Jagged-like

Overview
NameJagged-like
Smed IDSMED30031788
Length (bp)1779
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Jagged-like (SMED30031788) t-SNE clustered cells

Violin plots show distribution of expression levels for Jagged-like (SMED30031788) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Jagged-like (SMED30031788) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Jagged-like (SMED30031788) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031788

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30031788SMESG000005506.1 SMESG000005505.1 SMESG000005493.1 SMESG000005489.1 SMESG000005487.1 SMESG000005484.1 Contig42391newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031788SMESG000005506.1 SMESG000005505.1 SMESG000005493.1 SMESG000005489.1 SMESG000005487.1 SMESG000005484.1 Contig42391uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30031788SMESG000005484.1 dd_Smed_v4_10221_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30031788SMESG000005484.1 dd_Smed_v4_10221_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30031788SMESG000005484.1 dd_Smed_v4_10221_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30031788SMESG000005484.1 dd_Smed_v4_10221_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30031788SMESG000005484.1 dd_Smed_v4_10221_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031788SMESG000005506.1 SMESG000005505.1 SMESG000005493.1 SMESG000005489.1 SMESG000005487.1 SMESG000005484.1 Contig36854newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031788SMESG000005506.1 SMESG000005505.1 SMESG000005493.1 SMESG000005489.1 SMESG000005487.1 SMESG000005484.1 Contig36854uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031788SMESG000005506.1 SMESG000005505.1 SMESG000005493.1 SMESG000005489.1 SMESG000005487.1 SMESG000005484.1 Contig35154newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031788SMESG000005506.1 SMESG000005505.1 SMESG000005493.1 SMESG000005489.1 SMESG000005487.1 SMESG000005484.1 Contig35154uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
glial cellSMED30031788SMESG000005484.1 dd_Smed_v6_10221_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Jagged-like vs. Ensembl Human
Match: JAG1 (jagged canonical Notch ligand 1 [Source:HGNC Symbol;Acc:HGNC:6188])

HSP 1 Score: 65.855 bits (159), Expect = 1.966e-10
Identity = 38/96 (39.58%), Postives = 54/96 (56.25%), Query Frame = 1
Query:  661 NLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFC 945
            N+++C  E+  C N GTC+ G ++ KC C DG+ G  CE   + C++  C NGG C   +L NDF C CKN + GK+C      C++ TC     C
Sbjct:  629 NINDC--ESNPCRNGGTCIDGVNSYKCICSDGWEGAYCETNINDCSQNPCHNGGTC--RDLVNDFYCDCKNGWKGKTCHSRDSQCDEATCNNGGTC 720          

HSP 2 Score: 54.6842 bits (130), Expect = 4.629e-7
Identity = 47/166 (28.31%), Postives = 68/166 (40.96%), Query Frame = 1
Query:  478 IHSQDFATLSVDIVIKCKPGFFPKN------RCLVSCFEEASVYKCDENGRKICLSGYVFDPLTNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFCEIV 954
            ++++    L       C PG+  +N       CL  C  +AS        R IC  GY  D      ++D C S    C N G C +  +  +C C  GFSG  C++  D C    C+NG +C      +D+ C C  +Y GK+C      C    CE    C + 
Sbjct:  422 VNAKSCKNLIASYYCDCLPGWMGQNCDININDCLGQCQNDASCRDLVNGYRCICPPGYAGDHCER--DIDECASN--PCLNGGHCQNEINRFQCLCPTGFSGNLCQLDIDYCEPNPCQNGAQCYNR--ASDYFCKCPEDYEGKNCSHLKDHCRTTPCEVIDSCTVA 581          
BLAST of Jagged-like vs. Ensembl Human
Match: VCAN (versican [Source:HGNC Symbol;Acc:HGNC:2464])

HSP 1 Score: 64.3142 bits (155), Expect = 4.921e-10
Identity = 33/96 (34.38%), Postives = 46/96 (47.92%), Query Frame = 1
Query:  631 YVFDPLTNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCN 915
            Y+ +   NK   D C      C N GTC     +  C CV G+SG  CE+ +D C    C+NG  C+     N F C C  +Y G  CE+  ++C+
Sbjct: 1277 YIIEVRENKTGPDRCKMNP--CLNGGTCYPTETSYVCTCVPGYSGDQCELDFDECHSNPCRNGATCVDG--FNTFRCLCLPSYVGALCEQDTETCD 1368          
BLAST of Jagged-like vs. Ensembl Human
Match: VCAN (versican [Source:HGNC Symbol;Acc:HGNC:2464])

HSP 1 Score: 64.3142 bits (155), Expect = 5.077e-10
Identity = 33/96 (34.38%), Postives = 46/96 (47.92%), Query Frame = 1
Query:  631 YVFDPLTNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCN 915
            Y+ +   NK   D C      C N GTC     +  C CV G+SG  CE+ +D C    C+NG  C+     N F C C  +Y G  CE+  ++C+
Sbjct: 1325 YIIEVRENKTGPDRCKMNP--CLNGGTCYPTETSYVCTCVPGYSGDQCELDFDECHSNPCRNGATCVDG--FNTFRCLCLPSYVGALCEQDTETCD 1416          
BLAST of Jagged-like vs. Ensembl Human
Match: NOTCH1 (notch receptor 1 [Source:HGNC Symbol;Acc:HGNC:7881])

HSP 1 Score: 64.3142 bits (155), Expect = 5.267e-10
Identity = 38/123 (30.89%), Postives = 56/123 (45.53%), Query Frame = 1
Query:  625 SGYV------FDPLTNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFCEIVNNQPKC 972
            SGYV      F     + N++ C S    C N GTC+      KC C+  ++G +CE+   PC    C+NGG+C +SE    F C C   + G++CE     C    C     C+  +   +C
Sbjct:  773 SGYVCTCREGFSGPNCQTNINECASNP--CLNQGTCIDDVAGYKCNCLLPYTGATCEVVLAPCAPSPCRNGGECRQSEDYESFSCVCPTGWQGQTCEVDINECVLSPCRHGASCQNTHGGYRC 893          

HSP 2 Score: 59.3066 bits (142), Expect = 1.971e-8
Identity = 37/122 (30.33%), Postives = 55/122 (45.08%), Query Frame = 1
Query:  565 SCFEEASVYKCDENGRKICLSGYVFDPLTNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITC 927
            +C ++   ++C      IC+ GY  + +  + N D C S    C +NG C+   +  +C C  GF+G  C+   D C    CKNG KC+     N + C C   Y G  CE     C+   C
Sbjct:  466 TCLDQIGEFQC------ICMPGY--EGVHCEVNTDECASSP--CLHNGRCLDKINEFQCECPTGFTGHLCQYDVDECASTPCKNGAKCLDG--PNTYTCVCTEGYTGTHCEVDIDECDPDPC 575          

HSP 3 Score: 57.3806 bits (137), Expect = 8.408e-8
Identity = 43/152 (28.29%), Postives = 61/152 (40.13%), Query Frame = 1
Query:  565 SCFEEASVYKCDENGRKICLSGYVFDPLTNKCNLDNCN------SENIICFNNGTCVSGAHNPKCFCVDGFSGPSCE-IWDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFCEIVNNQPKCSVKKNSKSF 999
            +C +  + YKC       C  G     +  + N+D+CN      S +  CFNNGTCV       C C  GF G  CE   + C    C   G     +  NDF C C+  + G+ CE     C    C+    C + +N  +  + K    F
Sbjct: 1197 TCLDLPNTYKCS------CPRGT--QGVHCEINVDDCNPPVDPVSRSPKCFNNGTCVDQVGGYSCTCPPGFVGERCEGDVNECLSNPCDARGTQNCVQRVNDFHCECRAGHTGRRCESVINGCKGKPCKNGGTCAVASNTARGFICKCPAGF 1340          

HSP 4 Score: 55.4546 bits (132), Expect = 3.291e-7
Identity = 32/91 (35.16%), Postives = 44/91 (48.35%), Query Frame = 1
Query:  643 PLTNKCNLDNCNSENIICFNNGTC-VSGAHNPKCFCVDGFSGPSCEIWDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSC 912
            PL N C  + C        N GTC +      KC C  G+SG SC+  DPC    C NGG+C+  E    +IC C  +++G +C +    C
Sbjct:  101 PLDNACLTNPCR-------NGGTCDLLTLTEYKCRCPPGWSGKSCQQADPCASNPCANGGQCLPFEAS--YICHCPPSFHGPTCRQDVNEC 182          

HSP 5 Score: 54.6842 bits (130), Expect = 6.030e-7
Identity = 43/157 (27.39%), Postives = 65/157 (41.40%), Query Frame = 1
Query:  526 CKPGFFPK------NRCLVS-CFEEASVYKCDENGRKICLSGYVFDPLTNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCE-IWDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFCEIVNNQPKC 972
            C PGF         N C    C   A+   C ++    C +G  F  +  + N  +C   +  CFN GTCV G ++  C C  GF+G  C+   + C    C +GG C   +    + C C   Y G +C+     C+   C+    C   + Q +C
Sbjct:  933 CLPGFRGTFCEEDINECASDPCRNGANCTDCVDSYTCTCPAG--FSGIHCENNTPDCTESS--CFNGGTCVDGINSFTCLCPPGFTGSYCQHDVNECDSQPCLHGGTC--QDGCGSYRCTCPQGYTGPNCQNLVHWCDSSPCKNGGKCWQTHTQYRC 1083          

HSP 6 Score: 54.299 bits (129), Expect = 7.590e-7
Identity = 37/126 (29.37%), Postives = 57/126 (45.24%), Query Frame = 1
Query:  604 NGRKICL--SGYVFDPLTNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFCEIVNNQPKC 972
            NG+ IC   SGY     +   ++D C+     C + G C++   + +C C+ G++GP CEI  + C    C+N   C+  +   +F C C   Y G  CE     C    C  N  C    N+ +C
Sbjct:  393 NGKAICTCPSGYTGPACSQ--DVDECSLGANPCEHAGKCINTLGSFECQCLQGYTGPRCEIDVNECVSNPCQNDATCL--DQIGEFQCICMPGYEGVHCEVNTDECASSPCLHNGRCLDKINEFQC 514          

HSP 7 Score: 53.1434 bits (126), Expect = 1.635e-6
Identity = 37/134 (27.61%), Postives = 56/134 (41.79%), Query Frame = 1
Query:  550 NRCLVS-CFEEASVYKCDENGRKICLSGYVFDPLTNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSC-EIWDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFC 945
            N C++S C   AS        R  C +GY       + ++D+C      C N G+C  G +   C C+ GF G  C E  + C    C+NG  C  ++  + + C C   + G  CE     C + +C     C
Sbjct:  871 NECVLSPCRHGASCQNTHGGYRCHCQAGY--SGRNCETDIDDCRPNP--CHNGGSCTDGINTAFCDCLPGFRGTFCEEDINECASDPCRNGANC--TDCVDSYTCTCPAGFSGIHCENNTPDCTESSCFNGGTC 998          

HSP 8 Score: 51.9878 bits (123), Expect = 3.316e-6
Identity = 34/141 (24.11%), Postives = 55/141 (39.01%), Query Frame = 1
Query:  568 CFEEASVYKCDENGRKICLSGYVFDPLTNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEI------WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFCEIVNNQPKC 972
            C ++ + ++C+      C +G+      + C  D     +  C N   C+ G +   C C +G++G  CE+       DPC    CK+G           F C C+  Y G  CE     C+   C     C+  +N   C
Sbjct:  505 CLDKINEFQCE------CPTGFT----GHLCQYDVDECASTPCKNGAKCLDGPNTYTCVCTEGYTGTHCEVDIDECDPDPCHYGSCKDGVAT--------FTCLCRPGYTGHHCETNINECSSQPCRHGGTCQDRDNAYLC 627          

HSP 9 Score: 51.9878 bits (123), Expect = 3.550e-6
Identity = 28/102 (27.45%), Postives = 47/102 (46.08%), Query Frame = 1
Query:  691 ICFNNGTCVSGAHNPKCFCVDGFSGPSCE-IWDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFCEIVNNQPKCSVKKNSK 993
            +C + G CV   +   C C  G++G  CE + D C+   C+NG  C  ++    + C C   Y+G +C +    C    C+    C  + N  KCS  + ++
Sbjct: 1115 LCQHGGLCVDAGNTHHCRCQAGYTGSYCEDLVDECSPSPCQNGATC--TDYLGGYSCKCVAGYHGVNCSEEIDECLSHPCQNGGTCLDLPNTYKCSCPRGTQ 1214          
BLAST of Jagged-like vs. Ensembl Human
Match: SNED1 (sushi, nidogen and EGF like domains 1 [Source:HGNC Symbol;Acc:HGNC:24696])

HSP 1 Score: 63.5438 bits (153), Expect = 8.265e-10
Identity = 43/140 (30.71%), Postives = 65/140 (46.43%), Query Frame = 1
Query:  550 NRCLVSCFEEASVYKCDENGRKICLSGYVFDPLTNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCE-IWDPCTKPRCKNGGKCIKSELKND-FICFCKNNYYGKSCEKTGKSCNDITCEKNQFC-EIVNN 960
             +C+  C      Y C       CLSG+       +C+LD     +  C N GTC  G ++ +C C  GF GP+CE    PC    C++GG+C   +++N   +C C+  Y G +CE     C+   C     C ++V N
Sbjct:  282 GKCIDDCVTGNPSYTCS------CLSGFT----GRRCHLDVNECASQPCQNGGTCTHGINSFRCQCPAGFGGPTCETAQSPCDTKECQHGGQC---QVENGSAVCVCQAGYTGAACEMDVDDCSPDPCLNGGSCVDLVGN 408          

HSP 2 Score: 53.1434 bits (126), Expect = 1.358e-6
Identity = 33/124 (26.61%), Postives = 54/124 (43.55%), Query Frame = 1
Query:  601 ENGRKICLSGYVFDPLTNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCE-----IWDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFCEIVN 957
            ENG  +C+    +     + ++D+C+ +   C N G+CV    N  C C + F G  CE     + D C    C NGG C+ ++    ++C C   + G  C +  +  +D  C     C   N
Sbjct:  367 ENGSAVCVCQAGYTGAACEMDVDDCSPDP--CLNGGSCVDLVGNYTCLCAEPFKGLRCETGDHPVPDACLSAPCHNGGTCVDAD--QGYVCECPEGFMGLDCRE--RVPDDCECRNGGRCLGAN 484          

HSP 3 Score: 51.9878 bits (123), Expect = 3.332e-6
Identity = 32/78 (41.03%), Postives = 38/78 (48.72%), Query Frame = 1
Query:  667 DNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEIW-DPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEK 897
            D+C S    C N GTC       KC C  GFSG  CEI   PC +  C NGG C   +   DF C C+  Y G+ C+ 
Sbjct:  621 DSCASGP--CHNGGTCFHYIGKYKCDCPPGFSGRHCEIAPSPCFRSPCVNGGTC--EDRDTDFFCHCQAGYMGRRCQA 694          

HSP 4 Score: 51.6026 bits (122), Expect = 4.494e-6
Identity = 31/113 (27.43%), Postives = 47/113 (41.59%), Query Frame = 1
Query:  613 KICLSGYVFDPLTNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFCE 948
            ++C    V+        +D C S+   C + G+C        C C  G+ G  CE+  D C    C+NGG C    L   ++C C   + G  CE    +C+   C+    CE
Sbjct:  737 RVCQPHGVWSEPPQCLEIDECRSQP--CLHGGSCQDRVAGYLCLCSTGYEGAHCELERDECRAHPCRNGGSC--RNLPGAYVCRCPAGFVGVHCETEVDACDSSPCQHGGRCE 845          
BLAST of Jagged-like vs. Ensembl Celegans
Match: cdh-4 (Cadherin-4 [Source:UniProtKB/TrEMBL;Acc:A0A1C3NSI5])

HSP 1 Score: 61.6178 bits (148), Expect = 1.740e-9
Identity = 35/91 (38.46%), Postives = 49/91 (53.85%), Query Frame = 1
Query:  673 CNSENIICFNNGTCVS-GAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDI-TCEKN 936
            CN  ++ C + GTC+S G  + KC C   +SG  CEI  +PC    C  G +CI     ND++C C N + GK CE  G   ++  +C KN
Sbjct: 3933 CN--DLPCQHAGTCISQGKSHFKCECPSRYSGNVCEIDLEPCASSPCPTGIQCIP--FYNDYLCKCPNGFTGKHCEARGFEDHETSSCSKN 4019          
BLAST of Jagged-like vs. Ensembl Celegans
Match: clec-78 (C-type LECtin [Source:UniProtKB/TrEMBL;Acc:Q20531])

