Hemicentin-1

Overview
NameHemicentin-1
Smed IDSMED30031784
Length (bp)1587
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Hemicentin-1 (SMED30031784) t-SNE clustered cells

Violin plots show distribution of expression levels for Hemicentin-1 (SMED30031784) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Hemicentin-1 (SMED30031784) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Hemicentin-1 (SMED30031784) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031784

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30031784SMESG000035109.1 Contig2486GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30031784SMESG000024603.1 Contig2486GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
protonephridiaSMED30031784SMESG000024603.1 dd_Smed_v4_2783_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30031784SMESG000024603.1 dd_Smed_v4_2783_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30031784SMESG000024603.1 dd_Smed_v4_2783_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Hemicentin-1 vs. Ensembl Human
Match: HMCN1 (hemicentin 1 [Source:HGNC Symbol;Acc:HGNC:19194])

HSP 1 Score: 132.494 bits (332), Expect = 9.104e-32
Identity = 74/190 (38.95%), Postives = 98/190 (51.58%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPV 963
            PV G W +W  W  CS +C       G  TR RLCN+PPP  GG  C G  T+   C    C  PIHG W+ W+ WSACS +C        + R+R C++PVP+ GG KC+G  + S FC+  P CP  G W  W   G C     ++C  G  R  R C+ P P+  G+ C G   +++ C   + CPV
Sbjct: 4641 PVHGAWSAWQPWGTCSESCGK-----GTQTRARLCNNPPPAFGGSYCDGAETQMQVCNERNC--PIHGKWATWASWSACSVSC----GGGARQRTRGCSDPVPQYGGRKCEGSDVQSDFCNSDP-CPTHGNWSPWSGWGTC----SRTCNGGQMRRYRTCDNPPPSNGGRACGGPDSQIQRCNTDM-CPV 4813          

HSP 2 Score: 130.954 bits (328), Expect = 3.024e-31
Identity = 69/182 (37.91%), Postives = 93/182 (51.10%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDC 939
            P+ G W +W +WS CS++C       G   R R C+ P PQ GG+ C G   ++D C + PCP   HGNWS WS W  CS+TC   Q      R R C+NP P +GG  C G     + C+    CP+DG WG W+    C +    SC  G +  +R C+ P P   G+PC G   ++  C
Sbjct: 4698 PIHGKWATWASWSACSVSCGG-----GARQRTRGCSDPVPQYGGRKCEGSDVQSDFCNSDPCPT--HGNWSPWSGWGTCSRTCNGGQMR----RYRTCDNPPPSNGGRACGGPDSQIQRCN-TDMCPVDGSWGSWHSWSQCSA----SCGGGEKTRKRLCDHPVPVKGGRPCPGDTTQVTRC 4863          

HSP 3 Score: 130.183 bits (326), Expect = 5.558e-31
Identity = 71/181 (39.23%), Postives = 93/181 (51.38%), Query Frame = 1
Query:  397 VDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDC 939
            V G +  W+ W  CS+TC       G+  R RLCN P P  GGK C G   E  NC N PCPV   G+WSEWS W  C+++C        Q R+R CNNP  + GG  C+G ++    C+  P CP+ G W  W   G C     +SC  G+Q   R CN P P   G  C+G + +++ C
Sbjct: 4528 VHGGFSQWSAWRACSVTCGK-----GIQKRSRLCNQPLPANGGKPCQGSDLEMRNCQNKPCPV--DGSWSEWSLWEECTRSCGRGN----QTRTRTCNNPSVQHGGRPCEGNAVEIIMCNIRP-CPVHGAWSAWQPWGTC----SESCGKGTQTRARLCNNPPPAFGGSYCDGAETQMQVC 4692          

HSP 4 Score: 122.865 bits (307), Expect = 1.296e-28
Identity = 69/174 (39.66%), Postives = 86/174 (49.43%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEG 915
            PVDG W  W+ W +C+ +C       G  TR R CN+P  Q GG+ C G   E   C   PCPV  HG WS W  W  CS++C        Q R+RLCNNP P  GG  CDG     + C+    CPI G+W  W     C      SC  G+++  R C+ P P   G+ CEG
Sbjct: 4584 PVDGSWSEWSLWEECTRSCGR-----GNQTRTRTCNNPSVQHGGRPCEGNAVEIIMCNIRPCPV--HGAWSAWQPWGTCSESC----GKGTQTRARLCNNPPPAFGGSYCDGAETQMQVCNER-NCPIHGKWATWASWSACSV----SCGGGARQRTRGCSDPVPQYGGRKCEG 4741          

HSP 5 Score: 100.523 bits (249), Expect = 2.271e-21
Identity = 52/114 (45.61%), Postives = 63/114 (55.26%), Query Frame = 1
Query:  574 PCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEG 915
            P  V +HG +S+WS W ACS TC       +Q RSRLCN P+P +GG  C G  L  R C   P CP+DG W EW +   C     +SC  G+Q   R CN PS    G+PCEG
Sbjct: 4523 PVIVQVHGGFSQWSAWRACSVTC----GKGIQKRSRLCNQPLPANGGKPCQGSDLEMRNCQNKP-CPVDGSWSEWSLWEEC----TRSCGRGNQTRTRTCNNPSVQHGGRPCEG 4627          

HSP 6 Score: 88.1965 bits (217), Expect = 1.825e-17
Identity = 49/139 (35.25%), Postives = 67/139 (48.20%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAG 810
            P  G W  W+ W  CS TC+      G M R+R C++PPP  GG+ C G  ++   C    CPV   G+W  W  WS CS +C        + R RLC++PVP  GG  C G++     C+ +  CP   Q     + G
Sbjct: 4755 PTHGNWSPWSGWGTCSRTCNG-----GQMRRYRTCDNPPPSNGGRACGGPDSQIQRCNTDMCPV--DGSWGSWHSWSQCSASC----GGGEKTRKRLCDHPVPVKGGRPCPGDTTQVTRCN-VQACPGGPQRARGSVIG 4881          

