVIHXXXXXXXXXXXXXXXXXXXXSSNRTFEVKFRNANETVSRLEEKVEFLKIENQKIYERYTDVLKSHAEQLNKIKAETCRDISPPFSLSIRDLENRSTKSLIRDLRLKNNIQNSVIIPNKLLDPEHSNPDLNHLHDENFDIFDEKNXXXXXXXXXXHQGETVADILSNDHWMTDCCDGETDCNQVHSNNLKNPSQFDSSSSYFMDPQDLSQRMNRDHSLETNIVDSDTDVTDDEFGIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREELRRHSNREADLKGKLAHLEQELKICKEKLIDSQAXXXXXXXXQKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFPE------------------------------------------FRESSKPMKAQNSGIWNL---------------FNNLFKKEDELSIQMKEKSKSLLSRFKRESDRSQLYSWSVPRSLVESELPKRIPIPIKIQTIFEPKDIVICATTGYGSTVGNDSAQYLWCLIQSNTKNNKNYYLQQMCLTEKVPELTNKYSISLQFLTTPFTMTEVPAINLATKHFSSLICGNENKSIVKINEMTQNRNQSEISEIDKKRKIFQTKLQMKSKIKHNLGSKTIWFACEKNQIVIYVLFDNNKIESRMAIVTMDSEVDFIRYNFGRVFVIEKNGSFGIFELNKEMNHWELNQCLLIDVTGGLPISDLCCDSSSFRLWIGSSISCCIMDLSTLDTLKMLQVMEESQLSDYCSSIESMILIEKYSLMLFSISRLGILLGYDLKNLQYKVLLDLKPSVFELIEPIQGIEKSTLSLFHLIVDDERIWMTTDCGMIIVVTLDTLVCHLKNQSGKTTKFKCSLQTDKVYISSHAFAQCIKIISLLEYSNTSLCLKNVNSIKRFTGKNDLNGNPKEKPRTELEEDLSTSVKTYYMMTAIGSSYVNLNCPMMESVHPSNHAIIWKS 3166
            MNKHLREQICDKRHKSSDNENLNNGMTEKVQILANKIYKEFERLISFYGSDVVEYLMPLIVNILENLEELYRDKHTYEIDVELLKEDNCTLNRQYEREKYLKKQSEERVIHIEYAYEEEKKALEEKIIILESSNRTFEVKFRNANETVSRLEEKVEFLKIENQKIYERYTDVLKSHAEQLNKIKAETCRDISPPFSLSIRDLENRSTKSLIRDLRLKNNIQNSVIIPNKLLDPEHSNPDLNHLHDENFDIFDEKNDKSDSSDSMSHQGETVADILSNDHWMTDCCDGETDCNQVHSNNLKNPSQFDSSSSYFMDPQDLSQRMNRDHSLETNIVDSDTDVTDDEFGIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREELRRHSNREADLKGKLAHLEQELKICKEKLIDSQASENNSSNEQKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFPE                                          FR   KP+   +    N                FNNLFKKEDELSIQMKEKSKSLLSRFKRESDRSQLYSWSVPRSLVESELPKRIPIPIKIQTIFEPKDIVICATTGYGSTVGNDSAQYLWCLIQSNTKNNKNYYLQQMCLTEKVPELTNKYSISLQFLTTPFTMTEVPAINLATKHFSSLICGNENKSIVKINEMTQNRNQSEISEIDKKRKIFQTKLQMKSKIKHNLGSKTIWFACEKNQIVIYVLFDNNKIESRMAIVTMDSEVDFIRYNFGRVFVIEKNGSFGIFELNKEMNHWELNQCLLIDVTGGLPISDLCCDSSSFRLWIGSSISCCIMDLSTLDTLKMLQVMEESQLSDYCSSIESMILIEKYSLMLFSISRLGILLGYDLKNLQYKVLLDLKPSVFELIEPIQGIEKSTLSLFHLIVDDERIWMTTDCGMIIVVTLDTLVCHLKNQSGKTTKFKCSLQTDKVYISSHAFAQCIKIISLLEYSNTSLCLKNVNSIKRFTGKNDLNGNPKEKPRTELEEDLSTSVKTYYMMTAIGSSYVNLNCPMMESVHPSNHAIIWKS
Sbjct:    1 MNKHLREQICDKRHKSSDNENLNNGMTEKVQILANKIYKEFERLISFYGSDVVEYLMPLIVNILENLEELYRDKHTYEIDVELLKEDNCTLNRQYEREKYLKKQSEERVIHIEYAYEEEKKALEEKIIILESSNRTFEVKFRNANETVSRLEEKVEFLKIENQKIYERYTDVLKSHAEQLNKIKAETCRDISPPFSLSIRDLENRSTKSLIRDLRLKNNIQNSVIIPNKLLDPEHSNPDLNHLHDENFDIFDEKNDKSDSSDSMSHQGETVADILSNDHWMTDCCDGETDCNQVHSNNLKNPSQFDSSSSYFMDPQDLSQRMNRDHSLETNIVDSDTDVTDDEFGIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREELRRHSNREADLKGKLAHLEQELKICKEKLIDSQASENNSSNEQKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFPEFRESSKPMKAQNSGIWNLFGFMKILFKCLLATISNSFVFLSSFRRGPKPVCCGDKYDKNKKLKKKRRRRRISHKKFNNLFKKEDELSIQMKEKSKSLLSRFKRESDRSQLYSWSVPRSLVESELPKRIPIPIKIQTIFEPKDIVICATTGYGSTVGNDSAQYLWCLIQSNTKNNKNYYLQQMCLTEKVPELTNKYSISLQFLTTPFTMTEVPAINLATKHFSSLICGNENKSIVKINEMTQNRNQSEISEIDKKRKIFQTKLQMKSKIKHNLGSKTIWFACEKNQIVIYVLFDNNKIESRMAIVTMDSEVDFIRYNFGRVFVIEKNGSFGIFELNKEMNHWELNQCLLIDVTGGLPISDLCCDSSSFRLWIGSSISCCIMDLSTLDTLKMLQVMEESQLSDYCSSIESMILIEKYSLMLFSISRLGILLGYDLKNLQYKVLLDLKPSVFELIEPIQGIEKSTLSLFHLIVDDERIWMTTDCGMIIVVTLDTLVCHLKNQSGKTTKFKCSLQTDKVYISSHAFAQCIKIISLLEYSNTSLCLKNVNSIKRFTGKNDLNGNPKEKPRTELEEDLSTSVKTYYMMTAIGSSYVNLNCPMMESVHPSNHAIIWKS 1088          
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. Planmine SMEST
Match: SMESG000027094.1 (SMESG000027094.1)

HSP 1 Score: 1932.15 bits (5004), Expect = 0.000e+0
Identity = 1016/1088 (93.38%), Postives = 1019/1088 (93.66%), Query Frame = 2
Query:   74 MNKHLREQICDKRHKSSDNENLNNGMTEKVQILANKIYKEFERLISFYGSDVVEYLMPXXXXXXXXXXXXYRDKHTYEIDVELLKEDNCTLNRQYEREKYLKKQSEERVIHXXXXXXXXXXXXXXXXXXXXSSNRTFEVKFRNANETVSRLEEKVEFLKIENQKIYERYTDVLKSHAEQLNKIKAETCRDISPPFSLSIRDLENRSTKSLIRDLRLKNNIQNSVIIPNKLLDPEHSNPDLNHLHDENFDIFDEKNXXXXXXXXXXHQGETVADILSNDHWMTDCCDGETDCNQVHSNNLKNPSQFDSSSSYFMDPQDLSQRMNRDHSLETNIVDSDTDVTDDEFGIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREELRRHSNREADLKGKLAHLEQELKICKEKLIDSQAXXXXXXXXQKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFPE------------------------------------------FRESSKPMKAQNSGIWNL---------------FNNLFKKEDELSIQMKEKSKSLLSRFKRESDRSQLYSWSVPRSLVESELPKRIPIPIKIQTIFEPKDIVICATTGYGSTVGNDSAQYLWCLIQSNTKNNKNYYLQQMCLTEKVPELTNKYSISLQFLTTPFTMTEVPAINLATKHFSSLICGNENKSIVKINEMTQNRNQSEISEIDKKRKIFQTKLQMKSKIKHNLGSKTIWFACEKNQIVIYVLFDNNKIESRMAIVTMDSEVDFIRYNFGRVFVIEKNGSFGIFELNKEMNHWELNQCLLIDVTGGLPISDLCCDSSSFRLWIGSSISCCIMDLSTLDTLKMLQVMEESQLSDYCSSIESMILIEKYSLMLFSISRLGILLGYDLKNLQYKVLLDLKPSVFELIEPIQGIEKSTLSLFHLIVDDERIWMTTDCGMIIVVTLDTLVCHLKNQSGKTTKFKCSLQTDKVYISSHAFAQCIKIISLLEYSNTSLCLKNVNSIKRFTGKNDLNGNPKEKPRTELEEDLSTSVKTYYMMTAIGSSYVNLNCPMMESVHPSNHAIIWKS 3166
            MNKHLREQICDKRHKSSDNENLNNGMTEKVQILANKIYKEFERLISFYGSDVVEYLMPLIVNILENLEELYRDKHTYEIDVELLKEDNCTLNRQYEREKYLKKQSEERVIHIEYAYEEEKKALEEKIIILESSNRTFEVKFRNANETVSRLEEKVEFLKIENQKIYERYTDVLKSHAEQLNKIKAETCRDISPPFSLSIRDLENRSTKSLIRDLRLKNNIQNSVIIPNKLLDPEHSNPDLNHLHDENFDIFDEKNDKSDSSDSMSHQGETVADILSNDHWMTDCCDGETDCNQVHSNNLKNPSQFDSSSSYFMDPQDLSQRMNRDHSLETNIVDSDTDVTDDEFGIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREELRRHSNREADLKGKLAHLEQELKICKEKLIDSQASENNSSN +KTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFPE                                          FR   KP+   +    N                FNNLFKKEDELSIQMKEKSKSLLSRFKRESDRSQLYSWSVPRSLVESELPKRIPIPIKIQTIFEPKDIVICATTGYGSTVGNDSAQYLWCLIQSNTKNNKNYYLQQMCLTEKVPELTNKYSISLQFLTTPFTMTEVPAINLATKHFSSLICGNENKSIVKINEMTQNRNQSEISEIDKKRKIFQTKLQMKSKIKHNLGSKTIWFACEKNQIVIYVLFDNNKIESRMAIVTMDSEVDFIRYNFGRVFVIEKNGSFGIFELNKEMNHWELNQCLLIDVTGGLPISDLCCDSSSFRLWIGSSISCCIMDLSTLDTLKMLQVMEESQLSDYCSSIESMILIEKYSLMLFSISRLGILLGYDLKNLQYKVLLDLKPSVFELIEPIQGIEKSTLSLFHLIVDDERIWMTTDCGMIIVVTLDTLVCHLKNQSGKTTKFKCSLQTDKVYISSHAFAQCIKIISLLEYSNTSLCLKNVNSIKRFTGKNDLNGNPKEKPRTELEEDLSTSVKTYYMMTAIGSSYVNLNCPMMESVHPSNHAIIWKS