HSP 1 Score: 58.9214 bits (141), Expect = 1.170e-8
Identity = 52/162 (32.10%), Postives = 72/162 (44.44%), Query Frame = 1
Query:  526 CKPGFFPKNRCLV--------SCFEEASVYKCDENGRKI-CLSGYVFDPLTNKCNLDNCNSENIICFNNGTC--VSGAHNPKCFCVDGFSGPSCE-IWDPC-TKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFCEIVNNQPKC 972
            CKPG+   +RC +         C+      KC++ G    C    +F+    +   D CN   + C N G C  + G  +  C C  GF+GP CE I D C T   C+NG +CI  +L   F C C   + G +C+K    C D  C  N  C  + N  KC
Sbjct: 2039 CKPGYV-GDRCEMLEDVCSTQPCYNGG---KCEQVGTTYKCTCPKMFNGARCQFESDECN--GVKCPNGGVCHDLPGVKSTTCLCRTGFAGPQCEEITDICSTNNPCRNGARCIGEKLGR-FKCQCVPGWEGPNCDKNIDDCADSPCALNATCVDLINDYKC 2193          

HSP 2 Score: 55.0694 bits (131), Expect = 1.775e-7
Identity = 52/169 (30.77%), Postives = 68/169 (40.24%), Query Frame = 1
Query:  511 DIVIKCKPGF------FPKNRCLVS-------CFEEASVYKCDENGRKICLSGYVFDPLTNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCE-IWDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFC-EIVNNQPKC 972
            D    CKPG+        +++C  S       C +    YKC      +C SG+       KC  DN +     C NNG CVS   +  C C  G SG +CE   + C    C NGG+C   +  +   C C  ++ GK CE     C   TCE    C E      KC
Sbjct: 2343 DFKCVCKPGYTGPRCDVKQDQCADSPCLNDAQCVDMGGAYKC------VCKSGWT----GPKCEQDNGSCAAKPCRNNGFCVSLVADYFCVCPPGVSGKNCESAPNRCIGQPCHNGGEC--GDFGSHLECACPASFTGKGCEFKNTGCK--TCENGGKCAEAAGGLQKC 2497          

HSP 3 Score: 51.9878 bits (123), Expect = 1.359e-6
Identity = 47/166 (28.31%), Postives = 67/166 (40.36%), Query Frame = 1
Query:  526 CKPGFFPKN------RCLVS-------CFEEASVYKCDENGRKICLSGYVFDPLTNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFCEIVNNQPKCSVK 981
            C+PG+  +N       C  S       C +E + Y C+      C  GY  + +  +  +D+C  +   C NN TC +      C C  GF G  CE+  D C + +C   G     +  NDF C CK  Y G  C+     C D  C  +  C  +    KC  K
Sbjct: 2232 CQPGWTGENCDQNIDECAASPCQNDAKCIDEINGYMCE------CADGY--EGVHCQHLVDHCAKQP--CHNNATCTNMGATYHCDCTLGFDGVHCEMNIDECAENQCDKLGTESCRDAVNDFKCVCKPGYTGPRCDVKQDQCADSPCLNDAQCVDMGGAYKCVCK 2387          

HSP 4 Score: 51.6026 bits (122), Expect = 1.878e-6
Identity = 37/138 (26.81%), Postives = 56/138 (40.58%), Query Frame = 1
Query:  565 SCFEEASVYKCDENGRKICLSGYVFDPLTNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEIWD-PCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFCEIVNNQPKCS 975
            SC +  + +KC      +C  GY       +C++      +  C N+  CV      KC C  G++GP CE  +  C    C+N G C+   L  D+ C C     GK+CE     C    C     C    +  +C+
Sbjct: 2336 SCRDAVNDFKC------VCKPGYT----GPRCDVKQDQCADSPCLNDAQCVDMGGAYKCVCKSGWTGPKCEQDNGSCAAKPCRNNGFCVS--LVADYFCVCPPGVSGKNCESAPNRCIGQPCHNGGECGDFGSHLECA 2461          

HSP 5 Score: 49.2914 bits (116), Expect = 9.790e-6
Identity = 27/86 (31.40%), Postives = 38/86 (44.19%), Query Frame = 1
Query:  691 ICFNNGTCVSGAHNPKCFCVDGFSGPSCEIW-DPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFC 945
            +C NN  C    H  +C C  G+ G  CE+  D C+   C NGGKC   ++   + C C   + G  C+     CN + C     C
Sbjct: 2021 MCENNAECSVFMHRAQCHCKPGYVGDRCEMLEDVCSTQPCYNGGKC--EQVGTTYKCTCPKMFNGARCQFESDECNGVKCPNGGVC 2104          
BLAST of Jagged-like vs. Ensembl Celegans
Match: ZC116.3 (Probable cubilin [Source:UniProtKB/Swiss-Prot;Acc:Q20911])

HSP 1 Score: 55.4546 bits (132), Expect = 1.328e-7
Identity = 41/127 (32.28%), Postives = 59/127 (46.46%), Query Frame = 1
Query:  547 KNRC--LVSCFEEASVYKCDENGRKICLSGYVFDPLTNKCNLDNCNS--ENIICFNNGTCVSGAHNP-KCFCVDGFSGPSCEIWDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSC 912
            KN+C  L +C      Y    +    C  GYV D +  +  + + ++  +N  C N G C   +    KC C  GF G  CE   PC    CKNGG CI  E  N   C C  +++G++CE+  + C
Sbjct:  394 KNKCHKLATCKVTDDGYSAVGDYTCYCPDGYVGDGIGEEGCVKSASNVCQNHNCVNAGKCKPTSDTEYKCECEAGFLGKFCEKTSPCQTNPCKNGGTCIAVE--NSAYCDCPEHFFGRACEEEEEHC 518          
BLAST of Jagged-like vs. Ensembl Celegans
Match: slt-1 (Slit homolog 1 protein [Source:UniProtKB/Swiss-Prot;Acc:G5EFX6])

HSP 1 Score: 55.0694 bits (131), Expect = 1.514e-7
Identity = 34/108 (31.48%), Postives = 52/108 (48.15%), Query Frame = 1
Query:  604 NGRKICLSGYVFDPLTNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEI----------WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEK 897
            NG   C+    F     + N+D+C  +N+ C N G+CV G  +  C C  G++G  CEI           D C +  C   G+C+ S+  +DF C C   + G SC++
Sbjct: 1006 NGSYSCMCSPGFTGNNCETNIDDC--KNVECQNGGSCVDGILSYDCLCRPGYAGQYCEIPPMMDMEYQKTDACQQSACGQ-GECVASQNSSDFTCKCHEGFSGPSCDR 1110          

HSP 2 Score: 51.9878 bits (123), Expect = 1.316e-6
Identity = 35/104 (33.65%), Postives = 48/104 (46.15%), Query Frame = 1
Query:  694 CFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFC-EIVNNQPKCSVKKNSKSF 999
            C NNG C+    +  C C  GF+G +CE   D C    C+NGG C+   L  D  C C+  Y G+ CE       D+  +K   C +    Q +C   +NS  F
Sbjct:  996 CENNGKCIPINGSYSCMCSPGFTGNNCETNIDDCKNVECQNGGSCVDGILSYD--CLCRPGYAGQYCEIPPMM--DMEYQKTDACQQSACGQGECVASQNSSDF 1095          
BLAST of Jagged-like vs. Ensembl Celegans
Match: crb-1 (Drosophila CRumBs homolog [Source:UniProtKB/TrEMBL;Acc:Q19350])

HSP 1 Score: 55.0694 bits (131), Expect = 1.522e-7
Identity = 38/112 (33.93%), Postives = 60/112 (53.57%), Query Frame = 1
Query:  604 NGRK-ICLSGYVFDPLTNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEIW-DPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKS-CNDITCE 930
            N RK +C +G+  +   +  N+++C  + + C  +G C+ G    KC C +GF G  CE+  D C    C NGGKC+K+  +   +C C N++ G SC  T  + C D  C+
Sbjct: 1194 NKRKCVCPAGFAGENCED--NVNDC--KFVDCGKHGYCLDGIDEAKCICNNGFHGEHCELAKDECEGVECHNGGKCVKNRSEK-IVCQCGNSWMGDSCNVTKTTNCKDSPCQ 1300          

HSP 2 Score: 49.6766 bits (117), Expect = 6.561e-6
Identity = 35/86 (40.70%), Postives = 41/86 (47.67%), Query Frame = 1
Query:  694 CFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCE-KTGKSCNDITCEKNQFC 945
            C NNGTCV+   N KC C  GF G  CE   D C +  C+NG  C    LK  + C C   + GK CE +  K C    C  N  C
Sbjct:  134 CQNNGTCVAENGNVKCACPPGFVGDHCETDEDECKENFCQNGADC--ENLKGSYECKCLKGFSGKYCEIQDKKQCTSDYCHNNGQC 217          
BLAST of Jagged-like vs. Ensembl Fly
Match: eys (gene:FBgn0031414 transcript:FBtr0344662)

HSP 1 Score: 64.3142 bits (155), Expect = 2.962e-10
Identity = 44/129 (34.11%), Postives = 55/129 (42.64%), Query Frame = 1
Query:  565 SCFEEASVYKCDENGRKICLSGYVFDPLTN---KCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSC-EIWDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQ 939
            +C     V+    +G     S Y  D  T    + N D C S    C N GTCV G     C C +GFSG +C E  D C    C+NGG C   +  N +IC C+  Y G  CE     C   T  + Q
Sbjct:  147 ACLSNPCVFGVCIDGLNSSYSCYCIDGYTGIQCQTNWDECWSSP--CQNGGTCVDGVAYYNCTCPEGFSGSNCEENVDECMSNPCQNGGLC--RDRTNGYICTCQPGYLGSHCELDVAVCETGTGARCQ 271          

HSP 2 Score: 60.077 bits (144), Expect = 6.538e-9
Identity = 29/102 (28.43%), Postives = 47/102 (46.08%), Query Frame = 1
Query:  694 CFNN----GTCVSGAHNP-KCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFCEIVNNQPKCSVK 981
            C +N    G C+ G ++   C+C+DG++G  C+  WD C    C+NGG C+       + C C   + G +CE+    C    C+    C    N   C+ +
Sbjct:  148 CLSNPCVFGVCIDGLNSSYSCYCIDGYTGIQCQTNWDECWSSPCQNGGTCVDGVAY--YNCTCPEGFSGSNCEENVDECMSNPCQNGGLCRDRTNGYICTCQ 247          

HSP 3 Score: 51.6026 bits (122), Expect = 2.057e-6
Identity = 35/131 (26.72%), Postives = 55/131 (41.98%), Query Frame = 1
Query:  565 SCFEEASVYKCDENGRKICLSGYVFDPLTNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCE----IWDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFC 945
            +C +  + Y C       C  G  F     + N+D C S    C N G C    +   C C  G+ G  CE    + +  T  RC++GG+CI+     +F C C   ++G+ C++    C    C+    C
Sbjct:  196 TCVDGVAYYNC------TCPEG--FSGSNCEENVDECMSNP--CQNGGLCRDRTNGYICTCQPGYLGSHCELDVAVCETGTGARCQHGGECIEGP-GLEFTCDCPAGWHGRICQEEINECASSPCQNGGVC 315          

HSP 4 Score: 51.2174 bits (121), Expect = 2.795e-6
Identity = 31/82 (37.80%), Postives = 37/82 (45.12%), Query Frame = 1
Query:  670 NCNSENIICF-----NNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCT-KPRCKNGGKCIKSELKNDFICFCKNNYYGKSCE 894
            NC  E +IC      NN  C+     P C+CV  + G  CE  +D C   PRC NGG CI     + F C C     G  CE
Sbjct:  334 NCEEEILICADNPCQNNALCLMEEGVPTCYCVPDYHGEKCEFQYDECQLGPRCMNGGVCIDG--VDTFSCSCPPLLTGMLCE 413          

HSP 5 Score: 50.447 bits (119), Expect = 5.252e-6
Identity = 40/140 (28.57%), Postives = 54/140 (38.57%), Query Frame = 1
Query:  568 CFEEASVYKCDENGRKICLSGYVFDPLTNKCNLDNCNSEN---IICFNNGTCVSG-AHNPKCFCVDGFSGPSC-EIWDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFCEIVNNQPKC 972
            C +  + Y C       C  GY    L + C LD    E      C + G C+ G      C C  G+ G  C E  + C    C+NGG C+       + C C   Y G +CE+    C D  C+ N  C +    P C
Sbjct:  235 CRDRTNGYIC------TCQPGY----LGSHCELDVAVCETGTGARCQHGGECIEGPGLEFTCDCPAGWHGRICQEEINECASSPCQNGGVCVDKLAA--YACACPMGYTGINCEEEILICADNPCQNNALCLMEEGVPTC 362          
BLAST of Jagged-like vs. Ensembl Fly
Match: eys (gene:FBgn0031414 transcript:FBtr0344663)

HSP 1 Score: 64.3142 bits (155), Expect = 2.962e-10
Identity = 44/129 (34.11%), Postives = 55/129 (42.64%), Query Frame = 1
Query:  565 SCFEEASVYKCDENGRKICLSGYVFDPLTN---KCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSC-EIWDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQ 939
            +C     V+    +G     S Y  D  T    + N D C S    C N GTCV G     C C +GFSG +C E  D C    C+NGG C   +  N +IC C+  Y G  CE     C   T  + Q
Sbjct:  147 ACLSNPCVFGVCIDGLNSSYSCYCIDGYTGIQCQTNWDECWSSP--CQNGGTCVDGVAYYNCTCPEGFSGSNCEENVDECMSNPCQNGGLC--RDRTNGYICTCQPGYLGSHCELDVAVCETGTGARCQ 271          

HSP 2 Score: 60.077 bits (144), Expect = 6.538e-9
Identity = 29/102 (28.43%), Postives = 47/102 (46.08%), Query Frame = 1
Query:  694 CFNN----GTCVSGAHNP-KCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFCEIVNNQPKCSVK 981
            C +N    G C+ G ++   C+C+DG++G  C+  WD C    C+NGG C+       + C C   + G +CE+    C    C+    C    N   C+ +
Sbjct:  148 CLSNPCVFGVCIDGLNSSYSCYCIDGYTGIQCQTNWDECWSSPCQNGGTCVDGVAY--YNCTCPEGFSGSNCEENVDECMSNPCQNGGLCRDRTNGYICTCQ 247          

HSP 3 Score: 51.6026 bits (122), Expect = 2.057e-6
Identity = 35/131 (26.72%), Postives = 55/131 (41.98%), Query Frame = 1
Query:  565 SCFEEASVYKCDENGRKICLSGYVFDPLTNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCE----IWDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFC 945
            +C +  + Y C       C  G  F     + N+D C S    C N G C    +   C C  G+ G  CE    + +  T  RC++GG+CI+     +F C C   ++G+ C++    C    C+    C
Sbjct:  196 TCVDGVAYYNC------TCPEG--FSGSNCEENVDECMSNP--CQNGGLCRDRTNGYICTCQPGYLGSHCELDVAVCETGTGARCQHGGECIEGP-GLEFTCDCPAGWHGRICQEEINECASSPCQNGGVC 315          

HSP 4 Score: 51.2174 bits (121), Expect = 2.795e-6
Identity = 31/82 (37.80%), Postives = 37/82 (45.12%), Query Frame = 1
Query:  670 NCNSENIICF-----NNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCT-KPRCKNGGKCIKSELKNDFICFCKNNYYGKSCE 894
            NC  E +IC      NN  C+     P C+CV  + G  CE  +D C   PRC NGG CI     + F C C     G  CE
Sbjct:  334 NCEEEILICADNPCQNNALCLMEEGVPTCYCVPDYHGEKCEFQYDECQLGPRCMNGGVCIDG--VDTFSCSCPPLLTGMLCE 413          

HSP 5 Score: 50.447 bits (119), Expect = 5.252e-6
Identity = 40/140 (28.57%), Postives = 54/140 (38.57%), Query Frame = 1
Query:  568 CFEEASVYKCDENGRKICLSGYVFDPLTNKCNLDNCNSEN---IICFNNGTCVSG-AHNPKCFCVDGFSGPSC-EIWDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFCEIVNNQPKC 972
            C +  + Y C       C  GY    L + C LD    E      C + G C+ G      C C  G+ G  C E  + C    C+NGG C+       + C C   Y G +CE+    C D  C+ N  C +    P C
Sbjct:  235 CRDRTNGYIC------TCQPGY----LGSHCELDVAVCETGTGARCQHGGECIEGPGLEFTCDCPAGWHGRICQEEINECASSPCQNGGVCVDKLAA--YACACPMGYTGINCEEEILICADNPCQNNALCLMEEGVPTC 362          
BLAST of Jagged-like vs. Ensembl Fly
Match: wry (gene:FBgn0051665 transcript:FBtr0089786)