HSP 7 Score: 63.5438 bits (153), Expect = 9.784e-10
Identity = 27/53 (50.94%), Postives = 35/53 (66.04%), Query Frame = 1
Query: 1300 VDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            VDG WS WS W +C+  C +  G +TR R CNNPS + GG+PC GN+ E + C
Sbjct: 4585 VDGSWSEWSLWEECTRSCGR--GNQTRTRTCNNPSVQHGGRPCEGNAVEIIMC 4635          

HSP 8 Score: 56.6102 bits (135), Expect = 1.225e-7
Identity = 25/53 (47.17%), Postives = 32/53 (60.38%), Query Frame = 1
Query: 1300 VDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            VDG W SW  WS CSA C    G +TR R C++P P  GG+PC G++ +   C
Sbjct: 4813 VDGSWGSWHSWSQCSASCG--GGEKTRKRLCDHPVPVKGGRPCPGDTTQVTRC 4863          

HSP 9 Score: 52.373 bits (124), Expect = 2.819e-6
Identity = 25/56 (44.64%), Postives = 32/56 (57.14%), Query Frame = 1
Query: 1291 VRAVDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            +  V G +S WS W  CS  C K  G + R+R CN P P +GGKPC G+  E  +C
Sbjct: 4525 IVQVHGGFSQWSAWRACSVTCGK--GIQKRSRLCNQPLPANGGKPCQGSDLEMRNC 4578          
BLAST of Hemicentin-1 vs. Ensembl Human
Match: CFP (complement factor properdin [Source:HGNC Symbol;Acc:HGNC:8864])

HSP 1 Score: 114.775 bits (286), Expect = 4.461e-27
Identity = 72/192 (37.50%), Postives = 87/192 (45.31%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVP--KDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPV 963
            P  G W  W  W  CS+TCS      G  TR R CN P P+ GG +C G   E++ C       P HG W+ W  W+ CS +C      P + RSR C+ P P  K  G  C G +   R C  LP CP+ G WG W    PC      +C LG    QR CN P P   G  C G   +   C   + CPV
Sbjct:  134 PEMGGWSGWGPWEPCSVTCSK-----GTRTRRRACNHPAPKCGG-HCPGQAQESEACDTQQV-CPTHGAWATWGPWTPCSASCHGGPHEPKETRSRKCSAPEPSQKPPGKPCPGLAYEQRRCTGLPPCPVAGGWGPWGPVSPCPV----TCGLGQTMEQRTCNHPVPQHGGPFCAGDATRTHICNTAVPCPV 314          

HSP 2 Score: 99.3673 bits (246), Expect = 7.943e-22
Identity = 65/196 (33.16%), Postives = 91/196 (46.43%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPP--QLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCAL----GSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPV 963
            P  G W +W  W+ CS +C     +    TR R C++P P  +  GK C G+  E   C   P P P+ G W  W   S C  TC L Q+    +  R CN+PVP+ GG  C G++  +  C+    CP+DG+W  W    PC  R+ KS +     G Q   R C       DG  C G ++ +  C+    CP+
Sbjct:  191 PTHGAWATWGPWTPCSASCHGGPHEP-KETRSRKCSAPEPSQKPPGKPCPGLAYEQRRCTGLP-PCPVAGGWGPWGPVSPCPVTCGLGQT----MEQRTCNHPVPQHGGPFCAGDATRTHICNTAVPCPVDGEWDSWGEWSPCIRRNMKSISCQEIPGQQSRGRTCR--GRKFDGHRCAGQQQDIRHCYSIQHCPL 378          

HSP 3 Score: 88.5817 bits (218), Expect = 2.974e-18
Identity = 64/189 (33.86%), Postives = 81/189 (42.86%), Query Frame = 1
Query:  409 WGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFT-ETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNAD--GKPCEGIKEKLEDCWFFIGCPVT 966
            W  W+TW+ CS+TCS      G   R+R C     Q  GK   G    +   C +  C  P  G WS W  W  CS TC    S   + R R CN+P PK GG  C G++  S  CD    CP  G W  W    PC +          +   R+C+ P P+    GKPC G+  +   C     CPV 
Sbjct:   80 WSLWSTWAPCSVTCSE-----GSQLRYRRCVGWNGQCSGKVAPGTLEWQLQACEDQQC-CPEMGGWSGWGPWEPCSVTC----SKGTRTRRRACNHPAPKCGG-HCPGQAQESEACDTQQVCPTHGAWATWGPWTPCSASCHGGPHEPKETRSRKCSAPEPSQKPPGKPCPGLAYEQRRCTGLPPCPVA 257          

HSP 4 Score: 78.9518 bits (193), Expect = 3.753e-15
Identity = 54/148 (36.49%), Postives = 64/148 (43.24%), Query Frame = 1
Query:  385 PNEPVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSAC----SKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPC 816
            P  PV G WG W   S C +TC       G     R CN P PQ GG  C G  T T  C N+  P P+ G W  W EWS C     K+    +    Q R R C     K  G +C G+  + R C  +  CP+ G W EW   G C
Sbjct:  252 PPCPVAGGWGPWGPVSPCPVTCG-----LGQTMEQRTCNHPVPQHGGPFCAGDATRTHIC-NTAVPCPVDGEWDSWGEWSPCIRRNMKSISCQEIPGQQSRGRTCRGR--KFDGHRCAGQQQDIRHCYSIQHCPLKGSWSEWSTWGLC 391          

HSP 5 Score: 53.9138 bits (128), Expect = 4.130e-7
Identity = 38/110 (34.55%), Postives = 50/110 (45.45%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKC------SITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPK 705
            PVDG W SW  WS C      SI+C  +    G  +R R C     +  G  C G   +  +C++     P+ G+WSEWS W  C   C      P + R RLC   +PK
Sbjct:  313 PVDGEWDSWGEWSPCIRRNMKSISCQEIP---GQQSRGRTCRGR--KFDGHRCAGQQQDIRHCYSIQ-HCPLKGSWSEWSTWGLCMPPC---GPNPTRARQRLCTPLLPK 413          
BLAST of Hemicentin-1 vs. Ensembl Human
Match: CFP (complement factor properdin [Source:HGNC Symbol;Acc:HGNC:8864])