Sbjct:    1 MNKHLREQICDKRHKSSDNENLNNGMTEKVQILANKIYKEFERLISFYGSDVVEYLMPLIVNILENLEELYRDKHTYEIDVELLKEDNCTLNRQYEREKYLKKQSEERVIHIEYAYEEEKKALEEKIIILESSNRTFEVKFRNANETVSRLEEKVEFLKIENQKIYERYTDVLKSHAEQLNKIKAETCRDISPPFSLSIRDLENRSTKSLIRDLRLKNNIQNSVIIPNKLLDPEHSNPDLNHLHDENFDIFDEKNDKSDSSDSMSHQGETVADILSNDHWMTDCCDGETDCNQVHSNNLKNPSQFDSSSSYFMDPQDLSQRMNRDHSLETNIVDSDTDVTDDEFGIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREELRRHSNREADLKGKLAHLEQELKICKEKLIDSQASENNSSN-EKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFPEFRESSKPMKAQNSGIWNLFGFMKILFKCLLATISNSFVFLSSFRRGPKPVCCGDKYDKNKKLKKKRRRRRISHKKFNNLFKKEDELSIQMKEKSKSLLSRFKRESDRSQLYSWSVPRSLVESELPKRIPIPIKIQTIFEPKDIVICATTGYGSTVGNDSAQYLWCLIQSNTKNNKNYYLQQMCLTEKVPELTNKYSISLQFLTTPFTMTEVPAINLATKHFSSLICGNENKSIVKINEMTQNRNQSEISEIDKKRKIFQTKLQMKSKIKHNLGSKTIWFACEKNQIVIYVLFDNNKIESRMAIVTMDSEVDFIRYNFGRVFVIEKNGSFGIFELNKEMNHWELNQCLLIDVTGGLPISDLCCDSSSFRLWIGSSISCCIMDLSTLDTLKMLQVMEESQLSDYCSSIESMILIEKYSLMLFSISRLGILLGYDLKNLQYKVLLDLKPSVFELIEPIQGIEKSTLSLFHLIVDDERIWMTTDCGMIIVVTLDTLVCHLKNQSGKTTKFKCSLQTDKVYISSHAFAQCIKIISLLEYSNTSLCLKNVNSIKRFTGKNDLNGNPKEKPRTELEEDLSTSVKTYYMMTAIGSSYVNLNCPMMESVHPSNHAIIWKS 1087          
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. Planmine SMEST
Match: SMESG000027094.1 (SMESG000027094.1)

HSP 1 Score: 1073.92 bits (2776), Expect = 0.000e+0
Identity = 522/522 (100.00%), Postives = 522/522 (100.00%), Query Frame = 2
Query: 1601 MKEKSKSLLSRFKRESDRSQLYSWSVPRSLVESELPKRIPIPIKIQTIFEPKDIVICATTGYGSTVGNDSAQYLWCLIQSNTKNNKNYYLQQMCLTEKVPELTNKYSISLQFLTTPFTMTEVPAINLATKHFSSLICGNENKSIVKINEMTQNRNQSEISEIDKKRKIFQTKLQMKSKIKHNLGSKTIWFACEKNQIVIYVLFDNNKIESRMAIVTMDSEVDFIRYNFGRVFVIEKNGSFGIFELNKEMNHWELNQCLLIDVTGGLPISDLCCDSSSFRLWIGSSISCCIMDLSTLDTLKMLQVMEESQLSDYCSSIESMILIEKYSLMLFSISRLGILLGYDLKNLQYKVLLDLKPSVFELIEPIQGIEKSTLSLFHLIVDDERIWMTTDCGMIIVVTLDTLVCHLKNQSGKTTKFKCSLQTDKVYISSHAFAQCIKIISLLEYSNTSLCLKNVNSIKRFTGKNDLNGNPKEKPRTELEEDLSTSVKTYYMMTAIGSSYVNLNCPMMESVHPSNHAIIWKS 3166
            MKEKSKSLLSRFKRESDRSQLYSWSVPRSLVESELPKRIPIPIKIQTIFEPKDIVICATTGYGSTVGNDSAQYLWCLIQSNTKNNKNYYLQQMCLTEKVPELTNKYSISLQFLTTPFTMTEVPAINLATKHFSSLICGNENKSIVKINEMTQNRNQSEISEIDKKRKIFQTKLQMKSKIKHNLGSKTIWFACEKNQIVIYVLFDNNKIESRMAIVTMDSEVDFIRYNFGRVFVIEKNGSFGIFELNKEMNHWELNQCLLIDVTGGLPISDLCCDSSSFRLWIGSSISCCIMDLSTLDTLKMLQVMEESQLSDYCSSIESMILIEKYSLMLFSISRLGILLGYDLKNLQYKVLLDLKPSVFELIEPIQGIEKSTLSLFHLIVDDERIWMTTDCGMIIVVTLDTLVCHLKNQSGKTTKFKCSLQTDKVYISSHAFAQCIKIISLLEYSNTSLCLKNVNSIKRFTGKNDLNGNPKEKPRTELEEDLSTSVKTYYMMTAIGSSYVNLNCPMMESVHPSNHAIIWKS