HSP 1 Score: 59.3066 bits (142), Expect = 8.320e-9
Identity = 35/98 (35.71%), Postives = 42/98 (42.86%), Query Frame = 1
Query:  667 DNCNSENIICFNNGTCVS--GAHNPKCFCVDGFSGPSCEIWDPCTKPRCKNGGKCI---KSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFC 945
            DNC  EN  C   G C S  G    +C C  GF+GP CE  D C    C N G C+   +    N + C C   Y GK+C+     CN   C     C
Sbjct:  698 DNC-GENADCSGKGVCYSNSGMEEYECQCCSGFAGPHCEEIDACNPSPCTNNGICVDLSQGHEGNSYQCLCPYGYAGKNCQYESDPCNPAECMNGGSC 794          
BLAST of Jagged-like vs. Ensembl Fly
Match: wry (gene:FBgn0051665 transcript:FBtr0304911)

HSP 1 Score: 59.3066 bits (142), Expect = 8.387e-9
Identity = 35/98 (35.71%), Postives = 42/98 (42.86%), Query Frame = 1
Query:  667 DNCNSENIICFNNGTCVS--GAHNPKCFCVDGFSGPSCEIWDPCTKPRCKNGGKCI---KSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFC 945
            DNC  EN  C   G C S  G    +C C  GF+GP CE  D C    C N G C+   +    N + C C   Y GK+C+     CN   C     C
Sbjct:  698 DNC-GENADCSGKGVCYSNSGMEEYECQCCSGFAGPHCEEIDACNPSPCTNNGICVDLSQGHEGNSYQCLCPYGYAGKNCQYESDPCNPAECMNGGSC 794          
BLAST of Jagged-like vs. Ensembl Fly
Match: wry (gene:FBgn0051665 transcript:FBtr0334823)

HSP 1 Score: 59.3066 bits (142), Expect = 8.461e-9
Identity = 35/98 (35.71%), Postives = 42/98 (42.86%), Query Frame = 1
Query:  667 DNCNSENIICFNNGTCVS--GAHNPKCFCVDGFSGPSCEIWDPCTKPRCKNGGKCI---KSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFC 945
            DNC  EN  C   G C S  G    +C C  GF+GP CE  D C    C N G C+   +    N + C C   Y GK+C+     CN   C     C
Sbjct:  699 DNC-GENADCSGKGVCYSNSGMEEYECQCCSGFAGPHCEEIDACNPSPCTNNGICVDLSQGHEGNSYQCLCPYGYAGKNCQYESDPCNPAECMNGGSC 795          
BLAST of Jagged-like vs. Ensembl Zebrafish
Match: notch1a (notch receptor 1a [Source:NCBI gene;Acc:30718])

HSP 1 Score: 67.3958 bits (163), Expect = 3.516e-11
Identity = 46/159 (28.93%), Postives = 71/159 (44.65%), Query Frame = 1
Query:  526 CKPGFFP---KNRCLVS--CFEEASVYKCDENGRKICLSGYVFDPL---TNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCE-IWDPCTKPRCKNGGKC-IKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFCEIVNNQPKC 972
            C P   P   + RC     C +    Y C      +C +G+V +      N+C  D C+        +  CV   ++ +C C  G++G  CE +++ C    CKNGG C + S  K+ +IC C+  Y G SCE   +SC  + C     C   +  P+C
Sbjct:  441 CSPSVDPLTGEPRCFNGGRCVDRVGGYGC------VCPAGFVGERCEGDVNECLSDPCDPSG-----SYNCVQLINDFRCECRTGYTGKRCETVFNGCKDTPCKNGGTCAVASNTKHGYICKCQPGYSGSSCEYDSQSCGSLRCRNGATCVSGHLSPRC 588          

HSP 2 Score: 62.003 bits (149), Expect = 2.090e-9
Identity = 34/105 (32.38%), Postives = 49/105 (46.67%), Query Frame = 1
Query:  661 NLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCE-IWDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFCEIVNNQPKC 972
            N++ C S    C N G+C+      KC C+  ++G  CE +  PC+   CKNGG C +SE    F C C   + G++CE     C    C     CE +    +C
Sbjct:    7 NINECASNP--CLNQGSCIDDVAGFKCNCMLPYTGEVCENVLAPCSPRPCKNGGVCRESEDFQSFSCNCPAGWQGQTCEVDINECVRNPCTNGGVCENLRGGFQC 109          

HSP 3 Score: 59.6918 bits (143), Expect = 1.099e-8
Identity = 37/121 (30.58%), Postives = 55/121 (45.45%), Query Frame = 1
Query:  616 ICLSGYVFDPLTNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEIWDP-CTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFCEIVNNQPKCS 975
            +CL+G+  +      ++D C S    C N G C    ++  C C  GFSG +CEI  P CT+  C NGG C+     + F C C   + G  C+     C+   C+    C+      KC+
Sbjct:  148 VCLAGFRGERCAE--DIDECVSAP--CRNGGNCTDCVNSYTCSCPAGFSGINCEINTPDCTESSCFNGGTCVDG--ISSFSCVCLPGFTGNYCQHDVNECDSRPCQNGGSCQDGYGTYKCT 262          

HSP 4 Score: 57.3806 bits (137), Expect = 5.342e-8
Identity = 29/97 (29.90%), Postives = 46/97 (47.42%), Query Frame = 1
Query:  658 CNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCE-IWDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFC 945
            C ++  +     CFN GTCV G  +  C C+ GF+G  C+   + C    C+NGG C   +    + C C + Y G +C+   + C+   C+    C
Sbjct:  196 CEINTPDCTESSCFNGGTCVDGISSFSCVCLPGFTGNYCQHDVNECDSRPCQNGGSC--QDGYGTYKCTCPHGYTGLNCQSLVRWCDSSPCKNGGSC 290          

HSP 5 Score: 55.4546 bits (132), Expect = 1.722e-7
Identity = 29/82 (35.37%), Postives = 40/82 (48.78%), Query Frame = 1
Query:  652 NKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCE--IWDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSC 891
            + C  D+ +  ++ C N  TCVSG  +P+C C  GFSG  C+  +  PC    C NGG C        + C C  N+ G  C
Sbjct:  559 SSCEYDSQSCGSLRCRNGATCVSGHLSPRCLCAPGFSGHECQTRMDSPCLVNPCYNGGTCQPISDAPFYRCSCPANFNGLLC 640          

HSP 6 Score: 53.5286 bits (127), Expect = 7.418e-7
Identity = 30/96 (31.25%), Postives = 43/96 (44.79%), Query Frame = 1
Query:  661 NLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSC-EIWDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFC 945
            ++D+C  E   C N G C    +   C C+ GF G  C E  D C    C+NGG C  ++  N + C C   + G +CE     C + +C     C
Sbjct:  123 DIDDC--EPNPCSNGGVCQDRVNGFVCVCLAGFRGERCAEDIDECVSAPCRNGGNC--TDCVNSYTCSCPAGFSGINCEINTPDCTESSCFNGGTC 214          

HSP 7 Score: 52.7582 bits (125), Expect = 1.507e-6
Identity = 38/150 (25.33%), Postives = 63/150 (42.00%), Query Frame = 1
Query:  565 SCFEEASVYKCDENGRKICLSGYV---FDPLTNKCNL---DNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSC-EIWDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFCEIVNNQPKCSVKKNSK 993
            SC+++ + + C       C SG+     D  +  C +       S  ++C + G CV   +   C C  G++G  C E  D C    C+NG  C  ++    + C C   Y+G +C K    C    C+    C  + N  KCS  + ++
Sbjct:  289 SCWQQGASFTCQ------CASGWTGIYCDVPSVSCEVAARQQGVSVAVLCRHAGQCVDAGNTHLCRCQAGYTGSYCQEQVDECQPNPCQNGATC--TDYLGGYSCECVPGYHGMNCSKEINECLSQPCQNGGTCIDLVNTYKCSCPRGTQ 430          
BLAST of Jagged-like vs. Ensembl Zebrafish
Match: jag2b (jagged canonical Notch ligand 2b [Source:ZFIN;Acc:ZDB-GENE-011128-3])

HSP 1 Score: 65.0846 bits (157), Expect = 2.203e-10
Identity = 35/85 (41.18%), Postives = 47/85 (55.29%), Query Frame = 1
Query:  694 CFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFC 945
            C N GTC+ G  + +CFC DG+ G  C I  + C++  CKNGG C+  +L NDF C C N + GK+C      C+  TC     C
Sbjct:  608 CRNGGTCIDGISSFQCFCPDGWEGDLCSINVNECSRSPCKNGGHCV--DLVNDFYCECANGWKGKTCHSRESQCDSSTCSNGGTC 690          
BLAST of Jagged-like vs. Ensembl Zebrafish
Match: jag2b (jagged canonical Notch ligand 2b [Source:ZFIN;Acc:ZDB-GENE-011128-3])

HSP 1 Score: 64.6994 bits (156), Expect = 2.241e-10
Identity = 35/85 (41.18%), Postives = 47/85 (55.29%), Query Frame = 1
Query:  694 CFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFC 945
            C N GTC+ G  + +CFC DG+ G  C I  + C++  CKNGG C+  +L NDF C C N + GK+C      C+  TC     C
Sbjct:  608 CRNGGTCIDGISSFQCFCPDGWEGDLCSINVNECSRSPCKNGGHCV--DLVNDFYCECANGWKGKTCHSRESQCDSSTCSNGGTC 690          
BLAST of Jagged-like vs. Ensembl Zebrafish
Match: jag2b (jagged canonical Notch ligand 2b [Source:ZFIN;Acc:ZDB-GENE-011128-3])

HSP 1 Score: 64.6994 bits (156), Expect = 2.547e-10
Identity = 35/85 (41.18%), Postives = 47/85 (55.29%), Query Frame = 1
Query:  694 CFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFC 945
            C N GTC+ G  + +CFC DG+ G  C I  + C++  CKNGG C+  +L NDF C C N + GK+C      C+  TC     C
Sbjct:  646 CRNGGTCIDGISSFQCFCPDGWEGDLCSINVNECSRSPCKNGGHCV--DLVNDFYCECANGWKGKTCHSRESQCDSSTCSNGGTC 728          
BLAST of Jagged-like vs. Ensembl Zebrafish
Match: jag2b (jagged canonical Notch ligand 2b [Source:ZFIN;Acc:ZDB-GENE-011128-3])

HSP 1 Score: 64.6994 bits (156), Expect = 2.569e-10
Identity = 35/85 (41.18%), Postives = 47/85 (55.29%), Query Frame = 1
Query:  694 CFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFC 945
            C N GTC+ G  + +CFC DG+ G  C I  + C++  CKNGG C+  +L NDF C C N + GK+C      C+  TC     C
Sbjct:  646 CRNGGTCIDGISSFQCFCPDGWEGDLCSINVNECSRSPCKNGGHCV--DLVNDFYCECANGWKGKTCHSRESQCDSSTCSNGGTC 728          
BLAST of Jagged-like vs. Ensembl Xenopus
Match: notch1 (notch 1 receptor [Source:NCBI gene;Acc:100037842])

HSP 1 Score: 66.6254 bits (161), Expect = 9.767e-11
Identity = 48/142 (33.80%), Postives = 71/142 (50.00%), Query Frame = 1
Query:  565 SCFEEASVYKCDENGRKICLSGYVFDPLTNKCNLDNCNSENIICFNNGTC--VSGAHNPKCFCVDGFSGPSCE-IWDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFCEIVNNQPKCSVK 981
            +C +  + YKCD      C +G+      + C+++N   E+  C N GTC  ++GA+   C C  GFSG  CE +  PC+   CKNGG+C +SE    F C C   + G++CE     C +  C     C+  N   KC+ K
Sbjct:  619 TCHDGINGYKCD------CDAGWS----GSNCDVNNNECESNPCMNGGTCKDMTGAY--ICTCRAGFSGAICEAVLAPCSGSPCKNGGRCKESEDYETFSCECPPGWQGQTCEIDMNECVNRPCRNGAMCQNTNGSYKCNCK 748          
BLAST of Jagged-like vs. Ensembl Xenopus
Match: plpp7 (phospholipid phosphatase 7 (inactive) [Source:Xenbase;Acc:XB-GENE-977766])

HSP 1 Score: 65.855 bits (159), Expect = 1.769e-10
Identity = 39/96 (40.62%), Postives = 53/96 (55.21%), Query Frame = 1
Query:  661 NLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFC 945
            N+++C S    C N GTC+ G ++ KC C DG+ G  CE   + C+K  C NGG C   +L NDF C CKN + GK+C      C++ TC     C
Sbjct:  594 NINDCESN--PCKNGGTCIDGVNSYKCICSDGWEGIYCETNINDCSKNPCYNGGTC--RDLVNDFYCECKNGWKGKTCHSRDSQCDEATCNNGGTC 685          
BLAST of Jagged-like vs. Ensembl Xenopus
Match: plpp7 (phospholipid phosphatase 7 (inactive) [Source:Xenbase;Acc:XB-GENE-977766])

HSP 1 Score: 65.4698 bits (158), Expect = 2.030e-10
Identity = 39/96 (40.62%), Postives = 53/96 (55.21%), Query Frame = 1
Query:  661 NLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFC 945
            N+++C S    C N GTC+ G ++ KC C DG+ G  CE   + C+K  C NGG C   +L NDF C CKN + GK+C      C++ TC     C
Sbjct:  632 NINDCESN--PCKNGGTCIDGVNSYKCICSDGWEGIYCETNINDCSKNPCYNGGTC--RDLVNDFYCECKNGWKGKTCHSRDSQCDEATCNNGGTC 723          
BLAST of Jagged-like vs. Ensembl Xenopus
Match: plpp7 (phospholipid phosphatase 7 (inactive) [Source:Xenbase;Acc:XB-GENE-977766])

HSP 1 Score: 65.0846 bits (157), Expect = 2.881e-10
Identity = 39/96 (40.62%), Postives = 53/96 (55.21%), Query Frame = 1
Query:  661 NLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFC 945
            N+++C S    C N GTC+ G ++ KC C DG+ G  CE   + C+K  C NGG C   +L NDF C CKN + GK+C      C++ TC     C
Sbjct:  629 NINDCESN--PCKNGGTCIDGVNSYKCICSDGWEGIYCETNINDCSKNPCYNGGTC--RDLVNDFYCECKNGWKGKTCHSRDSQCDEATCNNGGTC 720          
BLAST of Jagged-like vs. Ensembl Xenopus
Match: plpp7 (phospholipid phosphatase 7 (inactive) [Source:Xenbase;Acc:XB-GENE-977766])

HSP 1 Score: 65.0846 bits (157), Expect = 3.034e-10
Identity = 39/96 (40.62%), Postives = 53/96 (55.21%), Query Frame = 1
Query:  661 NLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFC 945
            N+++C S    C N GTC+ G ++ KC C DG+ G  CE   + C+K  C NGG C   +L NDF C CKN + GK+C      C++ TC     C
Sbjct:  629 NINDCESN--PCKNGGTCIDGVNSYKCICSDGWEGIYCETNINDCSKNPCYNGGTC--RDLVNDFYCECKNGWKGKTCHSRDSQCDEATCNNGGTC 720          
BLAST of Jagged-like vs. Ensembl Mouse
Match: Sned1 (sushi, nidogen and EGF-like domains 1 [Source:MGI Symbol;Acc:MGI:3045960])

HSP 1 Score: 64.6994 bits (156), Expect = 2.996e-10
Identity = 42/139 (30.22%), Postives = 62/139 (44.60%), Query Frame = 1
Query:  550 NRCLVSCFEEASVYKCDENGRKICLSGYVFDPLTNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCE-IWDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFC-EIVNN 960
             +C+  C      Y C       CL+G+       +C+LD     +  C N GTC  G ++  C C  GF GP+CE    PC    C+NGG+C      +  +C C+  Y G +CE     C+   C+    C ++V N
Sbjct:  282 GKCIDDCVTGNPSYTCS------CLAGFT----GRRCHLDVNECASHPCQNGGTCTHGVNSFSCQCPAGFKGPTCESAQSPCDNKVCQNGGQCQAE--SSSAVCVCQAGYTGATCETDVDECSSDPCQNGGSCVDLVGN 408          