HSP 1 Score: 115.546 bits (288), Expect = 4.867e-27
Identity = 72/192 (37.50%), Postives = 87/192 (45.31%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVP--KDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPV 963
            P  G W  W  W  CS+TCS      G  TR R CN P P+ GG +C G   E++ C       P HG W+ W  W+ CS +C      P + RSR C+ P P  K  G  C G +   R C  LP CP+ G WG W    PC      +C LG    QR CN P P   G  C G   +   C   + CPV
Sbjct:  134 PEMGGWSGWGPWEPCSVTCSK-----GTRTRRRACNHPAPKCGG-HCPGQAQESEACDTQQV-CPTHGAWATWGPWTPCSASCHGGPHEPKETRSRKCSAPEPSQKPPGKPCPGLAYEQRRCTGLPPCPVAGGWGPWGPVSPCPV----TCGLGQTMEQRTCNHPVPQHGGPFCAGDATRTHICNTAVPCPV 314          

HSP 2 Score: 99.7525 bits (247), Expect = 8.864e-22
Identity = 65/196 (33.16%), Postives = 91/196 (46.43%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPP--QLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCAL----GSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPV 963
            P  G W +W  W+ CS +C     +    TR R C++P P  +  GK C G+  E   C   P P P+ G W  W   S C  TC L Q+    +  R CN+PVP+ GG  C G++  +  C+    CP+DG+W  W    PC  R+ KS +     G Q   R C       DG  C G ++ +  C+    CP+
Sbjct:  191 PTHGAWATWGPWTPCSASCHGGPHEP-KETRSRKCSAPEPSQKPPGKPCPGLAYEQRRCTGLP-PCPVAGGWGPWGPVSPCPVTCGLGQT----MEQRTCNHPVPQHGGPFCAGDATRTHICNTAVPCPVDGEWDSWGEWSPCIRRNMKSISCQEIPGQQSRGRTCR--GRKFDGHRCAGQQQDIRHCYSIQHCPL 378          

HSP 3 Score: 89.3521 bits (220), Expect = 2.440e-18
Identity = 64/189 (33.86%), Postives = 81/189 (42.86%), Query Frame = 1
Query:  409 WGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFT-ETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNAD--GKPCEGIKEKLEDCWFFIGCPVT 966
            W  W+TW+ CS+TCS      G   R+R C     Q  GK   G    +   C +  C  P  G WS W  W  CS TC    S   + R R CN+P PK GG  C G++  S  CD    CP  G W  W    PC +          +   R+C+ P P+    GKPC G+  +   C     CPV 
Sbjct:   80 WSLWSTWAPCSVTCSE-----GSQLRYRRCVGWNGQCSGKVAPGTLEWQLQACEDQQC-CPEMGGWSGWGPWEPCSVTC----SKGTRTRRRACNHPAPKCGG-HCPGQAQESEACDTQQVCPTHGAWATWGPWTPCSASCHGGPHEPKETRSRKCSAPEPSQKPPGKPCPGLAYEQRRCTGLPPCPVA 257          

HSP 4 Score: 79.7221 bits (195), Expect = 2.832e-15
Identity = 54/148 (36.49%), Postives = 64/148 (43.24%), Query Frame = 1
Query:  385 PNEPVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSAC----SKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPC 816
            P  PV G WG W   S C +TC       G     R CN P PQ GG  C G  T T  C N+  P P+ G W  W EWS C     K+    +    Q R R C     K  G +C G+  + R C  +  CP+ G W EW   G C
Sbjct:  252 PPCPVAGGWGPWGPVSPCPVTCG-----LGQTMEQRTCNHPVPQHGGPFCAGDATRTHIC-NTAVPCPVDGEWDSWGEWSPCIRRNMKSISCQEIPGQQSRGRTCRGR--KFDGHRCAGQQQDIRHCYSIQHCPLKGSWSEWSTWGLC 391          

HSP 5 Score: 54.6842 bits (130), Expect = 3.039e-7
Identity = 38/110 (34.55%), Postives = 50/110 (45.45%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKC------SITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPK 705
            PVDG W SW  WS C      SI+C  +    G  +R R C     +  G  C G   +  +C++     P+ G+WSEWS W  C   C      P + R RLC   +PK
Sbjct:  313 PVDGEWDSWGEWSPCIRRNMKSISCQEIP---GQQSRGRTCRGR--KFDGHRCAGQQQDIRHCYSIQ-HCPLKGSWSEWSTWGLCMPPC---GPNPTRARQRLCTPLLPK 413          
BLAST of Hemicentin-1 vs. Ensembl Human
Match: CFP (complement factor properdin [Source:HGNC Symbol;Acc:HGNC:8864])

HSP 1 Score: 115.546 bits (288), Expect = 4.867e-27
Identity = 72/192 (37.50%), Postives = 87/192 (45.31%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVP--KDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPV 963
            P  G W  W  W  CS+TCS      G  TR R CN P P+ GG +C G   E++ C       P HG W+ W  W+ CS +C      P + RSR C+ P P  K  G  C G +   R C  LP CP+ G WG W    PC      +C LG    QR CN P P   G  C G   +   C   + CPV
Sbjct:  134 PEMGGWSGWGPWEPCSVTCSK-----GTRTRRRACNHPAPKCGG-HCPGQAQESEACDTQQV-CPTHGAWATWGPWTPCSASCHGGPHEPKETRSRKCSAPEPSQKPPGKPCPGLAYEQRRCTGLPPCPVAGGWGPWGPVSPCPV----TCGLGQTMEQRTCNHPVPQHGGPFCAGDATRTHICNTAVPCPV 314          

HSP 2 Score: 99.7525 bits (247), Expect = 8.864e-22
Identity = 65/196 (33.16%), Postives = 91/196 (46.43%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPP--QLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCAL----GSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPV 963
            P  G W +W  W+ CS +C     +    TR R C++P P  +  GK C G+  E   C   P P P+ G W  W   S C  TC L Q+    +  R CN+PVP+ GG  C G++  +  C+    CP+DG+W  W    PC  R+ KS +     G Q   R C       DG  C G ++ +  C+    CP+
Sbjct:  191 PTHGAWATWGPWTPCSASCHGGPHEP-KETRSRKCSAPEPSQKPPGKPCPGLAYEQRRCTGLP-PCPVAGGWGPWGPVSPCPVTCGLGQT----MEQRTCNHPVPQHGGPFCAGDATRTHICNTAVPCPVDGEWDSWGEWSPCIRRNMKSISCQEIPGQQSRGRTCR--GRKFDGHRCAGQQQDIRHCYSIQHCPL 378          