Sbjct:    1 MKEKSKSLLSRFKRESDRSQLYSWSVPRSLVESELPKRIPIPIKIQTIFEPKDIVICATTGYGSTVGNDSAQYLWCLIQSNTKNNKNYYLQQMCLTEKVPELTNKYSISLQFLTTPFTMTEVPAINLATKHFSSLICGNENKSIVKINEMTQNRNQSEISEIDKKRKIFQTKLQMKSKIKHNLGSKTIWFACEKNQIVIYVLFDNNKIESRMAIVTMDSEVDFIRYNFGRVFVIEKNGSFGIFELNKEMNHWELNQCLLIDVTGGLPISDLCCDSSSFRLWIGSSISCCIMDLSTLDTLKMLQVMEESQLSDYCSSIESMILIEKYSLMLFSISRLGILLGYDLKNLQYKVLLDLKPSVFELIEPIQGIEKSTLSLFHLIVDDERIWMTTDCGMIIVVTLDTLVCHLKNQSGKTTKFKCSLQTDKVYISSHAFAQCIKIISLLEYSNTSLCLKNVNSIKRFTGKNDLNGNPKEKPRTELEEDLSTSVKTYYMMTAIGSSYVNLNCPMMESVHPSNHAIIWKS 522          
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. Planmine SMEST
Match: SMESG000027094.1 (SMESG000027094.1)

HSP 1 Score: 873.233 bits (2255), Expect = 0.000e+0
Identity = 496/497 (99.80%), Postives = 496/497 (99.80%), Query Frame = 2
Query:   74 MNKHLREQICDKRHKSSDNENLNNGMTEKVQILANKIYKEFERLISFYGSDVVEYLMPXXXXXXXXXXXXYRDKHTYEIDVELLKEDNCTLNRQYEREKYLKKQSEERVIHXXXXXXXXXXXXXXXXXXXXSSNRTFEVKFRNANETVSRLEEKVEFLKIENQKIYERYTDVLKSHAEQLNKIKAETCRDISPPFSLSIRDLENRSTKSLIRDLRLKNNIQNSVIIPNKLLDPEHSNPDLNHLHDENFDIFDEKNXXXXXXXXXXHQGETVADILSNDHWMTDCCDGETDCNQVHSNNLKNPSQFDSSSSYFMDPQDLSQRMNRDHSLETNIVDSDTDVTDDEFGIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREELRRHSNREADLKGKLAHLEQELKICKEKLIDSQAXXXXXXXXQKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFPEFRESSKPMKAQNSGIWNLFN 1564
            MNKHLREQICDKRHKSSDNENLNNGMTEKVQILANKIYKEFERLISFYGSDVVEYLMPLIVNILENLEELYRDKHTYEIDVELLKEDNCTLNRQYEREKYLKKQSEERVIHIEYAYEEEKKALEEKIIILESSNRTFEVKFRNANETVSRLEEKVEFLKIENQKIYERYTDVLKSHAEQLNKIKAETCRDISPPFSLSIRDLENRSTKSLIRDLRLKNNIQNSVIIPNKLLDPEHSNPDLNHLHDENFDIFDEKNDKSDSSDSMSHQGETVADILSNDHWMTDCCDGETDCNQVHSNNLKNPSQFDSSSSYFMDPQDLSQRMNRDHSLETNIVDSDTDVTDDEFGIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREELRRHSNREADLKGKLAHLEQELKICKEKLIDSQASENNSSNEQKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFPEFRESSKPMKAQNSGIWNLF 
Sbjct:    1 MNKHLREQICDKRHKSSDNENLNNGMTEKVQILANKIYKEFERLISFYGSDVVEYLMPLIVNILENLEELYRDKHTYEIDVELLKEDNCTLNRQYEREKYLKKQSEERVIHIEYAYEEEKKALEEKIIILESSNRTFEVKFRNANETVSRLEEKVEFLKIENQKIYERYTDVLKSHAEQLNKIKAETCRDISPPFSLSIRDLENRSTKSLIRDLRLKNNIQNSVIIPNKLLDPEHSNPDLNHLHDENFDIFDEKNDKSDSSDSMSHQGETVADILSNDHWMTDCCDGETDCNQVHSNNLKNPSQFDSSSSYFMDPQDLSQRMNRDHSLETNIVDSDTDVTDDEFGIGREIDCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREELRRHSNREADLKGKLAHLEQELKICKEKLIDSQASENNSSNEQKTFSRSEMAILLEEKNHYKEKLMELQDAVVYKEMCRVKKQFPEFRESSKPMKAQNSGIWNLFG 497          
The following BLAST results are available for this feature:
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MAPK8IP31.469e-2430.83mitogen-activated protein kinase 8 interacting pro... [more]
MAPK8IP31.508e-2430.83mitogen-activated protein kinase 8 interacting pro... [more]
MAPK8IP31.591e-2430.83mitogen-activated protein kinase 8 interacting pro... [more]
MAPK8IP39.133e-2429.96mitogen-activated protein kinase 8 interacting pro... [more]
SPAG93.695e-2026.99sperm associated antigen 9 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-166.046e-4630.52JNK-interacting protein [Source:UniProtKB/Swiss-P... [more]