HSP 2 Score: 57.7658 bits (138), Expect = 3.473e-8
Identity = 37/119 (31.09%), Postives = 56/119 (47.06%), Query Frame = 1
Query:  616 ICLSGYVFDPLTNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCE-----IWDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFCEIVN 957
            +C +GY     T + ++D C+S+   C N G+CV    N  C CV+ F GP CE     +  PC    C+NGG C+ ++    ++C C   + G  C +  +  ND  C     C   N
Sbjct:  374 VCQAGYTG--ATCETDVDECSSDP--CQNGGSCVDLVGNYSCICVEPFEGPQCETGSYLVPSPCLSNPCQNGGTCVDAD--EGYVCECPEGFMGLDCRE--RILNDCDCRNGGRCLGAN 484          

HSP 3 Score: 53.5286 bits (127), Expect = 8.216e-7
Identity = 33/77 (42.86%), Postives = 39/77 (50.65%), Query Frame = 1
Query:  667 DNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEIW-DPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCE 894
            D+C S    C N GTC       KC C  GFSG  CEI   PC +  C NGG C   +L  DF C+C+  Y G  C+
Sbjct:  621 DSCASGP--CHNGGTCFHYIGKYKCDCPPGFSGRHCEIAPSPCFRSPCMNGGTC--EDLGTDFSCYCQPGYTGHRCQ 693          

HSP 4 Score: 53.1434 bits (126), Expect = 1.017e-6
Identity = 33/113 (29.20%), Postives = 49/113 (43.36%), Query Frame = 1
Query:  613 KICLSGYVFDPLTNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFCE 948
            ++C    V+        +D C S+   C + G+C     + +C C  G+ G  CE+  D C    C+NGG C   +L   FIC C   + G  CE    +C    C+    CE
Sbjct:  737 RVCQPQGVWSQPPQCIEVDECRSQP--CLHGGSCQDLIADYQCLCSPGYEGVHCELETDECQAQPCRNGGSC--RDLPRAFICQCPEGFVGIHCETEVDACASSPCQHGGRCE 845          
BLAST of Jagged-like vs. Ensembl Mouse
Match: Vcan (versican [Source:MGI Symbol;Acc:MGI:102889])

HSP 1 Score: 62.7734 bits (151), Expect = 1.255e-9
Identity = 32/96 (33.33%), Postives = 46/96 (47.92%), Query Frame = 1
Query:  631 YVFDPLTNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCN 915
            Y+ +   NK   D C +    C N GTC     +  C C  G+SG  CE+ +D C    C+NG  C+     N F C C  +Y G  CE+  ++C+
Sbjct: 1298 YIIEVRENKTGPDLCKTNP--CLNGGTCYPTETSYVCTCAPGYSGDQCELDFDECHSNPCRNGATCVDG--FNTFRCLCLPSYVGALCEQDTETCD 1389          
BLAST of Jagged-like vs. Ensembl Mouse
Match: Jag1 (jagged 1 [Source:MGI Symbol;Acc:MGI:1095416])

HSP 1 Score: 62.003 bits (149), Expect = 1.653e-9
Identity = 39/97 (40.21%), Postives = 54/97 (55.67%), Query Frame = 1
Query:  661 NLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCE--IWDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFC 945
            N+++C  E+  C N GTC+ G ++ KC C DG+ G  CE  I D C++  C  GG C   +L NDF C CKN + GK+C      C++ TC     C
Sbjct:  629 NINDC--ESNPCKNGGTCIDGVNSYKCICSDGWEGAHCENNIND-CSQNPCHYGGTC--RDLVNDFYCDCKNGWKGKTCHSRDSQCDEATCNNGGTC 720          

HSP 2 Score: 57.3806 bits (137), Expect = 5.544e-8
Identity = 48/166 (28.92%), Postives = 69/166 (41.57%), Query Frame = 1
Query:  478 IHSQDFATLSVDIVIKCKPGFFPKN------RCLVSCFEEASVYKCDENGRKICLSGYVFDPLTNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFCEIV 954
            ++++    L       C PG+  +N       CL  C  +AS        R IC  GY  D      ++D C S    C N G C +  +  +C C  GFSG  C++  D C    C+NG +C      +D+ C C  +Y GK+C      C   TCE    C + 
Sbjct:  422 VNARSCKNLIASYYCDCLPGWMGQNCDININDCLGQCQNDASCRDLVNGYRCICPPGYAGDHCER--DIDECASN--PCLNGGHCQNEINRFQCLCPTGFSGNLCQLDIDYCEPNPCQNGAQCYNR--ASDYFCKCPEDYEGKNCSHLKDHCRTTTCEVIDSCTVA 581          
BLAST of Jagged-like vs. Ensembl Mouse
Match: Vcan (versican [Source:MGI Symbol;Acc:MGI:102889])

HSP 1 Score: 59.6918 bits (143), Expect = 1.109e-8
Identity = 27/75 (36.00%), Postives = 38/75 (50.67%), Query Frame = 1
Query:  694 CFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCN 915
            C N GTC     +  C C  G+SG  CE+ +D C    C+NG  C+     N F C C  +Y G  CE+  ++C+
Sbjct: 3056 CLNGGTCYPTETSYVCTCAPGYSGDQCELDFDECHSNPCRNGATCVDG--FNTFRCLCLPSYVGALCEQDTETCD 3128          
BLAST of Jagged-like vs. Ensembl Mouse
Match: Vcan (versican [Source:MGI Symbol;Acc:MGI:102889])

HSP 1 Score: 59.3066 bits (142), Expect = 1.321e-8
Identity = 27/75 (36.00%), Postives = 38/75 (50.67%), Query Frame = 1
Query:  694 CFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCN 915
            C N GTC     +  C C  G+SG  CE+ +D C    C+NG  C+     N F C C  +Y G  CE+  ++C+
Sbjct: 2096 CLNGGTCYPTETSYVCTCAPGYSGDQCELDFDECHSNPCRNGATCVDG--FNTFRCLCLPSYVGALCEQDTETCD 2168          
BLAST of Jagged-like vs. UniProt/SwissProt
Match: sp|P78504|JAG1_HUMAN (Protein jagged-1 OS=Homo sapiens OX=9606 GN=JAG1 PE=1 SV=3)

HSP 1 Score: 65.855 bits (159), Expect = 9.441e-10
Identity = 38/96 (39.58%), Postives = 54/96 (56.25%), Query Frame = 1
Query:  661 NLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFC 945
            N+++C  E+  C N GTC+ G ++ KC C DG+ G  CE   + C++  C NGG C   +L NDF C CKN + GK+C      C++ TC     C
Sbjct:  629 NINDC--ESNPCRNGGTCIDGVNSYKCICSDGWEGAYCETNINDCSQNPCHNGGTC--RDLVNDFYCDCKNGWKGKTCHSRDSQCDEATCNNGGTC 720          

HSP 2 Score: 54.6842 bits (130), Expect = 2.223e-6
Identity = 47/166 (28.31%), Postives = 68/166 (40.96%), Query Frame = 1
Query:  478 IHSQDFATLSVDIVIKCKPGFFPKN------RCLVSCFEEASVYKCDENGRKICLSGYVFDPLTNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFCEIV 954
            ++++    L       C PG+  +N       CL  C  +AS        R IC  GY  D      ++D C S    C N G C +  +  +C C  GFSG  C++  D C    C+NG +C      +D+ C C  +Y GK+C      C    CE    C + 
Sbjct:  422 VNAKSCKNLIASYYCDCLPGWMGQNCDININDCLGQCQNDASCRDLVNGYRCICPPGYAGDHCER--DIDECASN--PCLNGGHCQNEINRFQCLCPTGFSGNLCQLDIDYCEPNPCQNGAQCYNR--ASDYFCKCPEDYEGKNCSHLKDHCRTTPCEVIDSCTVA 581          
BLAST of Jagged-like vs. UniProt/SwissProt
Match: sp|Q70E20|SNED1_MOUSE (Sushi, nidogen and EGF-like domain-containing protein 1 OS=Mus musculus OX=10090 GN=Sned1 PE=2 SV=2)

HSP 1 Score: 64.6994 bits (156), Expect = 2.060e-9
Identity = 42/139 (30.22%), Postives = 62/139 (44.60%), Query Frame = 1
Query:  550 NRCLVSCFEEASVYKCDENGRKICLSGYVFDPLTNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCE-IWDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFC-EIVNN 960
             +C+  C      Y C       CL+G+       +C+LD     +  C N GTC  G ++  C C  GF GP+CE    PC    C+NGG+C      +  +C C+  Y G +CE     C+   C+    C ++V N
Sbjct:  282 GKCIDDCVTGNPSYTCS------CLAGFT----GRRCHLDVNECASHPCQNGGTCTHGVNSFSCQCPAGFKGPTCESAQSPCDNKVCQNGGQCQAE--SSSAVCVCQAGYTGATCETDVDECSSDPCQNGGSCVDLVGN 408          

HSP 2 Score: 58.151 bits (139), Expect = 2.388e-7
Identity = 37/119 (31.09%), Postives = 56/119 (47.06%), Query Frame = 1
Query:  616 ICLSGYVFDPLTNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCE-----IWDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFCEIVN 957
            +C +GY     T + ++D C+S+   C N G+CV    N  C CV+ F GP CE     +  PC    C+NGG C+ ++    ++C C   + G  C +  +  ND  C     C   N
Sbjct:  374 VCQAGYTG--ATCETDVDECSSDP--CQNGGSCVDLVGNYSCICVEPFEGPQCETGSYLVPSPCLSNPCQNGGTCVDAD--EGYVCECPEGFMGLDCRE--RILNDCDCRNGGRCLGAN 484          

HSP 3 Score: 53.5286 bits (127), Expect = 5.747e-6
Identity = 33/77 (42.86%), Postives = 39/77 (50.65%), Query Frame = 1
Query:  667 DNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEIW-DPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCE 894
            D+C S    C N GTC       KC C  GFSG  CEI   PC +  C NGG C   +L  DF C+C+  Y G  C+
Sbjct:  621 DSCASGP--CHNGGTCFHYIGKYKCDCPPGFSGRHCEIAPSPCFRSPCMNGGTC--EDLGTDFSCYCQPGYTGHRCQ 693          

HSP 4 Score: 53.1434 bits (126), Expect = 7.115e-6
Identity = 33/113 (29.20%), Postives = 49/113 (43.36%), Query Frame = 1
Query:  613 KICLSGYVFDPLTNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFCE 948
            ++C    V+        +D C S+   C + G+C     + +C C  G+ G  CE+  D C    C+NGG C   +L   FIC C   + G  CE    +C    C+    CE
Sbjct:  737 RVCQPQGVWSQPPQCIEVDECRSQP--CLHGGSCQDLIADYQCLCSPGYEGVHCELETDECQAQPCRNGGSC--RDLPRAFICQCPEGFVGIHCETEVDACASSPCQHGGRCE 845          
BLAST of Jagged-like vs. UniProt/SwissProt
Match: sp|P46531|NOTC1_HUMAN (Neurogenic locus notch homolog protein 1 OS=Homo sapiens OX=9606 GN=NOTCH1 PE=1 SV=4)

HSP 1 Score: 64.3142 bits (155), Expect = 2.529e-9
Identity = 38/123 (30.89%), Postives = 56/123 (45.53%), Query Frame = 1
Query:  625 SGYV------FDPLTNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFCEIVNNQPKC 972
            SGYV      F     + N++ C S    C N GTC+      KC C+  ++G +CE+   PC    C+NGG+C +SE    F C C   + G++CE     C    C     C+  +   +C
Sbjct:  773 SGYVCTCREGFSGPNCQTNINECASNP--CLNQGTCIDDVAGYKCNCLLPYTGATCEVVLAPCAPSPCRNGGECRQSEDYESFSCVCPTGWQGQTCEVDINECVLSPCRHGASCQNTHGGYRC 893          

HSP 2 Score: 59.3066 bits (142), Expect = 9.463e-8
Identity = 37/122 (30.33%), Postives = 55/122 (45.08%), Query Frame = 1
Query:  565 SCFEEASVYKCDENGRKICLSGYVFDPLTNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITC 927
            +C ++   ++C      IC+ GY  + +  + N D C S    C +NG C+   +  +C C  GF+G  C+   D C    CKNG KC+     N + C C   Y G  CE     C+   C
Sbjct:  466 TCLDQIGEFQC------ICMPGY--EGVHCEVNTDECASSP--CLHNGRCLDKINEFQCECPTGFTGHLCQYDVDECASTPCKNGAKCLDG--PNTYTCVCTEGYTGTHCEVDIDECDPDPC 575          

HSP 3 Score: 57.3806 bits (137), Expect = 4.038e-7
Identity = 43/152 (28.29%), Postives = 61/152 (40.13%), Query Frame = 1
Query:  565 SCFEEASVYKCDENGRKICLSGYVFDPLTNKCNLDNCN------SENIICFNNGTCVSGAHNPKCFCVDGFSGPSCE-IWDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFCEIVNNQPKCSVKKNSKSF 999
            +C +  + YKC       C  G     +  + N+D+CN      S +  CFNNGTCV       C C  GF G  CE   + C    C   G     +  NDF C C+  + G+ CE     C    C+    C + +N  +  + K    F
Sbjct: 1197 TCLDLPNTYKCS------CPRGT--QGVHCEINVDDCNPPVDPVSRSPKCFNNGTCVDQVGGYSCTCPPGFVGERCEGDVNECLSNPCDARGTQNCVQRVNDFHCECRAGHTGRRCESVINGCKGKPCKNGGTCAVASNTARGFICKCPAGF 1340          

HSP 4 Score: 55.4546 bits (132), Expect = 1.581e-6
Identity = 32/91 (35.16%), Postives = 44/91 (48.35%), Query Frame = 1
Query:  643 PLTNKCNLDNCNSENIICFNNGTC-VSGAHNPKCFCVDGFSGPSCEIWDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSC 912
            PL N C  + C        N GTC +      KC C  G+SG SC+  DPC    C NGG+C+  E    +IC C  +++G +C +    C
Sbjct:  101 PLDNACLTNPCR-------NGGTCDLLTLTEYKCRCPPGWSGKSCQQADPCASNPCANGGQCLPFEAS--YICHCPPSFHGPTCRQDVNEC 182          

HSP 5 Score: 54.6842 bits (130), Expect = 2.896e-6
Identity = 43/157 (27.39%), Postives = 65/157 (41.40%), Query Frame = 1
Query:  526 CKPGFFPK------NRCLVS-CFEEASVYKCDENGRKICLSGYVFDPLTNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCE-IWDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFCEIVNNQPKC 972
            C PGF         N C    C   A+   C ++    C +G  F  +  + N  +C   +  CFN GTCV G ++  C C  GF+G  C+   + C    C +GG C   +    + C C   Y G +C+     C+   C+    C   + Q +C
Sbjct:  933 CLPGFRGTFCEEDINECASDPCRNGANCTDCVDSYTCTCPAG--FSGIHCENNTPDCTESS--CFNGGTCVDGINSFTCLCPPGFTGSYCQHDVNECDSQPCLHGGTC--QDGCGSYRCTCPQGYTGPNCQNLVHWCDSSPCKNGGKCWQTHTQYRC 1083          

HSP 6 Score: 54.299 bits (129), Expect = 3.645e-6
Identity = 37/126 (29.37%), Postives = 57/126 (45.24%), Query Frame = 1
Query:  604 NGRKICL--SGYVFDPLTNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFCEIVNNQPKC 972
            NG+ IC   SGY     +   ++D C+     C + G C++   + +C C+ G++GP CEI  + C    C+N   C+  +   +F C C   Y G  CE     C    C  N  C    N+ +C
Sbjct:  393 NGKAICTCPSGYTGPACSQ--DVDECSLGANPCEHAGKCINTLGSFECQCLQGYTGPRCEIDVNECVSNPCQNDATCL--DQIGEFQCICMPGYEGVHCEVNTDECASSPCLHNGRCLDKINEFQC 514          

HSP 7 Score: 53.1434 bits (126), Expect = 7.850e-6
Identity = 37/134 (27.61%), Postives = 56/134 (41.79%), Query Frame = 1
Query:  550 NRCLVS-CFEEASVYKCDENGRKICLSGYVFDPLTNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSC-EIWDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFC 945
            N C++S C   AS        R  C +GY       + ++D+C      C N G+C  G +   C C+ GF G  C E  + C    C+NG  C  ++  + + C C   + G  CE     C + +C     C
Sbjct:  871 NECVLSPCRHGASCQNTHGGYRCHCQAGY--SGRNCETDIDDCRPNP--CHNGGSCTDGINTAFCDCLPGFRGTFCEEDINECASDPCRNGANC--TDCVDSYTCTCPAGFSGIHCENNTPDCTESSCFNGGTC 998          
BLAST of Jagged-like vs. UniProt/SwissProt
Match: sp|A0A1F4|EYS_DROME (Protein eyes shut OS=Drosophila melanogaster OX=7227 GN=eys PE=1 SV=1)