HSP 3 Score: 89.3521 bits (220), Expect = 2.440e-18
Identity = 64/189 (33.86%), Postives = 81/189 (42.86%), Query Frame = 1
Query:  409 WGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFT-ETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNAD--GKPCEGIKEKLEDCWFFIGCPVT 966
            W  W+TW+ CS+TCS      G   R+R C     Q  GK   G    +   C +  C  P  G WS W  W  CS TC    S   + R R CN+P PK GG  C G++  S  CD    CP  G W  W    PC +          +   R+C+ P P+    GKPC G+  +   C     CPV 
Sbjct:   80 WSLWSTWAPCSVTCSE-----GSQLRYRRCVGWNGQCSGKVAPGTLEWQLQACEDQQC-CPEMGGWSGWGPWEPCSVTC----SKGTRTRRRACNHPAPKCGG-HCPGQAQESEACDTQQVCPTHGAWATWGPWTPCSASCHGGPHEPKETRSRKCSAPEPSQKPPGKPCPGLAYEQRRCTGLPPCPVA 257          

HSP 4 Score: 79.7221 bits (195), Expect = 2.832e-15
Identity = 54/148 (36.49%), Postives = 64/148 (43.24%), Query Frame = 1
Query:  385 PNEPVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSAC----SKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPC 816
            P  PV G WG W   S C +TC       G     R CN P PQ GG  C G  T T  C N+  P P+ G W  W EWS C     K+    +    Q R R C     K  G +C G+  + R C  +  CP+ G W EW   G C
Sbjct:  252 PPCPVAGGWGPWGPVSPCPVTCG-----LGQTMEQRTCNHPVPQHGGPFCAGDATRTHIC-NTAVPCPVDGEWDSWGEWSPCIRRNMKSISCQEIPGQQSRGRTCRGR--KFDGHRCAGQQQDIRHCYSIQHCPLKGSWSEWSTWGLC 391          

HSP 5 Score: 54.6842 bits (130), Expect = 3.039e-7
Identity = 38/110 (34.55%), Postives = 50/110 (45.45%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKC------SITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPK 705
            PVDG W SW  WS C      SI+C  +    G  +R R C     +  G  C G   +  +C++     P+ G+WSEWS W  C   C      P + R RLC   +PK
Sbjct:  313 PVDGEWDSWGEWSPCIRRNMKSISCQEIP---GQQSRGRTCRGR--KFDGHRCAGQQQDIRHCYSIQ-HCPLKGSWSEWSTWGLCMPPC---GPNPTRARQRLCTPLLPK 413          
BLAST of Hemicentin-1 vs. Ensembl Human
Match: CFP (complement factor properdin [Source:HGNC Symbol;Acc:HGNC:8864])

HSP 1 Score: 108.612 bits (270), Expect = 5.003e-27
Identity = 67/173 (38.73%), Postives = 80/173 (46.24%), Query Frame = 1
Query:  403 GMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVP--KDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEG 915
            G W  W  W  CS+TCS      G  TR R CN P P+ GG +C G   E++ C       P HG W+ W  W+ CS +C      P + RSR C+ P P  K  G  C G +   R C  LP CP+ G WG W    PC      +C LG    QR CN P P   G  C G
Sbjct:    2 GGWSGWGPWEPCSVTCSK-----GTRTRRRACNHPAPKCGG-HCPGQAQESEACDTQQV-CPTHGAWATWGPWTPCSASCHGGPHEPKETRSRKCSAPEPSQKPPGKPCPGLAYEQRRCTGLPPCPVAGGWGPWGPVSPCPV----TCGLGQTMEQRTCNHPVPQHGGPFCAG 163          

HSP 2 Score: 68.9366 bits (167), Expect = 4.539e-13
Identity = 44/126 (34.92%), Postives = 55/126 (43.65%), Query Frame = 1
Query:  595 GNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPN--ADGKPCEGIKEKLEDCWFFIGCPVT 966
            G WS W  W  CS TC    S   + R R CN+P PK GG  C G++  S  CD    CP  G W  W    PC +          +   R+C+ P P+    GKPC G+  +   C     CPV 
Sbjct:    2 GGWSGWGPWEPCSVTC----SKGTRTRRRACNHPAPKCGG-HCPGQAQESEACDTQQVCPTHGAWATWGPWTPCSASCHGGPHEPKETRSRKCSAPEPSQKPPGKPCPGLAYEQRRCTGLPPCPVA 122          

HSP 3 Score: 68.1662 bits (165), Expect = 7.062e-13
Identity = 42/118 (35.59%), Postives = 57/118 (48.31%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPP--QLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLN 741
            P  G W +W  W+ CS +C     +    TR R C++P P  +  GK C G+  E   C   P P P+ G W  W   S C  TC L Q+    +  R CN+PVP+ GG  C G++  
Sbjct:   56 PTHGAWATWGPWTPCSASCHGGPHEP-KETRSRKCSAPEPSQKPPGKPCPGLAYEQRRCTGLP-PCPVAGGWGPWGPVSPCPVTCGLGQT----MEQRTCNHPVPQHGGPFCAGDATR 167          
BLAST of Hemicentin-1 vs. Ensembl Celegans
Match: adt-1 (A disintegrin and metalloproteinase with thrombospondin motifs adt-1 [Source:UniProtKB/Swiss-Prot;Acc:G5ECS8])