unc-161.279e-4431.91JNK-interacting protein [Source:UniProtKB/Swiss-P... [more]
unc-163.024e-4432.79JNK-interacting protein [Source:UniProtKB/Swiss-P... [more]
unc-163.130e-4332.79JNK-interacting protein [Source:UniProtKB/Swiss-P... [more]
unc-163.762e-2431.34JNK-interacting protein [Source:UniProtKB/Swiss-P... [more]
back to top
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syd1.568e-2640.72gene:FBgn0024187 transcript:FBtr0076768[more]
syd1.604e-2640.72gene:FBgn0024187 transcript:FBtr0076769[more]
syd1.625e-2640.72gene:FBgn0024187 transcript:FBtr0300412[more]
syd1.674e-2640.72gene:FBgn0024187 transcript:FBtr0332790[more]
syd1.735e-2640.72gene:FBgn0024187 transcript:FBtr0332792[more]
back to top
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mapk8ip32.380e-2434.19mitogen-activated protein kinase 8 interacting pro... [more]
mapk8ip35.310e-2438.64mitogen-activated protein kinase 8 interacting pro... [more]
SPAG91.332e-2326.93sperm associated antigen 9b [Source:NCBI gene;Acc:... [more]
SPAG91.851e-2326.93sperm associated antigen 9b [Source:NCBI gene;Acc:... [more]
SPAG92.589e-2326.93sperm associated antigen 9b [Source:NCBI gene;Acc:... [more]
back to top
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cldn28.412e-4832.13claudin 2 [Source:Xenbase;Acc:XB-GENE-994508][more]
cldn26.465e-4732.67claudin 2 [Source:Xenbase;Acc:XB-GENE-994508][more]
cldn27.954e-4731.65claudin 2 [Source:Xenbase;Acc:XB-GENE-994508][more]
cldn24.205e-4631.25claudin 2 [Source:Xenbase;Acc:XB-GENE-994508][more]
cldn22.994e-2335.33claudin 2 [Source:Xenbase;Acc:XB-GENE-994508][more]
back to top
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mapk8ip33.048e-4530.34mitogen-activated protein kinase 8 interacting pro... [more]
Mapk8ip36.201e-4530.09mitogen-activated protein kinase 8 interacting pro... [more]
Mapk8ip32.306e-4430.02mitogen-activated protein kinase 8 interacting pro... [more]
Mapk8ip33.501e-4429.68mitogen-activated protein kinase 8 interacting pro... [more]
Mapk8ip31.240e-2431.88mitogen-activated protein kinase 8 interacting pro... [more]
back to top
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q29EP6|JIP3_DROPS8.050e-2640.72JNK-interacting protein 3 OS=Drosophila pseudoobsc... [more]
sp|Q9GQF1|JIP3_DROME1.572e-2540.72JNK-interacting protein 3 OS=Drosophila melanogast... [more]
sp|Q9UPT6|JIP3_HUMAN7.054e-2430.83C-Jun-amino-terminal kinase-interacting protein 3 ... [more]
sp|E9PSK7|JIP3_RAT9.445e-2431.88C-Jun-amino-terminal kinase-interacting protein 3 ... [more]
sp|Q9ESN9|JIP3_MOUSE1.584e-2331.53C-Jun-amino-terminal kinase-interacting protein 3 ... [more]
back to top
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I7SQR85.254e-5031.73Uncharacterized protein OS=Bursaphelenchus xylophi... [more]