HSP 1 Score: 64.3142 bits (155), Expect = 2.969e-9
Identity = 44/129 (34.11%), Postives = 55/129 (42.64%), Query Frame = 1
Query:  565 SCFEEASVYKCDENGRKICLSGYVFDPLTN---KCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSC-EIWDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQ 939
            +C     V+    +G     S Y  D  T    + N D C S    C N GTCV G     C C +GFSG +C E  D C    C+NGG C   +  N +IC C+  Y G  CE     C   T  + Q
Sbjct:  147 ACLSNPCVFGVCIDGLNSSYSCYCIDGYTGIQCQTNWDECWSSP--CQNGGTCVDGVAYYNCTCPEGFSGSNCEENVDECMSNPCQNGGLC--RDRTNGYICTCQPGYLGSHCELDVAVCETGTGARCQ 271          

HSP 2 Score: 60.077 bits (144), Expect = 6.553e-8
Identity = 29/102 (28.43%), Postives = 47/102 (46.08%), Query Frame = 1
Query:  694 CFNN----GTCVSGAHNP-KCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFCEIVNNQPKCSVK 981
            C +N    G C+ G ++   C+C+DG++G  C+  WD C    C+NGG C+       + C C   + G +CE+    C    C+    C    N   C+ +
Sbjct:  148 CLSNPCVFGVCIDGLNSSYSCYCIDGYTGIQCQTNWDECWSSPCQNGGTCVDGVAY--YNCTCPEGFSGSNCEENVDECMSNPCQNGGLCRDRTNGYICTCQ 247          
BLAST of Jagged-like vs. UniProt/SwissProt
Match: sp|Q8TER0|SNED1_HUMAN (Sushi, nidogen and EGF-like domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SNED1 PE=2 SV=2)

HSP 1 Score: 63.1586 bits (152), Expect = 6.023e-9
Identity = 43/140 (30.71%), Postives = 65/140 (46.43%), Query Frame = 1
Query:  550 NRCLVSCFEEASVYKCDENGRKICLSGYVFDPLTNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCE-IWDPCTKPRCKNGGKCIKSELKND-FICFCKNNYYGKSCEKTGKSCNDITCEKNQFC-EIVNN 960
             +C+  C      Y C       CLSG+       +C+LD     +  C N GTC  G ++ +C C  GF GP+CE    PC    C++GG+C   +++N   +C C+  Y G +CE     C+   C     C ++V N
Sbjct:  282 GKCIDDCVTGNPSYTCS------CLSGFT----GRRCHLDVNECASQPCQNGGTCTHGINSFRCQCPAGFGGPTCETAQSPCDTKECQHGGQC---QVENGSAVCVCQAGYTGAACEMDVDDCSPDPCLNGGSCVDLVGN 408          

HSP 2 Score: 52.7582 bits (125), Expect = 8.896e-6
Identity = 33/124 (26.61%), Postives = 54/124 (43.55%), Query Frame = 1
Query:  601 ENGRKICLSGYVFDPLTNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCE-----IWDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFCEIVN 957
            ENG  +C+    +     + ++D+C+ +   C N G+CV    N  C C + F G  CE     + D C    C NGG C+ ++    ++C C   + G  C +  +  +D  C     C   N
Sbjct:  367 ENGSAVCVCQAGYTGAACEMDVDDCSPDP--CLNGGSCVDLVGNYTCLCAEPFKGLRCETGDHPVPDACLSAPCHNGGTCVDAD--QGYVCECPEGFMGLDCRE--RVPDDCECRNGGRCLGAN 484          
BLAST of Jagged-like vs. TrEMBL
Match: A0A1Z1R174 (Jagged-like (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1077 bits (2784), Expect = 0.000e+0
Identity = 525/529 (99.24%), Postives = 528/529 (99.81%), Query Frame = 1
Query:   94 FLRTFILLSINFLNNISAIKRAPGTLTLKIQTPAYVEDCVEKYCKYVLKSCVGSGRSENERCLWSPLTVNSNYFHKMPKYLAEISFEVDNVKDPFYFNANLSYFQNEILVKTENFKNIIIQNLYGATQIHSQDFATLSVDIVIKCKPGFFPKNRCLVSCFEEASVYKCDENGRKICLSGYVFDPLTNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEIWDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFCEIVNNQPKCSVKKNSKSFIQKTFVTPPSIKSTTITKPKFVSLNVETKKPIVESIPVSKGTNRLLQSHSLLNEYTTTAIVIVLVVFMIGCFGVTFWVLKIKYFQKKSKTYSNFSTLPVMPSIYNASTYRSSEENFRRWHSLDDNSFYLCNQGHVEPYHTYRSGSNVYPKHEQGIETCRDGYGSLNSSHRMCHSIMRTRMPVLCEPSTVNSSDLNFKYTNDSQNNSEKVDDYNNNYLVIDNPPTSDL 1680
            FLRTFILLSINFLNNISAIKRAPGTLTLKIQTPAYVEDCVEKYCKYVLKSCVGSGRSENERCLWSPLTVNSNYFHKMPKYLAEISFEVDNVKDPFYFNANLSYFQNEILVKTENFKNIIIQNLYGA+QIHSQDFATLSVDIVIKCKPGFFPKNRCLVSCFEEASVYKCDENGRKICLSGYVFDPLTNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEIWDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGK+CEKTGKSCNDITCEKNQFCEIVNNQPKCSVKKNSKSFIQKTFVTPPSIKSTTITKPKFVSLNVETKKPIVESIPV+KGTNRLLQSHSLLNEYTTTAIVIVLVVFMIGCFGVTFWVLKIKYFQKKSKTYSNFSTLPVMPSIYNASTYRSSEENFRRWHSLDDNSFYLCNQGHVEPYHTYRSGSNVYPKHEQGIETCRDGYGSLNSSHRMCHSIMRTRMPVLCEPSTVNS DLNFKYTNDSQNNSEKVDDYNNNYLVIDNPPTSDL
Sbjct:    1 FLRTFILLSINFLNNISAIKRAPGTLTLKIQTPAYVEDCVEKYCKYVLKSCVGSGRSENERCLWSPLTVNSNYFHKMPKYLAEISFEVDNVKDPFYFNANLSYFQNEILVKTENFKNIIIQNLYGASQIHSQDFATLSVDIVIKCKPGFFPKNRCLVSCFEEASVYKCDENGRKICLSGYVFDPLTNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEIWDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKNCEKTGKSCNDITCEKNQFCEIVNNQPKCSVKKNSKSFIQKTFVTPPSIKSTTITKPKFVSLNVETKKPIVESIPVNKGTNRLLQSHSLLNEYTTTAIVIVLVVFMIGCFGVTFWVLKIKYFQKKSKTYSNFSTLPVMPSIYNASTYRSSEENFRRWHSLDDNSFYLCNQGHVEPYHTYRSGSNVYPKHEQGIETCRDGYGSLNSSHRMCHSIMRTRMPVLCEPSTVNSGDLNFKYTNDSQNNSEKVDDYNNNYLVIDNPPTSDL 529          
BLAST of Jagged-like vs. TrEMBL
Match: A0A3M7TAC8 (Neurogenic locus notch 2-like protein OS=Brachionus plicatilis OX=10195 GN=BpHYR1_024136 PE=4 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 1.057e-10
Identity = 47/119 (39.50%), Postives = 63/119 (52.94%), Query Frame = 1
Query:  625 SGYVFDPLTNKCNLDNCNSENIICFNNGTCVSGAHNPK--CFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFCEIVNNQPKC 972
            S ++   L NK NLD C  E   C N+G CV         C C+  F+G +CEI  +PC+  +C N G C+  + +  F C C    YGK CEK    C++ TC KN  CE  N++PKC
Sbjct:  238 SDHLIHVLENKYNLDGCLKE---CSNHGDCVYDKFKDSYICQCLPSFAGQACEINLEPCSSLQCLNNGTCVSFKNRT-FFCICSPISYGKRCEKLVDVCHNQTCSKNGICEPFNHKPKC 352          
BLAST of Jagged-like vs. TrEMBL
Match: A0A2T7PQL3 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_02684 PE=4 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 2.500e-10
Identity = 67/247 (27.13%), Postives = 109/247 (44.13%), Query Frame = 1
Query:  466 GATQIHSQDFATLSVDIVIKCKPGFFPKNRCLVSCFEEASVYKCD-ENGRKICLSGYVFDPLTNKCN---------LDNCNSENIICFNNGTCVSGAHNP-KCFCVDGFSGPSCEIWDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFCEIVNNQPK----CSVKKNSKSFIQKTFVTPPSIKSTTITKPKF-VSLNVETKKPIVESIPVSKGTNRLLQSHSLLN 1158
            G TQ+     A+L + + I C   +F  N CL  C    S Y+CD   GR++CL G   +P   + N         L++C S N  C N G C   A +   C C  G+SG  CE  + C+   C NGGKC ++    D+ C C   + G +C+     C+   C+    C   ++  +     +   +++S+     +   ++ S T+  P   VS  +    P V+ +  ++    LLQ   LL+
Sbjct:  161 GITQLRGIPSASLRIQVKIYCATNYF-GNLCLTFCRPVPSRYRCDVSTGRRVCL-GLWLEPDCEEGNDAGPYLCAALNDCRSMNYGCLNGGLCQGTASSAFACRCPTGYSGARCEN-NVCSPSPCYNGGKC-RAVNATDWTCDCLPGFTGSTCD-VASPCDSSPCQNGGRCYQTSSGGEYRWTPTRGTDARSWHPVLRLLAVTVVSVTLGVPPLSVSAQLAGAAPRVKPVTFAR-PQSLLQWRCLLS 401          
BLAST of Jagged-like vs. TrEMBL
Match: A0A2E6VMX4 (Uncharacterized protein OS=Myxococcales bacterium OX=2026763 GN=CMH56_00945 PE=4 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 4.572e-10
Identity = 49/159 (30.82%), Postives = 69/159 (43.40%), Query Frame = 1
Query:  517 VIKCKPGFFPKNRCLVSCFEEASVYKCDENGRKI--------------CLSGYVFDPLTNKC-NLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFC 945
            V +C+PGF           E   + +CDEN                  C  GYV +     C N+++C S    C N GTC  G     C C++G+SG +CE   D CT   C+NGG C+     ND+ C C   + G++CE     C    C+ +  C
Sbjct:  155 VCECRPGFSGD-----GVDECTDINECDENNGNCSHTCTNTSGGFVCSCDDGYVLNDDGFNCDNINDCASNP--CENGGTCNDGIGGYTCQCLEGYSGDNCETNIDDCTGAPCQNGGTCVDG--VNDYSCTCATGFEGENCETNSDDCTPNPCQNDGTC 304          

HSP 2 Score: 61.2326 bits (147), Expect = 7.929e-6
Identity = 34/99 (34.34%), Postives = 46/99 (46.46%), Query Frame = 1
Query:  619 CLSGYVFDPLTNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSC 912
            CL GY  D    + N+D+C      C N GTCV G ++  C C  GF G +CE   D CT   C+N G C+     + + C C   + G  C +    C
Sbjct:  239 CLEGYSGD--NCETNIDDCTGAP--CQNGGTCVDGVNDYSCTCATGFEGENCETNSDDCTPNPCQNDGTCVDG--VDAYTCNCTTGFKGADCSEDIDEC 331          
BLAST of Jagged-like vs. TrEMBL
Match: A0A2E4F7E3 (Uncharacterized protein OS=Deltaproteobacteria bacterium OX=2026735 GN=CL940_00115 PE=4 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 5.566e-10
Identity = 50/160 (31.25%), Postives = 72/160 (45.00%), Query Frame = 1
Query:  511 DIVIKCKPGFFPKN--RCLVSCFEEASVY--KC-DENGRKICLSGYVFDPLTNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFCEIVNNQPKC 972
            D +  C PGF  K     +  C +E  +   +C D     +C+    F   T + ++D+C  +   C N G C    ++ +C C++GF G +CEI  D C    C NGG C  ++  NDF+C C   + GKSCE     C D  C     C    N   C
Sbjct:  129 DFICACPPGFAGKTCETHMDECADEPCLNGGECKDAVNDFVCVCPPGFAGKTCELDIDDCADKP--CLNGGVCTDAVNDFECACLEGFEGETCEINIDDCADAPCLNGGVC--ADAANDFVCVCPAGFSGKSCEINVDDCADAPCLNGGVCTDAANDFVC 284          

HSP 2 Score: 68.1662 bits (165), Expect = 5.956e-8
Identity = 35/90 (38.89%), Postives = 47/90 (52.22%), Query Frame = 1
Query:  661 NLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITC 927
            N+D+C   ++ C N G C  G +   C CV GF G +CEI  D CT   C NGG C  ++  +DF C C   + GK+CE     C+   C
Sbjct: 1071 NIDDC--ADVPCLNGGACTDGLNAFTCECVTGFEGATCEINIDDCTPDPCVNGGSC--TDAVDDFACVCPEGFGGKTCEINADDCSPDPC 1156          

HSP 3 Score: 66.6254 bits (161), Expect = 1.766e-7
Identity = 35/107 (32.71%), Postives = 48/107 (44.86%), Query Frame = 1
Query:  658 CNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFCEIVNNQPKCS 975
            C  D  +  +  C N G C    ++  C C  GF+G +CE   D C    C NGG+C   +  NDF+C C   + GK+CE     C D  C     C    N  +C+
Sbjct:  105 CETDTDDCASAPCLNGGACTDAVNDFICACPPGFAGKTCETHMDECADEPCLNGGEC--KDAVNDFVCVCPPGFAGKTCELDIDDCADKPCLNGGVCTDAVNDFECA 209          

HSP 4 Score: 64.3142 bits (155), Expect = 9.209e-7
Identity = 40/127 (31.50%), Postives = 58/127 (45.67%), Query Frame = 1
Query:  568 CFEEASVYKCDENGRKICLSGYVFDPLTNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFC 945
            C ++ + ++C       C +G+  D L  + N+D+C  +   CFN   C+ G  +  C C  GF G  CEI  D C    C NGG C  ++  N F C C++ Y G  CE     C    C+    C
Sbjct: 1161 CIDQVAGFECS------CDAGW--DGLLCQNNIDDCAGQP--CFNGAVCLDGIDSFSCSCWPGFEGSLCEIDIDECAAAPCLNGGVC--TDQVNGFSCSCQDGYEGDLCETDTDGCTPNPCQNGGTC 1275          

HSP 5 Score: 61.2326 bits (147), Expect = 7.872e-6
Identity = 42/130 (32.31%), Postives = 60/130 (46.15%), Query Frame = 1
Query:  547 KNRCL--VSCFEEASVYKCDENGRKICLSGYVFDPLTNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITC 927
            +N CL    C ++   + CD      CL G  F+    + N+D+C   N  C N G+C  G     C C+ GF G +C I  + C    C+NGG C  ++  N+F C C   + GK CE     C+   C
Sbjct:  662 ENPCLNGSECLDDVGEFFCD------CLGG--FEGQLCEINIDDC--ANQPCLNGGSCTDGIDEFICECLPGFEGYNCSIDINECIPDPCENGGNC--ADGVNEFACECPPGFGGKLCEINADDCSPDPC 779          

HSP 6 Score: 61.2326 bits (147), Expect = 8.007e-6
Identity = 45/158 (28.48%), Postives = 68/158 (43.04%), Query Frame = 1
Query:  511 DIVIKCKPGFFPKNRCLV--SCFEEASVYKCDENGRKICLSGYVFDPLTNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFCEIVNNQPKCS 975
            D V+       P   CL   SC +E + + C      +C +G  FD    + ++D C   +  CFN+  C    +   C C  GF+G +C +  D C+   C NGG C  ++  N F C C   + G++C+     C D  C     CE      KC+
Sbjct:  414 DCVVPSDESEGPLTSCLNGGSCVDEVNGFSC------VCPAG--FDGAFCENDIDEC--ADTPCFNDSVCTDEVNGFSCECSPGFAGATCSVNIDDCSPNPCYNGGVC--ADEVNGFTCDCVVGFEGQTCQSNIDDCADEPCLNGGVCEDAFIDFKCT 559          
BLAST of Jagged-like vs. Ensembl Cavefish
Match: JAG1 (protein jagged-1a [Source:NCBI gene;Acc:103036342])