HSP 1 Score: 104.375 bits (259), Expect = 3.658e-23
Identity = 67/192 (34.90%), Postives = 94/192 (48.96%), Query Frame = 1
Query:  379 IAPNEPVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIH---GNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQC--PIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDC 939
            +  +E VDG W  WT WS+C+  C     + G  +R R C +P P  GG  CTG   E + CF+   P   H   G WS WS+W+ CS +C       +Q R R C++P PK GG  C G +  +  CD LP C    DG+W  W     C      +C +G++   R C  P  +  G+PC G   ++ +C
Sbjct: 1258 VCSDEKVDGGWTDWTAWSECTDYC-----RNGHRSRTRFCANPKPSQGGAQCTGSDFELNPCFD---PARCHLRDGGWSTWSDWTPCSASCGF----GVQTRDRSCSSPEPK-GGQSCSGLAHQTSLCD-LPACDHESDGEWSAWNEWSGC----MGNCGIGTRTRVRACVSPPVSDGGQPCFGRSSEITEC 1431          

HSP 2 Score: 92.8189 bits (229), Expect = 1.969e-19
Identity = 64/214 (29.91%), Postives = 87/214 (40.65%), Query Frame = 1
Query:  313 ICSVIGSIVACMTSHRVSPYIAIAPNE--PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCF--NSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPI-DGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDC 939
             C V+   V    +  +   I  AP    P  G W  W+ WS CS  C       G   R R+C+ P P   G  C+G   +   C   N      + G W++W+ WS C+  CR    +    R+R C NP P  GG +C G       C    +C + DG W  W    PC +    SC  G Q   R C+ P P   G+ C G+  +   C
Sbjct: 1172 FCQVVDPTVQGFCAGAILEQIPCAPGSCSPSAGGWSLWSEWSSCSKDCGDT----GHQIRNRMCSEPIPSNRGAYCSGYSFDQRPCVMDNVCSDEKVDGGWTDWTAWSECTDYCRNGHRS----RTRFCANPKPSQGGAQCTGSDFELNPCFDPARCHLRDGGWSTWSDWTPCSA----SCGFGVQTRDRSCSSPEPKG-GQSCSGLAHQTSLC 1372          

HSP 3 Score: 83.1889 bits (204), Expect = 2.125e-16
Identity = 61/181 (33.70%), Postives = 79/181 (43.65%), Query Frame = 1
Query:  409 WGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQC---PIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCW 942
            W  W++WS CS  C S+       TR R C    P + G  C G   E   C    C  P  G WS WSEWS+CSK C        Q+R+R+C+ P+P + G  C G S + R C     C    +DG W +W     C       C  G +   R C  P P+  G  C G   +L  C+
Sbjct: 1151 WSEWSSWSACS--CFSL-----TSTRRRFCQVVDPTVQGF-CAGAILEQIPCAPGSCS-PSAGGWSLWSEWSSCSKDC---GDTGHQIRNRMCSEPIPSNRGAYCSGYSFDQRPCVMDNVCSDEKVDGGWTDWTAWSECTDY----CRNGHRSRTRFCANPKPSQGGAQCTGSDFELNPCF 1315          

HSP 4 Score: 75.0998 bits (183), Expect = 6.692e-14
Identity = 44/122 (36.07%), Postives = 61/122 (50.00%), Query Frame = 1
Query:  400 DGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLP 765
            DG W +W+ W+ CS +C      +G+ TR R C+SP P+ GG++C+G+  +T  C    C     G WS W+EWS C   C +      + R R C +P   DGG  C G S     C   P
Sbjct: 1324 DGGWSTWSDWTPCSASCG-----FGVQTRDRSCSSPEPK-GGQSCSGLAHQTSLCDLPACDHESDGEWSAWNEWSGCMGNCGI----GTRTRVRACVSPPVSDGGQPCFGRSSEITECRQSP 1435          

HSP 5 Score: 53.5286 bits (127), Expect = 3.919e-7
Identity = 25/59 (42.37%), Postives = 33/59 (55.93%), Query Frame = 1
Query: 1300 VDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSCYGMGDC 1476
            VDG W+ W+ WS+C+  C   NG+R+R R C NP P  GG  C G+  E   C+    C
Sbjct: 1264 VDGGWTDWTAWSECTDYC--RNGHRSRTRFCANPKPSQGGAQCTGSDFELNPCFDPARC 1320          

HSP 6 Score: 49.6766 bits (117), Expect = 5.977e-6
Identity = 50/177 (28.25%), Postives = 69/177 (38.98%), Query Frame = 1
Query:  409 WGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDC 939
            +G W  W  CS  C+      G+  RFR C      L  +  +    E   C N  C       W+ W EWS+CS++C        + R R C +        KCDG+ L    C+   Q  I   WG+W    PC      SC +G Q  +R C       DG+ C    ++   C
Sbjct:  761 FGEWKEWGSCSEKCA-----LGVQKRFRPC------LTDQCSSKHLQEERPCDNEGC-------WTNWDEWSSCSQSC----GGGRRYRIRKCLDD-------KCDGDDLEKESCN--TQKCISQSWGDWL---PCSV----SCGIGFQIRERLC-------DGELCATANKQARTC 892          

HSP 7 Score: 49.2914 bits (116), Expect = 7.154e-6
Identity = 37/93 (39.78%), Postives = 45/93 (48.39%), Query Frame = 1
Query:  598 NWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCD-YLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQC 873
             W EWS WS CS +C L      +VR R C++      G KC G S  SR C+  L  C   G+W EW   G C  +    CALG Q+  R C
Sbjct:  709 QWEEWSSWSECSVSCGL---GGREVRERKCSS------GRKCQGVSEESRPCEGVLRDCEEFGEWKEW---GSCSEK----CALGVQKRFRPC 785          

HSP 8 Score: 48.9062 bits (115), Expect = 9.093e-6
Identity = 25/52 (48.08%), Postives = 30/52 (57.69%), Query Frame = 1
Query: 1303 DGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            DG+WS+W+ WS C   C    G RTR R C +P   DGG+PC G S E   C
Sbjct: 1382 DGEWSAWNEWSGCMGNCGI--GTRTRVRACVSPPVSDGGQPCFGRSSEITEC 1431          
BLAST of Hemicentin-1 vs. Ensembl Celegans
Match: C36B7.5 (pep chromosome:WBcel235:X:7089228:7096449:-1 gene:WBGene00016468.1 transcript:C36B7.5a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C36B7.5)