A0A0A9WK501.730e-4934.16JNK-interacting protein 3 OS=Lygus hesperus OX=300... [more]
A0A182YJ261.929e-4933.65Uncharacterized protein OS=Anopheles stephensi OX=... [more]
A0A0A9WTG84.103e-4934.16JNK-interacting protein 3 OS=Lygus hesperus OX=300... [more]
A0A0A9WG441.926e-4834.23JNK-interacting protein 3 OS=Lygus hesperus OX=300... [more]
back to top
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mapk8ip35.452e-2538.59mitogen-activated protein kinase 8 interacting pro... [more]
mapk8ip38.823e-2538.64mitogen-activated protein kinase 8 interacting pro... [more]
mapk8ip39.509e-2538.64mitogen-activated protein kinase 8 interacting pro... [more]
mapk8ip39.661e-2538.64mitogen-activated protein kinase 8 interacting pro... [more]
mapk8ip38.659e-2436.81mitogen-activated protein kinase 8 interacting pro... [more]
back to top
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO470392.274e-4030.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mapk8ip33.362e-4430.33mitogen-activated protein kinase 8 interacting pro... [more]
mapk8ip33.590e-4430.33mitogen-activated protein kinase 8 interacting pro... [more]
mapk8ip38.929e-4430.33mitogen-activated protein kinase 8 interacting pro... [more]
ENSORLT00000028893.11.116e-2236.28pep primary_assembly:ASM223467v1:8:13379366:133930... [more]
mapk8ip39.842e-2240.15mitogen-activated protein kinase 8 interacting pro... [more]
back to top
BLAST of C-Jun-amino-terminal kinase-interacting protein 4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000027094.10.000e+0100.00SMESG000027094.1[more]
SMESG000027094.10.000e+093.57SMESG000027094.1[more]
SMESG000027094.10.000e+093.38SMESG000027094.1[more]
SMESG000027094.10.000e+0100.00SMESG000027094.1[more]
SMESG000027094.10.000e+099.80SMESG000027094.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031818 ID=SMED30031818|Name=C-Jun-amino-terminal kinase-interacting protein 4|organism=Schmidtea mediterranea sexual|type=transcript|length=3240bp
GAATTCTTTTGTACTTTTGAGATTTATTTTTAATGAATACTAAAATTTGA
AATTTTTTTCAATCAGTTTTGTTATGAACAAGCATTTACGAGAGCAAATT
TGTGATAAAAGACATAAATCTTCAGATAATGAAAATCTTAATAATGGAAT
GACAGAGAAAGTACAAATTCTTGCTAATAAAATTTATAAGGAATTTGAAC
GTCTGATATCTTTCTATGGATCAGATGTAGTGGAATATTTAATGCCTTTA
ATTGTCAATATCCTGGAAAATTTAGAAGAATTATATCGTGATAAACATAC
TTATGAAATTGACGTTGAATTATTAAAGGAAGATAATTGTACATTAAATA
GACAATATGAGAGAGAAAAATATCTTAAAAAGCAATCTGAAGAAAGAGTT
ATTCACATAGAATATGCTTACGAAGAAGAGAAAAAAGCCTTAGAAGAAAA
AATAATAATTCTCGAATCTTCAAATAGAACCTTCGAAGTAAAATTTCGAA
ATGCCAATGAAACAGTTTCACGTCTTGAAGAAAAAGTCGAATTTTTAAAA
ATAGAAAACCAGAAAATCTATGAGCGCTATACGGACGTGCTGAAATCCCA
CGCGGAACAGTTGAATAAGATCAAAGCAGAAACTTGTCGAGACATATCAC
CGCCCTTCTCGTTATCTATTCGTGACTTGGAGAATCGTTCGACAAAATCT
CTAATTCGAGATCTTCGACTGAAAAACAATATCCAAAACTCGGTGATTAT
TCCGAATAAATTACTCGATCCAGAACACAGCAATCCCGATCTCAATCATT
TACACGATGAAAACTTTGACATTTTTGATGAAAAAAATGACAAATCCGAC