HSP 1 Score: 65.4698 bits (158), Expect = 1.175e-10
Identity = 39/105 (37.14%), Postives = 56/105 (53.33%), Query Frame = 1
Query:  661 NLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFCEIVNNQPKC 972
            N+++C  E+  C N GTC+   +  +C C DG+ GP+CE   D C+   C++ G C   +L NDF C CKN + GK+C      C++ TC     C    N  KC
Sbjct:  575 NINDC--ESSPCGNGGTCIDKVNVYQCICADGWEGPNCETNIDDCSTNPCRDRGVC--RDLVNDFYCECKNGWKGKTCHSRESQCDEATCNNGGTCSDEGNSFKC 675          

HSP 2 Score: 52.7582 bits (125), Expect = 1.017e-6
Identity = 30/85 (35.29%), Postives = 44/85 (51.76%), Query Frame = 1
Query:  694 CFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFC 945
            CFN G+CV  +   +C C  G++GPSC I  D C+   C + G C+  +L N F C C + + GK+C      C++  C     C
Sbjct:  349 CFNGGSCVESSQGFECRCSPGWTGPSCTINEDDCSPNPCNHAGTCV--DLINGFRCLCPSQWSGKTCLIDANECDENPCVNAHSC 431          
BLAST of Jagged-like vs. Ensembl Cavefish
Match: JAG1 (protein jagged-1a [Source:NCBI gene;Acc:103036342])

HSP 1 Score: 65.0846 bits (157), Expect = 1.488e-10
Identity = 39/105 (37.14%), Postives = 56/105 (53.33%), Query Frame = 1
Query:  661 NLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFCEIVNNQPKC 972
            N+++C  E+  C N GTC+   +  +C C DG+ GP+CE   D C+   C++ G C   +L NDF C CKN + GK+C      C++ TC     C    N  KC
Sbjct:  633 NINDC--ESSPCGNGGTCIDKVNVYQCICADGWEGPNCETNIDDCSTNPCRDRGVC--RDLVNDFYCECKNGWKGKTCHSRESQCDEATCNNGGTCSDEGNSFKC 733          

HSP 2 Score: 53.5286 bits (127), Expect = 5.548e-7
Identity = 52/182 (28.57%), Postives = 78/182 (42.86%), Query Frame = 1
Query:  523 KCKPGFFPKN----------RCL--VSCFEEASVYKCDENGRKICLSGYVFDPLTNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFC--EIVNNQPKCSVKKNSKSFIQKTFVTP 1023
            +C PG+  +N          +CL   SC +  + YKC      +C  G+  +      ++D C S    C N G C    +  +C C+ GFSG  C++  D C    C+NG +C    L ND+ C C ++Y GK+C      C    C+    C   +V+N    SV+     FI      P
Sbjct:  441 ECLPGWTGQNCDINVNDCQGQCLNGGSCKDLVNGYKC------VCAPGFAGEHCER--DIDECASH--PCLNRGRCQDDVNGFQCLCLPGFSGNLCQLDIDYCVGNPCQNGAQCFN--LANDYYCKCPDDYEGKNCSHLKDHCRTTPCQVIDSCTVAVVSNSSAGSVR-----FISSNVCGP 605          

HSP 3 Score: 52.7582 bits (125), Expect = 1.208e-6
Identity = 30/85 (35.29%), Postives = 44/85 (51.76%), Query Frame = 1
Query:  694 CFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFC 945
            CFN G+CV  +   +C C  G++GPSC I  D C+   C + G C+  +L N F C C + + GK+C      C++  C     C
Sbjct:  349 CFNGGSCVESSQGFECRCSPGWTGPSCTINEDDCSPNPCNHAGTCV--DLINGFRCLCPSQWSGKTCLIDANECDENPCVNAHSC 431          
BLAST of Jagged-like vs. Ensembl Cavefish
Match: ENSAMXT00000039261.1 (neurocan core protein-like [Source:NCBI gene;Acc:103030700])

HSP 1 Score: 62.3882 bits (150), Expect = 1.137e-9
Identity = 31/75 (41.33%), Postives = 41/75 (54.67%), Query Frame = 1
Query:  694 CFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCN 915
            C + GTC+      +CFC  G++G SCEI  D C    C+NGG CI  +  + FIC C  +Y G  CEK  + C 
Sbjct:  912 CLHGGTCLPDGEGFRCFCPQGYTGESCEIDVDDCLSNPCENGGTCI--DKVDSFICLCLPSYSGDMCEKDTEGCE 984          
BLAST of Jagged-like vs. Ensembl Cavefish
Match: ENSAMXT00000042001.1 (neurocan core protein-like [Source:NCBI gene;Acc:103030700])

HSP 1 Score: 62.3882 bits (150), Expect = 1.156e-9
Identity = 31/74 (41.89%), Postives = 41/74 (55.41%), Query Frame = 1
Query:  694 CFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSC 912
            C + GTC+      +CFC  G++G SCEI  D C    C+NGG CI  +  + FIC C  +Y G  CEK  + C
Sbjct:  998 CLHGGTCLPDGEGFRCFCPQGYTGESCEIDVDDCLSNPCENGGTCI--DKVDSFICLCLPSYSGDMCEKDTEGC 1069          
BLAST of Jagged-like vs. Ensembl Cavefish
Match: jag2b (protein jagged-2 [Source:NCBI gene;Acc:103029720])

HSP 1 Score: 62.3882 bits (150), Expect = 1.161e-9
Identity = 36/96 (37.50%), Postives = 54/96 (56.25%), Query Frame = 1
Query:  661 NLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFC 945
            N+++C S    C N GTC+ G ++ +CFC DG+ G  C +  + C++  CKNGG+C+  +  NDF C C N + GK+C      C+  TC     C
Sbjct:  597 NVNDCVSS--PCRNGGTCIDGINSFQCFCPDGWEGDLCGLNVNECSRNPCKNGGRCV--DQVNDFYCECANGWKGKTCHSRESQCDASTCSNGGTC 688          
BLAST of Jagged-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000962.1 (pep scaffold:Pmarinus_7.0:GL477031:38805:53470:-1 gene:ENSPMAG00000000874.1 transcript:ENSPMAT00000000962.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.9214 bits (141), Expect = 2.196e-9
Identity = 32/85 (37.65%), Postives = 48/85 (56.47%), Query Frame = 1
Query:  694 CFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFC 945
            C N GTC+ G  + +C C +G+ G  CEI  + C+   C+N G+C   +L NDF C C+N + GK+C    + C++ TC     C
Sbjct:  399 CKNGGTCIDGVKSYQCICHEGWEGDVCEIDTNDCSPNLCQNRGRC--RDLVNDFYCECRNGWKGKTCHSRERQCDEATCNNGATC 481          
BLAST of Jagged-like vs. Ensembl Sea Lamprey
Match: JAG1 (jagged canonical Notch ligand 1 [Source:HGNC Symbol;Acc:HGNC:6188])

HSP 1 Score: 58.9214 bits (141), Expect = 2.555e-9
Identity = 46/136 (33.82%), Postives = 65/136 (47.79%), Query Frame = 1
Query:  595 CDENGRKICLSGYVFDPLTNK------CNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCE-IWDPCTKPR-CKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFCEIVNNQPKCSV 978
            C  NGR +  +G  F  + N       C+ +  +     C N GTC+ G ++ +C C DG+ G  CE   D C+    C NGG C   +L NDF C CKN + GK+C      C++ TC     C  V +  +CS 
Sbjct:  465 CGPNGRCLSQAGGNFTCMCNSGFRGSFCHENVNDCAEGACHNGGTCLDGINSFQCMCPDGWDGEFCENDVDDCSNHNPCLNGGTC--HDLVNDFSCECKNGWKGKTCHSKISHCDEATCNNGGECFDVGDTFRCSC 598          
BLAST of Jagged-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004043.1 (pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 gene:ENSPMAG00000003698.1 transcript:ENSPMAT00000004043.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.9214 bits (141), Expect = 2.895e-9
Identity = 38/127 (29.92%), Postives = 55/127 (43.31%), Query Frame = 1
Query:  601 ENGRKICLSGYVFDPLTNKC-----------NLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFC 945
            E+   I +S  V +P    C           ++D C S    C + G+C +      C C+ GFSG +CE   D C +  C+NGG C  ++    F C C   + GK C+ T  +C    C  N  C
Sbjct: 1500 ESASVILVSHEVLEPAVCTCTAGYAGTWCEADMDECLSTP--CRHGGSCQNLPGGFACRCLPGFSGTACETDVDECLEGPCQNGGLCHNTQ--GGFACDCSAGFSGKICDVTVDNCASSPCYNNGSC 1622          
BLAST of Jagged-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004042.1 (pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 gene:ENSPMAG00000003698.1 transcript:ENSPMAT00000004042.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.9214 bits (141), Expect = 2.922e-9
Identity = 38/127 (29.92%), Postives = 55/127 (43.31%), Query Frame = 1
Query:  601 ENGRKICLSGYVFDPLTNKC-----------NLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFC 945
            E+   I +S  V +P    C           ++D C S    C + G+C +      C C+ GFSG +CE   D C +  C+NGG C  ++    F C C   + GK C+ T  +C    C  N  C
Sbjct: 1500 ESASVILVSHEVLEPAVCTCTAGYAGTWCEADMDECLSTP--CRHGGSCQNLPGGFACRCLPGFSGTACETDVDECLEGPCQNGGLCHNTQ--GGFACDCSAGFSGKICDVTVDNCASSPCYNNGSC 1622          
BLAST of Jagged-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001302.1 (pep scaffold:Pmarinus_7.0:GL479305:38781:187025:1 gene:ENSPMAG00000001162.1 transcript:ENSPMAT00000001302.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.3806 bits (137), Expect = 8.020e-9
Identity = 37/132 (28.03%), Postives = 54/132 (40.91%), Query Frame = 1
Query:  517 VIKCKPGFFPKNRCLVSCFEEASVYKCDENGRKICLSGYVFDPLTNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEIWDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSC 912
            +  C  GF P +    SC    S +     GR +C SG+       +C++      N  C  +G+C++G     C C  G++G SCE    C  P C   G C+         C C + + G SCE     C
Sbjct:  150 ICHCNQGFLPPHCSRASCPVLCSGHGQYVRGRCLCHSGWK----GAECDIPAWQCTNPACGGHGSCITGV----CVCNSGYTGESCE-EVMCPHPTCSGKGVCVHG------TCICLSGWGGPSCETRKPMC 266          

HSP 2 Score: 55.0694 bits (131), Expect = 5.195e-8
Identity = 38/122 (31.15%), Postives = 52/122 (42.62%), Query Frame = 1
Query:  595 CDENGRKICLSGYVF---DPLTNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEI--WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFC 945
            C  NG  +CL+G        L   C+  +C    ++C  +G  V G    +C C  G+ G  C+I  W  CT P C   G CI        +C C + Y G+SCE+    C   TC     C
Sbjct:  140 CHGNG--VCLAGICHCNQGFLPPHCSRASCP---VLCSGHGQYVRG----RCLCHSGWKGAECDIPAWQ-CTNPACGGHGSCITG------VCVCNSGYTGESCEEV--MCPHPTCSGKGVC 243          
BLAST of Jagged-like vs. Ensembl Nematostella
Match: EDO31542 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXN5])

HSP 1 Score: 59.3066 bits (142), Expect = 6.818e-11
Identity = 42/110 (38.18%), Postives = 53/110 (48.18%), Query Frame = 1
Query:  568 CFEEASVYKCDENGRKICLSGYVFDPLTNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCE 894
            C EE   YKC+      C  G  FD    +  +D C +    C N+GTC+ G  N  C C  GF GP+CEI  D C    C NGG C+     N ++C C   Y G +CE
Sbjct:   12 CKEEVGSYKCE------CALG--FDGTNCEQGVDECAAS--PCLNDGTCIDGPGNYSCICSTGFLGPTCEINVDDCASEPCLNGGACVDG--ANSYLCSCTAGYTGINCE 109          
BLAST of Jagged-like vs. Ensembl Nematostella
Match: EDO41767 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3G3])

HSP 1 Score: 60.8474 bits (146), Expect = 1.590e-9
Identity = 34/95 (35.79%), Postives = 44/95 (46.32%), Query Frame = 1
Query:  694 CFNNGTCVSGAHNP-KCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFCEIVNNQPKC 972
            C N G+C++G H+   C C  G SG +CE+   PC    C   G C      +DF C C N+  GK CE  G  CN + C     CE  +    C
Sbjct: 3960 CRNGGSCLAGQHDDFICDCPKGVSGKTCEVDSRPCASNPCFFNGNCTNK--GSDFECKCPNDLSGKRCEH-GFHCNRLPCMNGGSCETRDGAAVC 4051          

HSP 2 Score: 50.8322 bits (120), Expect = 1.552e-6
Identity = 27/106 (25.47%), Postives = 41/106 (38.68%), Query Frame = 1
Query:  658 CNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEIWDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFCEIVNNQPKCS 975
            C +D+    +  CF NG C +   + +C C +  SG  CE    C +  C NGG C   +     +C C   + G  C      C    C  +  C       +C+
Sbjct: 3987 CEVDSRPCASNPCFFNGNCTNKGSDFECKCPNDLSGKRCEHGFHCNRLPCMNGGSCETRD--GAAVCLCPRGFTGLDCSVDVDECQSNPCLNDGACVNTRGSFRCN 4090          
BLAST of Jagged-like vs. Ensembl Nematostella
Match: EDO34151 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQ46])

HSP 1 Score: 58.5362 bits (140), Expect = 5.251e-9
Identity = 42/127 (33.07%), Postives = 58/127 (45.67%), Query Frame = 1
Query:  598 DENGRKICLSGYVFDPLTNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFCEIVNNQPKCS 975
            +++G   C     F+    + N+D C S    C NN  CV G    +C C  GFSG  C+   D C+   C+NGG CI +E    + C C   Y GK+CE   + C    C+    C    N  +CS
Sbjct:  281 EQSGGAHCSCPLGFEGAFCELNVDECASN--PCQNNAVCVGGVDKFQCICRPGFSGTLCQFNDDDCSAKPCRNGGSCIDNE--RFYTCACPAGYTGKNCETEVQECQSEPCQHGGTCTKRFNGYECS 403          
BLAST of Jagged-like vs. Ensembl Nematostella
Match: EDO41508 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S431])

HSP 1 Score: 55.4546 bits (132), Expect = 3.449e-8
Identity = 42/119 (35.29%), Postives = 56/119 (47.06%), Query Frame = 1
Query:  601 ENG-RKICLSGYVFDPLTNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFCEI 951
            ENG   +CL GY       +C +D  +     C N G C+   ++ +C C+ GF G +CE   D C    C NG  CI     ND+ C C   YY K+CE    +C D TCE    C +
Sbjct:  248 ENGFECVCLPGYT----GKRCGIDIDDCTPSPCINGGRCIDQVNDYECQCLPGFVGDNCETNVDDCADNPCLNGATCIDG--VNDYYCVCAIGYYSKNCEHKTSTCTDCTCENGGTCGV 360          
BLAST of Jagged-like vs. Ensembl Nematostella
Match: EDO28379 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6M6])

HSP 1 Score: 54.6842 bits (130), Expect = 3.802e-8
Identity = 32/93 (34.41%), Postives = 48/93 (51.61%), Query Frame = 1
Query:  685 NIICFNNGTCVSGAHNPKCFCVDGFSGPSCEIWDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFCEIVNNQ 963
            ++ C N G+CV      KC C  GF G  CE  D C    CKNGG C +S+ ++ F+C CK  + G+ CE   + C+   C+    C+ + + 
Sbjct:  103 SMPCLNGGSCVEIPGAFKCGCPFGFLGTVCEERDACHPNPCKNGGTCTRSDTESGFVCVCKEGFTGEHCEGFNR-CDPNPCKNGATCQQIKDD 194          
BLAST of Jagged-like vs. Ensembl Medaka
Match: jag1b (jagged canonical Notch ligand 1 [Source:NCBI gene;Acc:101168394])

HSP 1 Score: 63.1586 bits (152), Expect = 5.837e-10
Identity = 37/96 (38.54%), Postives = 49/96 (51.04%), Query Frame = 1
Query:  661 NLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFC 945
            N+++C S    C N GTC+      +C C DG+ G  CEI  D C+   C NGG C   +L  DF C CKN + GK+C      C++ TC     C
Sbjct:  566 NINDCESN--PCHNGGTCIDKVSVYQCICADGWEGEHCEINIDDCSTSPCHNGGTC--RDLVTDFFCECKNGWKGKTCHSRESQCDEATCNNGGTC 657          
BLAST of Jagged-like vs. Ensembl Medaka
Match: jag1b (jagged canonical Notch ligand 1 [Source:NCBI gene;Acc:101168394])