HSP 1 Score: 72.4034 bits (176), Expect = 5.051e-13
Identity = 85/330 (25.76%), Postives = 116/330 (35.15%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFN-SPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPVTLQPPLNLHLTGNGSGLFNVSWSSVPYGKLASTYRIYKTIEDESNREIKTNYEDHNALPNKKITSMNYWAIIDLRNLLSLNTFQTLAVRMSSIDFWKEESSLSNPVRSKVRAVDGKWSSWSYWSDCSAKCHKENGYRTR 1380
            P   +W  W+ WS C+ TC   ++Q     R R+C +      G+NC G   E + C    PCP      WS W  W+ C  +C       ++ RSR+C N      GL C G +   R CD  P CP    WG+W        +  K C  G     R+C       DG  CEG  E+   C              N       S     +      G+ +   R  K +  E+N       +D  + P +       W         S    Q    R+   D   E S     +R    A    W  W+ WS CS  C +    RTR
Sbjct:  346 PECAVWTLWSPWSLCTATCGVGEIQ-----RNRVCQT------GRNCDGPSVEVEACKALLPCPT-----WSSWMSWTGCGNSC----GKSIERRSRICQN------GLLCPGPATEERTCDKRP-CPHWSNWGQW-------EKCSKECGAGHTYRNREC------IDGVSCEGASEEKILC--------------NQQPCPEWSQWTAWTVCDERCGEESIRLRNRKCMNAENNNACDGPAQDQMSCPYRDCPKWEEWGEW---ADCSTTCGQGTQKRLRKCDSGNECSGPGEEMRFCQIASCPYWGDWTPWSGCSVSCGQGVCERTR 618          

HSP 2 Score: 64.3142 bits (155), Expect = 1.789e-10
Identity = 90/351 (25.64%), Postives = 121/351 (34.47%), Query Frame = 1
Query:  415 SWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPVTLQPPLNLHLTGNGSGLFNVSWSSVPYGKLASTYRIYKTIEDESNREIKTNYEDHNALPNKKITSMNYWAIIDLR---NLLSLNTFQTLAVRMSSIDFWKEESSLSNPVRSKVRAVDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
             WT WS+CS +C       G+  R R C      LGG  C G  T        PC VP    W+ WS WS C+ TC + +      R+R+C        G  CDG S+    C  L  CP    W  W   G        SC    +R  R C       +G  C G              P T +   +     + S        S   G    TYR  + I+  S           N  P  + +    W + D R     + L   + +    ++      +  +S P R        KW  W  W+DCS  C +  G + R R C      D G  C+G  EE   C
Sbjct:  309 EWTEWSECSASC-------GISLRTRQC------LGGITCIGPST-------IPCQVPECAVWTLWSPWSLCTATCGVGEIQ----RNRVCQT------GRNCDGPSVEVEACKALLPCPTWSSWMSWTGCG-------NSCGKSIERRSRICQ------NGLLCPG--------------PATEERTCDKRPCPHWSNWGQWEKCSKECG-AGHTYRNRECIDGVSCEGASEEKILCNQQPCPEWSQWTAWTVCDERCGEESIRLRNRKCMNAENNNACDGPAQDQMSCPYRDCP-----KWEEWGEWADCSTTCGQ--GTQKRLRKC------DSGNECSGPGEEMRFC 588          
BLAST of Hemicentin-1 vs. Ensembl Celegans
Match: C36B7.5 (pep chromosome:WBcel235:X:7089228:7096449:-1 gene:WBGene00016468.1 transcript:C36B7.5b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C36B7.5)

HSP 1 Score: 71.633 bits (174), Expect = 7.516e-13
Identity = 85/330 (25.76%), Postives = 116/330 (35.15%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFN-SPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPVTLQPPLNLHLTGNGSGLFNVSWSSVPYGKLASTYRIYKTIEDESNREIKTNYEDHNALPNKKITSMNYWAIIDLRNLLSLNTFQTLAVRMSSIDFWKEESSLSNPVRSKVRAVDGKWSSWSYWSDCSAKCHKENGYRTR 1380
            P   +W  W+ WS C+ TC   ++Q     R R+C +      G+NC G   E + C    PCP      WS W  W+ C  +C       ++ RSR+C N      GL C G +   R CD  P CP    WG+W        +  K C  G     R+C       DG  CEG  E+   C              N       S     +      G+ +   R  K +  E+N       +D  + P +       W         S    Q    R+   D   E S     +R    A    W  W+ WS CS  C +    RTR
Sbjct:  346 PECAVWTLWSPWSLCTATCGVGEIQ-----RNRVCQT------GRNCDGPSVEVEACKALLPCPT-----WSSWMSWTGCGNSC----GKSIERRSRICQN------GLLCPGPATEERTCDKRP-CPHWSNWGQW-------EKCSKECGAGHTYRNREC------IDGVSCEGASEEKILC--------------NQQPCPEWSQWTAWTVCDERCGEESIRLRNRKCMNAENNNACDGPAQDQMSCPYRDCPKWEEWGEW---ADCSTTCGQGTQKRLRKCDSGNECSGPGEEMRFCQIASCPYWGDWTPWSGCSVSCGQGVCERTR 618          

HSP 2 Score: 63.5438 bits (153), Expect = 2.542e-10
Identity = 90/356 (25.28%), Postives = 121/356 (33.99%), Query Frame = 1
Query:  415 SWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNK----PSPNADGKPCEGIKEKLEDCWFFIGCPVTLQPPLNLHLTGNGSGLFNVSWSSVPYG-KLASTYRIYKTIEDESNREIKTNYEDHNALPNKKITSMNYWAIIDLR---NLLSLNTFQTLAVRMSSIDFWKEESSLSNPVRSKVRAVDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
             WT WS+CS +C       G+  R R C      LGG  C G  T        PC VP    W+ WS WS C+ TC + +      R+R+C        G  CDG S+    C  L  CP    W  W   G        SC    +R  R C      P P  + + C+              CP         H +  G       W           TYR  + I+  S           N  P  + +    W + D R     + L   + +    ++      +  +S P R        KW  W  W+DCS  C +  G + R R C      D G  C+G  EE   C
Sbjct:  309 EWTEWSECSASC-------GISLRTRQC------LGGITCIGPST-------IPCQVPECAVWTLWSPWSLCTATCGVGEIQ----RNRVCQT------GRNCDGPSVEVEACKALLPCPTWSSWMSWTGCG-------NSCGKSIERRSRICQNGLLCPGPATEERTCDKRP-----------CP---------HWSNWG------QWEKCSKECGAGHTYRNRECIDGVSCEGASEEKILCNQQPCPEWSQWTAWTVCDERCGEESIRLRNRKCMNAENNNACDGPAQDQMSCPYRDCP-----KWEEWGEWADCSTTCGQ--GTQKRLRKC------DSGNECSGPGEEMRFC 588          
BLAST of Hemicentin-1 vs. Ensembl Celegans
Match: adt-2 (A disintegrin and metalloproteinase with thrombospondin motifs adt-2 [Source:UniProtKB/Swiss-Prot;Acc:Q19204])