AGTTCCGATTCCATGTCTCATCAAGGAGAAACGGTCGCAGATATCCTGTC
CAATGATCACTGGATGACGGATTGTTGTGACGGGGAAACCGATTGCAATC
AAGTCCATTCAAATAACCTAAAAAACCCATCACAATTCGACAGTAGCTCT
AGCTATTTTATGGATCCCCAGGATCTCAGTCAAAGGATGAACCGAGATCA
TTCATTGGAAACAAACATTGTCGATAGCGATACAGATGTGACTGATGATG
AATTCGGTATAGGCAGAGAGATAGACTGTATAATTCGTGAAAATCAGGAT
CTCGTCGCAACGAAGAATGCCTTGAATATAGTCAAAGATGATCTGATAAA
CCGATTAGATATAATGACAAATGAAAATGATATGCTTCGCGAAGAACTTC
GGCGACATTCTAATCGAGAAGCTGATCTCAAAGGAAAGTTAGCCCATTTG
GAGCAGGAACTGAAAATATGCAAAGAAAAATTAATAGACTCCCAAGCGTC
AGAAAACAACTCATCCAATGAACAGAAAACCTTTTCTCGGTCAGAAATGG
CAATTCTGTTGGAAGAAAAGAATCACTACAAAGAGAAATTAATGGAGTTG
CAGGATGCAGTCGTATACAAGGAAATGTGTCGAGTGAAAAAACAGTTTCC
AGAATTCAGAGAGTCTTCAAAACCGATGAAGGCCCAAAACTCTGGAATTT
GGAATTTGTTTAATAATCTCTTTAAAAAAGAAGATGAATTATCAATTCAA
ATGAAAGAAAAATCAAAAAGTCTTTTATCAAGGTTCAAGCGTGAGAGTGA
TAGGTCTCAACTCTACAGCTGGTCGGTACCCAGAAGTCTCGTCGAATCAG
AACTGCCAAAACGTATTCCGATTCCCATTAAGATCCAAACAATATTCGAA
CCAAAAGACATAGTAATCTGTGCCACAACTGGGTATGGGTCAACGGTTGG
TAACGATTCTGCACAGTACCTCTGGTGTTTGATACAGTCCAATACAAAAA
ACAACAAAAATTATTACTTGCAACAAATGTGTCTTACAGAAAAAGTTCCC
GAATTGACGAATAAATATTCCATTAGTCTACAATTCCTCACAACCCCATT
CACAATGACTGAAGTGCCAGCAATCAATTTAGCCACTAAGCACTTCAGTT
CATTGATTTGCGGCAATGAGAATAAATCCATTGTGAAAATTAATGAAATG
ACACAAAATCGAAATCAATCCGAAATTAGTGAAATCGACAAAAAGAGAAA
AATCTTTCAAACTAAACTTCAAATGAAGAGCAAGATCAAGCACAACCTCG
GCAGCAAGACCATTTGGTTTGCCTGTGAAAAGAACCAAATTGTCATATAT
GTTTTATTTGACAACAACAAGATCGAAAGTCGAATGGCAATTGTGACAAT
GGATTCGGAAGTGGATTTCATAAGGTACAATTTCGGGAGAGTTTTCGTTA
TTGAAAAGAATGGATCTTTTGGAATATTCGAGCTTAACAAAGAAATGAAT
CACTGGGAACTTAACCAGTGCTTGCTAATCGATGTAACAGGGGGTCTCCC
GATTTCCGATTTATGTTGTGATTCAAGTTCATTTCGATTATGGATTGGTT
CTTCGATTTCGTGCTGCATTATGGATCTCTCTACCCTTGATACATTAAAA
ATGTTGCAAGTAATGGAGGAGAGTCAGCTTTCTGACTACTGCTCGTCTAT
CGAATCTATGATCCTAATAGAGAAATACTCACTGATGTTGTTCTCGATCA
GCAGGCTCGGCATCTTGCTGGGTTACGATTTGAAGAATCTTCAGTACAAA
GTACTTTTGGATTTGAAACCCAGCGTTTTCGAATTAATCGAACCGATTCA
GGGCATTGAAAAATCGACCTTGTCACTTTTTCATTTAATCGTCGATGATG
AAAGAATCTGGATGACGACGGACTGTGGAATGATAATCGTGGTGACCCTC
GACACTCTCGTGTGCCACTTGAAGAATCAATCAGGCAAAACTACCAAGTT
TAAATGTTCTCTTCAAACGGACAAAGTTTATATTAGTTCCCATGCATTTG
CTCAATGTATAAAAATTATTTCGCTATTAGAATATTCCAACACTTCTTTA
TGCCTAAAAAATGTCAACTCAATAAAGAGGTTTACTGGAAAAAACGATTT
AAACGGAAATCCAAAAGAGAAACCAAGAACCGAACTAGAAGAAGATTTGA
GCACTTCGGTAAAGACCTATTACATGATGACTGCGATCGGTTCCAGCTAT
GTAAACCTCAATTGTCCAATGATGGAATCGGTCCATCCGTCTAATCATGC
CATCATTTGGAAAAGTTGAATGTGCTGTGTTTTACTTAATTTGATACTTT
TACTTTCGTTAATAAAAGCTCTATTTTTTTTCAAAAAAAA
back to top

protein sequence of SMED30031818-orf-1

>SMED30031818-orf-1 ID=SMED30031818-orf-1|Name=SMED30031818-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1032bp
MNKHLREQICDKRHKSSDNENLNNGMTEKVQILANKIYKEFERLISFYGS
DVVEYLMPLIVNILENLEELYRDKHTYEIDVELLKEDNCTLNRQYEREKY
LKKQSEERVIHIEYAYEEEKKALEEKIIILESSNRTFEVKFRNANETVSR
LEEKVEFLKIENQKIYERYTDVLKSHAEQLNKIKAETCRDISPPFSLSIR