HSP 1 Score: 63.1586 bits (152), Expect = 6.957e-10
Identity = 37/96 (38.54%), Postives = 50/96 (52.08%), Query Frame = 1
Query:  661 NLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFC 945
            N+++C  E+  C N GTC+      +C C DG+ G  CEI  D C+   C NGG C   +L  DF C CKN + GK+C      C++ TC     C
Sbjct:  624 NINDC--ESNPCHNGGTCIDKVSVYQCICADGWEGEHCEINIDDCSTSPCHNGGTC--RDLVTDFFCECKNGWKGKTCHSRESQCDEATCNNGGTC 715          

HSP 2 Score: 49.6766 bits (117), Expect = 8.924e-6
Identity = 41/151 (27.15%), Postives = 65/151 (43.05%), Query Frame = 1
Query:  523 KCKPGFFPKN------RCLVSCFEEASVYKCDENGRKICLSGYVFDPLTNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFCEIV 954
            +C PG+  +N       C   C    +        R +C  G+  + L  + ++D C S    C N G C    +  +C C+ GFSG  C++  D C++  C+NG  C      ND++C C  +Y G++C      C   TC     C + 
Sbjct:  432 ECLPGWMGQNCDININDCKDQCQNGGTCKDLVNGYRCLCPPGFTGE-LCER-DVDECASS--PCLNGGRCQDEVNGFQCLCLTGFSGNLCQLDIDYCSQNPCQNGAPCFNR--ANDYVCACPEDYEGRNCSHLKDHCRTTTCTVIDSCTVA 576          
BLAST of Jagged-like vs. Ensembl Medaka
Match: jag1b (jagged canonical Notch ligand 1 [Source:NCBI gene;Acc:101168394])

HSP 1 Score: 62.7734 bits (151), Expect = 8.262e-10
Identity = 37/96 (38.54%), Postives = 50/96 (52.08%), Query Frame = 1
Query:  661 NLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFC 945
            N+++C  E+  C N GTC+      +C C DG+ G  CEI  D C+   C NGG C   +L  DF C CKN + GK+C      C++ TC     C
Sbjct:  598 NINDC--ESNPCHNGGTCIDKVSVYQCICADGWEGEHCEINIDDCSTSPCHNGGTC--RDLVTDFFCECKNGWKGKTCHSRESQCDEATCNNGGTC 689          
BLAST of Jagged-like vs. Ensembl Medaka
Match: ncanb (neurocan [Source:NCBI gene;Acc:101163561])

HSP 1 Score: 62.3882 bits (150), Expect = 1.025e-9
Identity = 38/113 (33.63%), Postives = 57/113 (50.44%), Query Frame = 1
Query:  577 EASVYKCDENGRKICLSGYVFDPLTNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSC 912
            EA   K   N   I +  + F  + +   ++N   +N  C + G+C+    +  C+C  GFSG +CEI  D C    C+NGG CI  +  N F+C C  +Y G +CEK  + C
Sbjct:  984 EAEANKDPNNPFGILVPSWAFSLIPS---VENNPCQNNPCLHGGSCLQEGDSYSCYCPQGFSGENCEIDIDDCQSNPCQNGGTCI--DEINSFVCLCLPSYSGATCEKDTEGC 1091          
BLAST of Jagged-like vs. Ensembl Medaka
Match: ENSORLT00000040656.1 (protein jagged-1a [Source:NCBI gene;Acc:101169088])

HSP 1 Score: 62.003 bits (149), Expect = 1.294e-9
Identity = 37/105 (35.24%), Postives = 53/105 (50.48%), Query Frame = 1
Query:  661 NLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFCEIVNNQPKC 972
            N+++C  E   C N GTC+      +C C  G+ GP+CE   D C+   C+N G C   +L NDF C C + + GK+C      C+D+TC     C    +  KC
Sbjct:  630 NINDC--EIAPCLNGGTCIDEVSRYRCICPKGWEGPTCENNIDDCSSAPCQNRGVC--QDLTNDFYCKCGDGWKGKTCSSRESQCDDVTCNNGGTCYDEGDAFKC 730          

HSP 2 Score: 52.373 bits (124), Expect = 1.550e-6
Identity = 34/99 (34.34%), Postives = 50/99 (50.51%), Query Frame = 1
Query:  661 NLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFCEIV 954
            +LD+C S    C N G+C    ++  C C  GFSG  C++  D C    C NGG+C  S   +D+IC C  +Y GK+C +    C   +C+    C + 
Sbjct:  488 DLDDCASG--PCLNGGSCHDRVNDFHCLCPPGFSGRRCQLDIDFCLDSPCLNGGQCFNS--VDDYICECPEDYEGKNCSRLRDHCLTASCKVIDSCTVA 582          
BLAST of Jagged-like vs. Planmine SMEST
Match: SMESG000005484.1 (SMESG000005484.1)

HSP 1 Score: 1091.26 bits (2821), Expect = 0.000e+0
Identity = 532/535 (99.44%), Postives = 533/535 (99.63%), Query Frame = 1
Query:   76 MNLFNNFLRTFILLSINFLNNISAIKRAPGTLTLKIQTPAYVEDCVEKYCKYVLKSCVGSGRSENERCLWSPLTVNSNYFHKMPKYLAEISFEVDNVKDPFYFNANLSYFQNEILVKTENFKNIIIQNLYGATQIHSQDFATLSVDIVIKCKPGFFPKNRCLVSCFEEASVYKCDENGRKICLSGYVFDPLTNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEIWDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFCEIVNNQPKCSVKKNSKSFIQKTFVTPPSIKSTTITKPKFVSLNVETKKPIVESIPVSKGTNRLLQSHSLLNEYTTTAIVIVLVVFMIGCFGVTFWVLKIKYFQKKSKTYSNFSTLPVMPSIYNASTYRSSEENFRRWHSLDDNSFYLCNQGHVEPYHTYRSGSNVYPKHEQGIETCRDGYGSLNSSHRMCHSIMRTRMPVLCEPSTVNSSDLNFKYTNDSQNNSEKVDDYNNNYLVIDNPPTSDL 1680
            MNLFNNFLRTFILLSINFLNNISAIKRAPGTLTLKIQTPAYVEDCVEKYCKYVLKSCVGSGRSENERCLWSPLTVNSNYFHKMPKYLAEISFEVDNVKDPFYFNANLSYFQNEILVKTENFKNIIIQNLYGATQIHSQDFATLSVDIVIKCKPGFFPKNRCLVSCFEEASVYKCDENGRKICLSGYVFDPLTNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEIWDPC KPRCKNGGKCIKSELKNDFICFCKNNYYGK+CEKTGKSCNDITCEKNQFCEIVNNQPKCSVKKNSKSFIQKTFVTPPSIKSTTITKPK VSLNVETKKPIVESIPVSKGTNRLLQSHSLLNEYTTTAIVIVLVVFMIGCFGVTFWVLKIKYFQKKSKTYSNFSTLPVMPSIYNASTYRSSEENFRRWHSLDDNSFYLCNQGHVEPYHTYRSGSNVYPKHEQGIETCRDGYGSLNSSHRMCHSIMRTRMPVLCEPSTVNSSDLNFKYTNDSQNNSEKVDDYNNNYLVIDNPPTSDL
Sbjct:    1 MNLFNNFLRTFILLSINFLNNISAIKRAPGTLTLKIQTPAYVEDCVEKYCKYVLKSCVGSGRSENERCLWSPLTVNSNYFHKMPKYLAEISFEVDNVKDPFYFNANLSYFQNEILVKTENFKNIIIQNLYGATQIHSQDFATLSVDIVIKCKPGFFPKNRCLVSCFEEASVYKCDENGRKICLSGYVFDPLTNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEIWDPCAKPRCKNGGKCIKSELKNDFICFCKNNYYGKNCEKTGKSCNDITCEKNQFCEIVNNQPKCSVKKNSKSFIQKTFVTPPSIKSTTITKPKLVSLNVETKKPIVESIPVSKGTNRLLQSHSLLNEYTTTAIVIVLVVFMIGCFGVTFWVLKIKYFQKKSKTYSNFSTLPVMPSIYNASTYRSSEENFRRWHSLDDNSFYLCNQGHVEPYHTYRSGSNVYPKHEQGIETCRDGYGSLNSSHRMCHSIMRTRMPVLCEPSTVNSSDLNFKYTNDSQNNSEKVDDYNNNYLVIDNPPTSDL 535          
BLAST of Jagged-like vs. Planmine SMEST
Match: SMESG000025147.1 (SMESG000025147.1)

HSP 1 Score: 112.079 bits (279), Expect = 5.520e-26
Identity = 112/421 (26.60%), Postives = 182/421 (43.23%), Query Frame = 1
Query:  151 KRAPGTLTLKIQTPAYVEDCVEKYCKYVLKSCVGSGRSENERCLWSPLTVNSNY-FHKMPKYLAEISFEVDNVKDPFYFNANLSYFQNEILV--KTENFKNIIIQNLYGATQIHSQDFATLSVDIVIKCKPGFFPKNRCLVSCFEEASVYKCDENGRKICLSGYVFDPLTNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEIWDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCE-KTGKSCNDITCEKNQFCEIVNNQPKCSVKKNSKSFIQKTFVTPPSIKSTTITKPKFVSLNVETKKPIVESIPVSKGTNRLLQSHSLLNEYTTTAIVIVLVVFMIGCFGVTFWVLKIKYFQKKSKTYSNFSTLPVMPSIYNASTYRSS-----EENFRRWHSLDDNSFYL 1386
            +++P  + L+     + +    +  K+ L  C+       E+C W   T N N   H+      +  F ++N+      +  L    + I    KT N K I  ++ +    I  ++F  ++V+   +C+ G++P  +C   CF   + Y CD  G KIC  G  FD   NKC  +NC + +I C+NNG CV+     +C C++ +SG  CE  +PC    C+N GKC      N + C C+  + G  C+ K  ++C    C +N  C              S+S +     +  SI       P         + P+ E  P+ K  N+  Q+ +  N  +TT IV       IGCF V   +    Y  ++++ YS  S +    S    S + +      E  F+R  SL+DNS YL
Sbjct:   34 QQSPAKVNLRFLISKFSQLLTSEPVKFSL--CIDKNH---EKCFW---TTNKNVELHEELFQEVQFEFYINNMDTNLSISIKLENGGSTINFSHKTINLKKISSKDTFELHSITLENFVKVTVEH--ECENGYYPAKQCNKFCFPSENEYTCDGFGNKICKEGLYFDADENKCLPNNCIASSIQCYNNGFCVNKGSTFECKCMESYSGKFCEFANPCFPNPCQNMGKCFIKPNGNAYFCNCRTGFAGDKCDFKVVQTC---KCPENMRCNY------------SESGV---LFSCTSINDDNRENP---------ENPLYEK-PIKKSENK--QNQNWNNVSSTTTIVAA-----IGCFMVLISIGVSVYVCQRTRNYS--SLIKSRTSEGTQSNFLNQYPPKFESTFKRSFSLEDNSAYL 407          
BLAST of Jagged-like vs. Planmine SMEST
Match: SMESG000059836.1 (SMESG000059836.1)

HSP 1 Score: 89.7373 bits (221), Expect = 6.616e-19
Identity = 70/258 (27.13%), Postives = 115/258 (44.57%), Query Frame = 1
Query:  106 FILLSINFLNNISAIKRAPGTLTLKIQTP----AYVEDCVEKYCKYVLKSCVGSGRSENERCLWSPLTVNSNYFHKMPKYLAE--ISFEVDNVKDPFYFNANLSYFQNEILVKTENF----------KNIIIQNL-YGATQIHSQDFATLSVDIVIKCKPGFFPKNRCLVSCFEEASVYKCDENGRKICLSGYVFDPLTNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKC 825
            F+ +++   +   A  +APGT+T+ I+       Y +D V       L S V + +   E      L   ++    +     E  I F+V N+ +   +N  +   QN    +T  F          K+ ++ N+ Y     +S+++  L V   +KCK  F+P+  C V C +  ++ KCD NG KIC  G+ F+  T  C+ D C     IC N+G CV+     +C C   +SG  C+I  + C +  C N   C
Sbjct:    6 FVFVALGISSVGFARFQAPGTITMNIKYHPDIYLYGDDNV------TLDSTVNTTKMRRE------LYKKADRMKLLSDGALELTIKFDVYNISEHIDYNGLMKIMQNGRKTETYEFRLISFKFSTKKSFLLNNMRYVTATAYSKEYKELEVMTSVKCKQNFYPEFNCSVLCVKTQTIEKCDSNGNKICRKGFYFNDYTQTCDTDWCTQSKPICVNDGHCVNRRKESECVCGPLYSGKYCQIPLNLCQQHNCPNKTYC 251          
BLAST of Jagged-like vs. Planmine SMEST
Match: SMESG000063217.1 (SMESG000063217.1)

HSP 1 Score: 60.4622 bits (145), Expect = 3.361e-9
Identity = 52/156 (33.33%), Postives = 70/156 (44.87%), Query Frame = 1
Query:  619 CLSGYVFDPLTNKCNLDNCNS-ENIICFNNGTCVSGAHNPKCFCVDGFSGPSCE--IWDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEK-------------------------------TGKSCNDIT-------CEKNQFCEIVNNQ 963
            C  GY  D  +N  ++D C S E  +C N GTC++   + +C C  GF+G  CE  I D CT   CKNGG C+  +    + C C NNY+G +CE                                TGK+C+D+        C+ N FCE VN Q
Sbjct:  161 CNKGYTGDTCSN--DIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVD-CTNDTCKNGGTCL--DKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVKNPCKINPCKNNGFCESVNYQ 311          

HSP 2 Score: 58.5362 bits (140), Expect = 1.618e-8
Identity = 37/96 (38.54%), Postives = 49/96 (51.04%), Query Frame = 1
Query:  664 LDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFCE 948
            +DNC  + I CFN G+C++     KC C+ GF G +CEI  + C    C+N  KCI  +L ND+ C C     GK+CE     C    C     CE
Sbjct:  330 IDNC--QKISCFNGGSCINMIEGGKCNCLPGFEGNNCEINVNECENKPCQNNAKCI--DLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCE 421          

HSP 3 Score: 55.8398 bits (133), Expect = 8.546e-8
Identity = 44/135 (32.59%), Postives = 61/135 (45.19%), Query Frame = 1
Query:  562 VSCFEEASVYKCDENGRKICLSGYVFDPLTNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDIT-CEKNQFCEIVNN 960
            +SCF   S     E G+  CL G+      N C ++    EN  C NN  C+   ++  C C +G +G +CEI  D CT   C NG +C   +    F C C   + G  CE     C  +T C+  + C  VNN
Sbjct:  336 ISCFNGGSCINMIEGGKCNCLPGFE----GNNCEINVNECENKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARC--EDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNN 464          

HSP 4 Score: 51.9878 bits (123), Expect = 1.354e-6
Identity = 38/109 (34.86%), Postives = 54/109 (49.54%), Query Frame = 1
Query:  604 NGRKICLSGYVFDPLTNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEIW-DPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITC 927
            NG  IC     ++    +  L+NC   N  C N  TC + A   +C CV GF+G  CEI  + C    C N  KCI  +  ND+ C C++ + GK+CE     C + +C
Sbjct:  678 NGSFICKCSSQYEGRQCEKPLNNC--RNDPCRNGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCI--DHINDYQCICQSGFSGKNCEINDNDCTESSC 782          

HSP 5 Score: 50.447 bits (119), Expect = 4.032e-6
Identity = 33/89 (37.08%), Postives = 46/89 (51.69%), Query Frame = 1
Query:  682 ENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEI-WDPCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFC 945
            +NI+C N G CV   +  KC C+ GF G +CEI  + C    C++G +C   +L ND++C C   + GK CE     C    C  N  C
Sbjct:  488 KNIVCVN-GQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQC--QDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQC 573          

HSP 6 Score: 50.447 bits (119), Expect = 4.543e-6
Identity = 33/107 (30.84%), Postives = 55/107 (51.40%), Query Frame = 1
Query:  610 RKICLSGYVFDPLTNKCNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEIWD-PCTKPRCKNGGKCIKSELKNDFICFCKNNYYGKSCEKTGKSCNDITC 927
            R  C++G+  +    +C ++    ++  C N+  C+   ++ +C C  GFSG +CEI D  CT+  C   G+C+  +  N F C C  NY G +CE   + C+   C
Sbjct:  720 RCRCVAGFTGE----RCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCV--DKVNGFECKCNENYIGTNCEHLKRPCDSNPC 820          
BLAST of Jagged-like vs. Planmine SMEST
Match: SMESG000025423.1 (SMESG000025423.1)