HSP 1 Score: 68.1662 bits (165), Expect = 8.529e-12
Identity = 55/181 (30.39%), Postives = 80/181 (44.20%), Query Frame = 1
Query:  403 GMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCP--VPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDC 939
            G WG+W+ W+ C+ TC       G   R R C+     + G+ C G   ET+ C +  CP  + +   WS W+EW+ CS +C        Q R R C +P  +     C  +++  R CD  P C   G WG W     C +    SC  G+   QR CN+       +PC+G   +   C
Sbjct:  703 GQWGTWSLWTSCTATCGG-----GYRKRNRACS-----ITGQ-CEGNEDETEVCSSESCPSVLRVGNEWSTWTEWNHCSVSC----GRGSQARYRKCLSP-HRTLAFDCPEKNIEVRSCDNGP-CNAIGVWGTWGGWSTCST----SCGPGTLVRQRTCNR-------EPCDGSAHERRSC 855          

HSP 2 Score: 59.6918 bits (143), Expect = 4.138e-9
Identity = 49/159 (30.82%), Postives = 62/159 (38.99%), Query Frame = 1
Query:  397 VDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQC 873
            V   W +WT W+ CS++C       G   R+R C SP   L   +C     E  +C N PC     G W  W  WS CS +C         VR R CN          CDG +   R C+ +  C  DG W  W     C     + C  G +   R C
Sbjct:  756 VGNEWSTWTEWNHCSVSCGR-----GSQARYRKCLSPHRTL-AFDCPEKNIEVRSCDNGPCNAI--GVWGTWGGWSTCSTSC----GPGTLVRQRTCNRE-------PCDGSAHERRSCN-VATCQNDGIWSLWNEWSDCS----RVCGKGLRSRSRSC 890          

HSP 3 Score: 50.447 bits (119), Expect = 2.914e-6
Identity = 32/96 (33.33%), Postives = 40/96 (41.67%), Query Frame = 1
Query:  400 DGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLC 687
            DG+W  W  WS CS  C       GL +R R C        G  C G  +E   C    C      +W  WS WS CS +C     A ++ R+R C
Sbjct:  863 DGIWSLWNEWSDCSRVCGK-----GLRSRSRSCF-------GSGCMGASSEQQFCNEQACASSSANDWGTWSGWSQCSVSC----GAGVKRRTRTC 942          
BLAST of Hemicentin-1 vs. Ensembl Celegans
Match: adt-2 (A disintegrin and metalloproteinase with thrombospondin motifs adt-2 [Source:UniProtKB/Swiss-Prot;Acc:Q19204])

HSP 1 Score: 68.1662 bits (165), Expect = 8.529e-12
Identity = 55/181 (30.39%), Postives = 80/181 (44.20%), Query Frame = 1
Query:  403 GMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCP--VPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDC 939
            G WG+W+ W+ C+ TC       G   R R C+     + G+ C G   ET+ C +  CP  + +   WS W+EW+ CS +C        Q R R C +P  +     C  +++  R CD  P C   G WG W     C +    SC  G+   QR CN+       +PC+G   +   C
Sbjct:  703 GQWGTWSLWTSCTATCGG-----GYRKRNRACS-----ITGQ-CEGNEDETEVCSSESCPSVLRVGNEWSTWTEWNHCSVSC----GRGSQARYRKCLSP-HRTLAFDCPEKNIEVRSCDNGP-CNAIGVWGTWGGWSTCST----SCGPGTLVRQRTCNR-------EPCDGSAHERRSC 855          

HSP 2 Score: 59.6918 bits (143), Expect = 4.138e-9
Identity = 49/159 (30.82%), Postives = 62/159 (38.99%), Query Frame = 1
Query:  397 VDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQC 873
            V   W +WT W+ CS++C       G   R+R C SP   L   +C     E  +C N PC     G W  W  WS CS +C         VR R CN          CDG +   R C+ +  C  DG W  W     C     + C  G +   R C
Sbjct:  756 VGNEWSTWTEWNHCSVSCGR-----GSQARYRKCLSPHRTL-AFDCPEKNIEVRSCDNGPCNAI--GVWGTWGGWSTCSTSC----GPGTLVRQRTCNRE-------PCDGSAHERRSCN-VATCQNDGIWSLWNEWSDCS----RVCGKGLRSRSRSC 890          

HSP 3 Score: 50.447 bits (119), Expect = 2.914e-6
Identity = 32/96 (33.33%), Postives = 40/96 (41.67%), Query Frame = 1
Query:  400 DGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLC 687
            DG+W  W  WS CS  C       GL +R R C        G  C G  +E   C    C      +W  WS WS CS +C     A ++ R+R C
Sbjct:  863 DGIWSLWNEWSDCSRVCGK-----GLRSRSRSCF-------GSGCMGASSEQQFCNEQACASSSANDWGTWSGWSQCSVSC----GAGVKRRTRTC 942          
BLAST of Hemicentin-1 vs. Ensembl Fly
Match: Sema5c (gene:FBgn0284221 transcript:FBtr0300339)