DLENRSTKSLIRDLRLKNNIQNSVIIPNKLLDPEHSNPDLNHLHDENFDI
FDEKNDKSDSSDSMSHQGETVADILSNDHWMTDCCDGETDCNQVHSNNLK
NPSQFDSSSSYFMDPQDLSQRMNRDHSLETNIVDSDTDVTDDEFGIGREI
DCIIRENQDLVATKNALNIVKDDLINRLDIMTNENDMLREELRRHSNREA
DLKGKLAHLEQELKICKEKLIDSQASENNSSNEQKTFSRSEMAILLEEKN
HYKEKLMELQDAVVYKEMCRVKKQFPEFRESSKPMKAQNSGIWNLFNNLF
KKEDELSIQMKEKSKSLLSRFKRESDRSQLYSWSVPRSLVESELPKRIPI
PIKIQTIFEPKDIVICATTGYGSTVGNDSAQYLWCLIQSNTKNNKNYYLQ
QMCLTEKVPELTNKYSISLQFLTTPFTMTEVPAINLATKHFSSLICGNEN
KSIVKINEMTQNRNQSEISEIDKKRKIFQTKLQMKSKIKHNLGSKTIWFA
CEKNQIVIYVLFDNNKIESRMAIVTMDSEVDFIRYNFGRVFVIEKNGSFG
IFELNKEMNHWELNQCLLIDVTGGLPISDLCCDSSSFRLWIGSSISCCIM
DLSTLDTLKMLQVMEESQLSDYCSSIESMILIEKYSLMLFSISRLGILLG
YDLKNLQYKVLLDLKPSVFELIEPIQGIEKSTLSLFHLIVDDERIWMTTD
CGMIIVVTLDTLVCHLKNQSGKTTKFKCSLQTDKVYISSHAFAQCIKIIS
LLEYSNTSLCLKNVNSIKRFTGKNDLNGNPKEKPRTELEEDLSTSVKTYY
MMTAIGSSYVNLNCPMMESVHPSNHAIIWKS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0016301kinase activity
GO:0005078MAP-kinase scaffold activity
GO:0005515protein binding
GO:0008432JUN kinase binding
GO:0019894kinesin binding
GO:0019900kinase binding
GO:0030159receptor signaling complex scaffold activity
Vocabulary: biological process
TermDefinition
GO:0016310phosphorylation
GO:0043410positive regulation of MAPK cascade
GO:0007257activation of JUN kinase activity
GO:0016192vesicle-mediated transport
GO:0018991oviposition
GO:0030421defecation
GO:0040011locomotion
GO:0046328regulation of JNK cascade
GO:0048489synaptic vesicle transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR039911JIP3/JIP4
IPR034744RH2
IPR034743RH1
IPR019143JNK/Rab-associated_protein-1_N
IPR032486JIP_LZII
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0030424axon
GO:0043194axon initial segment
GO:0043679axon terminus
GO:0044297cell body
GO:0048471perinuclear region of cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 134..186
NoneNo IPR availableCOILSCoilCoilcoord: 371..426
NoneNo IPR availableCOILSCoilCoilcoord: 442..462
NoneNo IPR availableCOILSCoilCoilcoord: 67..87
NoneNo IPR availableGENE3DG3DSA:1.20.5.1000coord: 341..415
e-value: 1.5E-20
score: 75.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..22
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..19
NoneNo IPR availablePANTHERPTHR13886:SF4JNK-INTERACTING PROTEIN 3coord: 19..979
NoneNo IPR availableSUPERFAMILYSSF101908Putative isomerase YbhEcoord: 694..948
IPR019143JNK/Rab-associated protein-1, N-terminalPFAMPF09744Jnk-SapK_ap_Ncoord: 30..184
e-value: 3.3E-40
score: 137.9
IPR032486JNK-interacting protein, leucine zipper IIPFAMPF16471JIP_LZIIcoord: 344..414
e-value: 2.4E-22
score: 78.9
IPR039911JNK-interacting protein 3/4PANTHERPTHR13886JNK/SAPK-ASSOCIATED PROTEINcoord: 19..979
IPR034744RH2 domainPROSITEPS51777RH2coord: 434..503
score: 12.354
IPR034743RH1 domainPROSITEPS51776RH1coord: 13..101
score: 18.804