HSP 1 Score: 58.151 bits (139), Expect = 1.059e-8
Identity = 67/276 (24.28%), Postives = 98/276 (35.51%), Query Frame = 1
Query:  526 CKPGFFPKNRCLVSCFEEASVYKCDEN-GRKICLSGYVFDPLTNK--CNLDNCNSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEIWD-PCTKPRCKNGGKCI-----KSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFCEIVNNQPKCSVKKNSKSFIQKTFVTPPSIKSTTITKPKFVSLNVETKKPIVESIPVSKGTNRLLQSHSLLNEYTTTAIVIVLVVFMIGCFGVTFWVLKIKYFQKKSKTYSNFSTLPVMPSIYNASTY 1326
            CKP F  K             Y CD+N G+K CL G+     T +  C LDN       C  + +C        C C D   G  C+    PC    C NGG C+      +E+    +C C  N+ G++C+     C +  C+ +  C  V     C    N                             V  +KP V S+   KG +      S    +    I+++LV  M  C      +L + Y++ +SK   + S   V   I N   Y
Sbjct:  189 CKPSFSMK----------TGFYACDKNSGQKYCLIGWTGTNCTQRDMCVLDN------PCHGSASCSMNESVVNCICPDSLEGQYCQTSKRPCGSSPCLNGGLCVLHPIDSNEVSRKTVCVCPRNFTGETCQHDFNECKNSPCKNDANCVNVFGSYDCICLNN--------------------------HWGVNCEKPPVFSV---KGIDPAYFIKSSTARFMQNTIIVLLVTVM--CLIFIIGLLSLLYYRNRSKIIRSPSAGSVYSEIQNDEKY 417          
The following BLAST results are available for this feature:
BLAST of Jagged-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
JAG11.966e-1039.58jagged canonical Notch ligand 1 [Source:HGNC Symbo... [more]
VCAN4.921e-1034.38versican [Source:HGNC Symbol;Acc:HGNC:2464][more]
VCAN5.077e-1034.38versican [Source:HGNC Symbol;Acc:HGNC:2464][more]
NOTCH15.267e-1030.89notch receptor 1 [Source:HGNC Symbol;Acc:HGNC:7881... [more]
SNED18.265e-1030.71sushi, nidogen and EGF like domains 1 [Source:HGNC... [more]
back to top
BLAST of Jagged-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdh-41.740e-938.46Cadherin-4 [Source:UniProtKB/TrEMBL;Acc:A0A1C3NSI... [more]
clec-781.170e-832.10C-type LECtin [Source:UniProtKB/TrEMBL;Acc:Q20531... [more]
ZC116.31.328e-732.28Probable cubilin [Source:UniProtKB/Swiss-Prot;Acc... [more]
slt-11.514e-731.48Slit homolog 1 protein [Source:UniProtKB/Swiss-Pr... [more]
crb-11.522e-733.93Drosophila CRumBs homolog [Source:UniProtKB/TrEMB... [more]
back to top
BLAST of Jagged-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eys2.962e-1034.11gene:FBgn0031414 transcript:FBtr0344662[more]
eys2.962e-1034.11gene:FBgn0031414 transcript:FBtr0344663[more]
wry8.320e-935.71gene:FBgn0051665 transcript:FBtr0089786[more]
wry8.387e-935.71gene:FBgn0051665 transcript:FBtr0304911[more]
wry8.461e-935.71gene:FBgn0051665 transcript:FBtr0334823[more]
back to top
BLAST of Jagged-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
notch1a3.516e-1128.93notch receptor 1a [Source:NCBI gene;Acc:30718][more]
jag2b2.203e-1041.18jagged canonical Notch ligand 2b [Source:ZFIN;Acc:... [more]
jag2b2.241e-1041.18jagged canonical Notch ligand 2b [Source:ZFIN;Acc:... [more]
jag2b2.547e-1041.18jagged canonical Notch ligand 2b [Source:ZFIN;Acc:... [more]
jag2b2.569e-1041.18jagged canonical Notch ligand 2b [Source:ZFIN;Acc:... [more]
back to top
BLAST of Jagged-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
notch19.767e-1133.80notch 1 receptor [Source:NCBI gene;Acc:100037842][more]
plpp71.769e-1040.63phospholipid phosphatase 7 (inactive) [Source:Xenb... [more]
plpp72.030e-1040.63phospholipid phosphatase 7 (inactive) [Source:Xenb... [more]
plpp72.881e-1040.63phospholipid phosphatase 7 (inactive) [Source:Xenb... [more]
plpp73.034e-1040.63phospholipid phosphatase 7 (inactive) [Source:Xenb... [more]
back to top
BLAST of Jagged-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sned12.996e-1030.22sushi, nidogen and EGF-like domains 1 [Source:MGI ... [more]
Vcan1.255e-933.33versican [Source:MGI Symbol;Acc:MGI:102889][more]
Jag11.653e-940.21jagged 1 [Source:MGI Symbol;Acc:MGI:1095416][more]
Vcan1.109e-836.00versican [Source:MGI Symbol;Acc:MGI:102889][more]
Vcan1.321e-836.00versican [Source:MGI Symbol;Acc:MGI:102889][more]
back to top
BLAST of Jagged-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P78504|JAG1_HUMAN9.441e-1039.58Protein jagged-1 OS=Homo sapiens OX=9606 GN=JAG1 P... [more]
sp|Q70E20|SNED1_MOUSE2.060e-930.22Sushi, nidogen and EGF-like domain-containing prot... [more]
sp|P46531|NOTC1_HUMAN2.529e-930.89Neurogenic locus notch homolog protein 1 OS=Homo s... [more]
sp|A0A1F4|EYS_DROME2.969e-934.11Protein eyes shut OS=Drosophila melanogaster OX=72... [more]
sp|Q8TER0|SNED1_HUMAN6.023e-930.71Sushi, nidogen and EGF-like domain-containing prot... [more]
back to top
BLAST of Jagged-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1Z1R1740.000e+099.24Jagged-like (Fragment) OS=Schmidtea mediterranea O... [more]
A0A3M7TAC81.057e-1039.50Neurogenic locus notch 2-like protein OS=Brachionu... [more]
A0A2T7PQL32.500e-1027.13Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A2E6VMX44.572e-1030.82Uncharacterized protein OS=Myxococcales bacterium ... [more]
A0A2E4F7E35.566e-1031.25Uncharacterized protein OS=Deltaproteobacteria bac... [more]
back to top
BLAST of Jagged-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
JAG11.175e-1037.14protein jagged-1a [Source:NCBI gene;Acc:103036342][more]
JAG11.488e-1037.14protein jagged-1a [Source:NCBI gene;Acc:103036342][more]
ENSAMXT00000039261.11.137e-941.33neurocan core protein-like [Source:NCBI gene;Acc:1... [more]
ENSAMXT00000042001.11.156e-941.89neurocan core protein-like [Source:NCBI gene;Acc:1... [more]
jag2b1.161e-937.50protein jagged-2 [Source:NCBI gene;Acc:103029720][more]
back to top
BLAST of Jagged-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000962.12.196e-937.65pep scaffold:Pmarinus_7.0:GL477031:38805:53470:-1 ... [more]
JAG12.555e-933.82jagged canonical Notch ligand 1 [Source:HGNC Symbo... [more]
ENSPMAT00000004043.12.895e-929.92pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 g... [more]
ENSPMAT00000004042.12.922e-929.92pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 g... [more]
ENSPMAT00000001302.18.020e-928.03pep scaffold:Pmarinus_7.0:GL479305:38781:187025:1 ... [more]
back to top
BLAST of Jagged-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Jagged-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO315426.818e-1138.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO417671.590e-935.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO341515.251e-933.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO415083.449e-835.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO283793.802e-834.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Jagged-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
jag1b5.837e-1038.54jagged canonical Notch ligand 1 [Source:NCBI gene;... [more]
jag1b6.957e-1038.54jagged canonical Notch ligand 1 [Source:NCBI gene;... [more]
jag1b8.262e-1038.54jagged canonical Notch ligand 1 [Source:NCBI gene;... [more]
ncanb1.025e-933.63neurocan [Source:NCBI gene;Acc:101163561][more]
ENSORLT00000040656.11.294e-935.24protein jagged-1a [Source:NCBI gene;Acc:101169088][more]
back to top
BLAST of Jagged-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000005484.10.000e+099.44SMESG000005484.1[more]
SMESG000025147.15.520e-2626.60SMESG000025147.1[more]
SMESG000059836.16.616e-1927.13SMESG000059836.1[more]
SMESG000063217.13.361e-933.33SMESG000063217.1[more]
SMESG000025423.11.059e-824.28SMESG000025423.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031788 ID=SMED30031788|Name=Jagged-like|organism=Schmidtea mediterranea sexual|type=transcript|length=1779bp
CTCTTCCGATCTTGATTTCATTGGCCGATGTCAAATTGAAATATATTCGA
TTCATTTTATCGCTTTGTAGAAATCATGAATTTGTTCAATAATTTCTTGC
GGACTTTTATTTTGTTATCAATCAACTTTCTCAATAATATTTCCGCTATC
AAGAGAGCTCCTGGAACCTTGACGTTGAAAATTCAAACTCCGGCTTATGT
TGAGGACTGTGTTGAAAAATATTGTAAATATGTACTGAAAAGTTGTGTTG
GATCAGGACGAAGCGAAAATGAAAGATGCCTCTGGTCACCATTAACTGTG
AACTCGAATTACTTTCACAAAATGCCAAAATATTTAGCAGAAATATCATT
TGAAGTTGATAATGTGAAAGATCCCTTCTATTTCAATGCTAATCTCTCGT
ACTTTCAAAATGAAATTTTGGTAAAAACTGAGAATTTTAAAAATATTATT
ATTCAAAACTTATATGGAGCTACTCAGATTCATTCTCAGGATTTTGCAAC
ACTTTCAGTTGATATTGTTATTAAATGCAAACCAGGATTTTTTCCCAAAA
ACAGATGTTTAGTATCATGCTTTGAAGAAGCTTCAGTTTATAAGTGCGAT
GAAAATGGTAGAAAAATCTGCTTATCCGGATACGTTTTCGATCCTTTGAC
AAATAAATGTAATCTTGATAATTGTAATTCGGAAAATATTATCTGTTTCA
ACAATGGAACTTGTGTAAGTGGAGCCCATAATCCCAAATGCTTTTGCGTT
GATGGATTTTCAGGTCCTAGTTGCGAAATCTGGGATCCATGTACAAAACC
TCGGTGTAAAAATGGTGGAAAATGCATAAAATCTGAATTGAAAAACGATT
TTATATGTTTTTGCAAAAACAATTATTATGGTAAAAGCTGTGAAAAAACT
GGAAAATCGTGTAATGATATAACTTGTGAAAAAAACCAGTTCTGTGAAAT
TGTCAACAATCAACCTAAATGCTCCGTGAAAAAAAATTCAAAGAGTTTTA
TACAAAAAACTTTTGTTACTCCTCCATCTATTAAATCAACTACCATAACA
AAACCGAAATTTGTTTCGTTGAATGTAGAAACAAAAAAACCGATAGTCGA
AAGCATTCCAGTTAGTAAAGGAACAAACAGACTTTTACAATCTCATTCTC
TTTTAAATGAATATACAACAACCGCTATCGTCATAGTTCTTGTCGTTTTC
ATGATCGGATGCTTCGGAGTTACCTTTTGGGTTTTAAAGATAAAATATTT
TCAGAAAAAAAGTAAAACTTATTCGAATTTCTCAACACTTCCTGTTATGC
CATCAATTTATAATGCCTCTACTTACAGAAGCAGTGAAGAAAACTTCAGA
AGATGGCATAGCCTTGATGACAACTCATTTTATTTATGTAATCAGGGTCA
CGTGGAACCGTACCATACCTATAGATCTGGCTCGAATGTATATCCGAAGC
ACGAACAGGGAATCGAAACTTGTCGTGATGGATATGGATCTTTAAATAGT
TCACATAGAATGTGCCATTCTATTATGAGAACAAGAATGCCGGTTCTTTG
TGAACCTAGCACTGTCAATTCGAGTGACTTAAATTTCAAGTATACCAATG
ATTCTCAGAACAATTCCGAAAAAGTTGACGATTATAACAATAATTATCTG
GTTATAGATAACCCACCAACAAGTGACCTTTAGGTTAAAGCTGATATCCG
TCCACGCCTGTAAAAATTCATGTCAAGAAAATTTAAATTTGCTCTGTAAT
AAAATTCGTAATTTTTTGACTTAAACGCA
back to top

protein sequence of SMED30031788-orf-1

>SMED30031788-orf-1 ID=SMED30031788-orf-1|Name=SMED30031788-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=536bp
MNLFNNFLRTFILLSINFLNNISAIKRAPGTLTLKIQTPAYVEDCVEKYC
KYVLKSCVGSGRSENERCLWSPLTVNSNYFHKMPKYLAEISFEVDNVKDP
FYFNANLSYFQNEILVKTENFKNIIIQNLYGATQIHSQDFATLSVDIVIK
CKPGFFPKNRCLVSCFEEASVYKCDENGRKICLSGYVFDPLTNKCNLDNC
NSENIICFNNGTCVSGAHNPKCFCVDGFSGPSCEIWDPCTKPRCKNGGKC
IKSELKNDFICFCKNNYYGKSCEKTGKSCNDITCEKNQFCEIVNNQPKCS
VKKNSKSFIQKTFVTPPSIKSTTITKPKFVSLNVETKKPIVESIPVSKGT
NRLLQSHSLLNEYTTTAIVIVLVVFMIGCFGVTFWVLKIKYFQKKSKTYS
NFSTLPVMPSIYNASTYRSSEENFRRWHSLDDNSFYLCNQGHVEPYHTYR
SGSNVYPKHEQGIETCRDGYGSLNSSHRMCHSIMRTRMPVLCEPSTVNSS
DLNFKYTNDSQNNSEKVDDYNNNYLVIDNPPTSDL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0003116parenchymal cell
PLANA:0007528glial cell
Vocabulary: INTERPRO
TermDefinition
IPR001881EGF-like_Ca-bd_dom
IPR000742EGF-like_dom
IPR013032EGF-like_CS
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
GO:0005515protein binding
GO:0004872receptor activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0001525angiogenesis
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0007219Notch signaling pathway
GO:0007275multicellular organism development
GO:0030154cell differentiation
GO:0050793regulation of developmental process
GO:0060271cilium morphogenesis
GO:0061314Notch signaling involved in heart development
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005886plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000742EGF-like domainSMARTSM00181egf_5coord: 238..273
e-value: 1.6E-5
score: 34.3
coord: 199..234
e-value: 0.0022
score: 27.2
IPR000742EGF-like domainPFAMPF00008EGFcoord: 239..271
e-value: 1.4E-5
score: 25.3
coord: 200..231
e-value: 1.3E-5
score: 25.4
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 196..234
score: 17.003
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 235..273
score: 18.697
IPR001881EGF-like calcium-binding domainSMARTSM00179egfca_6coord: 196..234
e-value: 0.026
score: 14.5
coord: 237..273
e-value: 0.46
score: 4.5
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 238..275
e-value: 1.9E-8
score: 36.2
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 206..237
e-value: 2.4E-6
score: 29.2
NoneNo IPR availablePANTHERPTHR24033FAMILY NOT NAMEDcoord: 149..293
NoneNo IPR availablePANTHERPTHR24033:SF175SUSHI, NIDOGEN AND EGF LIKE DOMAINS 1coord: 149..293
NoneNo IPR availablePRODOMPD936484coord: 173..280
e-value: 0.007
score: 97.0
NoneNo IPR availableCDDcd00054EGF_CAcoord: 237..273
e-value: 7.2875E-4
score: 35.305
NoneNo IPR availableCDDcd00054EGF_CAcoord: 196..234
e-value: 1.40752E-4
score: 37.231
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..24
score: 0.546
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 196..236
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 236..275
NoneNo IPR availableTMHMMTMhelixcoord: 365..387
IPR013032EGF-like, conserved sitePROSITEPS01186EGF_2coord: 222..233
IPR013032EGF-like, conserved sitePROSITEPS00022EGF_1coord: 261..272
IPR013032EGF-like, conserved sitePROSITEPS00022EGF_1coord: 222..233