HSP 1 Score: 120.168 bits (300), Expect = 3.297e-28
Identity = 68/190 (35.79%), Postives = 92/190 (48.42%), Query Frame = 1
Query:  388 NEPVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCP------IDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDC 939
            N P+DG W +W+ W+ C               R R CN+P PQ GG  C GI T+  NC         HG W+EWS WS CS+TC +     +++R R C NP P  GG  C G   +  +C +LP CP      +DG WG W     C ++    C  G +  +R+CN P+P   G  C G +   E+C
Sbjct:  547 NAPIDGGWSTWSPWAVCQ---QHEQPDSNCQCRQRSCNNPQPQHGGATCEGISTQVTNCTQ-------HGGWTEWSAWSPCSQTCGI----AVKIRRRTCGNPRPAFGGRTCVGSEQSEMYCRHLPPCPVAKPQSVDGGWGPWGEWSECSAQ----CGGGFRMRRRECNDPAPLNGGMECPGCRLDYEEC 718          

HSP 2 Score: 70.0922 bits (170), Expect = 3.559e-12
Identity = 46/133 (34.59%), Postives = 59/133 (44.36%), Query Frame = 1
Query:  577 CPV---PIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPVT 966
            CPV   PI G WS WS W+ C +    P S   Q R R CNNP P+ GG  C+G S        +  C   G W EW    PC     ++C +  +  +R C  P P   G+ C G ++    C     CPV 
Sbjct:  543 CPVLNAPIDGGWSTWSPWAVCQQH-EQPDSN-CQCRQRSCNNPQPQHGGATCEGISTQ------VTNCTQHGGWTEWSAWSPCS----QTCGIAVKIRRRTCGNPRPAFGGRTCVGSEQSEMYCRHLPPCPVA 663          

HSP 3 Score: 55.4546 bits (132), Expect = 1.082e-7
Identity = 24/50 (48.00%), Postives = 34/50 (68.00%), Query Frame = 1
Query: 1285 SKVRAVDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNG 1434
            +K ++VDG W  W  WS+CSA+C    G+R R R+CN+P+P +GG  C G
Sbjct:  663 AKPQSVDGGWGPWGEWSECSAQCG--GGFRMRRRECNDPAPLNGGMECPG 710          

HSP 4 Score: 54.299 bits (129), Expect = 2.933e-7
Identity = 42/122 (34.43%), Postives = 54/122 (44.26%), Query Frame = 1
Query:  388 NEPVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFC 753
            NE   G WG W+ WS CS+TC       GL  R R C +   +L    C G   E   C   PC   +   WS WSEWS+CS       S  +++R R C   V + G ++C G       C
Sbjct:  844 NELEHGEWGCWSEWSACSVTCG-----LGLRRRTRRCLAGHDRL----CQGRALEEQKCEMVPCEDFL--GWSAWSEWSSCS-------SDGIRLRHRRC--LVEQPGSMECRGAEFEKTAC 945          

HSP 5 Score: 51.2174 bits (121), Expect = 2.305e-6
Identity = 26/79 (32.91%), Postives = 40/79 (50.63%), Query Frame = 1
Query: 1234 SSIDFWKEESSLSNPVRSKVRAVDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSCYGMG 1470
            S +  W +   ++ PV +    +DG WS+WS W+ C      ++  + R R CNNP P+ GG  C G S +  +C   G
Sbjct:  530 SVLQHWHQAPQITCPVLNA--PIDGGWSTWSPWAVCQQHEQPDSNCQCRQRSCNNPQPQHGGATCEGISTQVTNCTQHG 606          
BLAST of Hemicentin-1 vs. Ensembl Fly
Match: Sema5c (gene:FBgn0284221 transcript:FBtr0076052)

HSP 1 Score: 120.168 bits (300), Expect = 3.331e-28
Identity = 68/190 (35.79%), Postives = 92/190 (48.42%), Query Frame = 1
Query:  388 NEPVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCP------IDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDC 939
            N P+DG W +W+ W+ C               R R CN+P PQ GG  C GI T+  NC         HG W+EWS WS CS+TC +     +++R R C NP P  GG  C G   +  +C +LP CP      +DG WG W     C ++    C  G +  +R+CN P+P   G  C G +   E+C
Sbjct:  549 NAPIDGGWSTWSPWAVCQ---QHEQPDSNCQCRQRSCNNPQPQHGGATCEGISTQVTNCTQ-------HGGWTEWSAWSPCSQTCGI----AVKIRRRTCGNPRPAFGGRTCVGSEQSEMYCRHLPPCPVAKPQSVDGGWGPWGEWSECSAQ----CGGGFRMRRRECNDPAPLNGGMECPGCRLDYEEC 720          

HSP 2 Score: 70.0922 bits (170), Expect = 3.500e-12
Identity = 46/133 (34.59%), Postives = 59/133 (44.36%), Query Frame = 1
Query:  577 CPV---PIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPVT 966
            CPV   PI G WS WS W+ C +    P S   Q R R CNNP P+ GG  C+G S        +  C   G W EW    PC     ++C +  +  +R C  P P   G+ C G ++    C     CPV 
Sbjct:  545 CPVLNAPIDGGWSTWSPWAVCQQH-EQPDSN-CQCRQRSCNNPQPQHGGATCEGISTQ------VTNCTQHGGWTEWSAWSPCS----QTCGIAVKIRRRTCGNPRPAFGGRTCVGSEQSEMYCRHLPPCPVA 665          

HSP 3 Score: 55.4546 bits (132), Expect = 1.083e-7
Identity = 24/50 (48.00%), Postives = 34/50 (68.00%), Query Frame = 1
Query: 1285 SKVRAVDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNG 1434
            +K ++VDG W  W  WS+CSA+C    G+R R R+CN+P+P +GG  C G
Sbjct:  665 AKPQSVDGGWGPWGEWSECSAQCG--GGFRMRRRECNDPAPLNGGMECPG 712          

HSP 4 Score: 54.299 bits (129), Expect = 2.885e-7
Identity = 42/122 (34.43%), Postives = 54/122 (44.26%), Query Frame = 1
Query:  388 NEPVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFC 753
            NE   G WG W+ WS CS+TC       GL  R R C +   +L    C G   E   C   PC   +   WS WSEWS+CS       S  +++R R C   V + G ++C G       C
Sbjct:  846 NELEHGEWGCWSEWSACSVTCG-----LGLRRRTRRCLAGHDRL----CQGRALEEQKCEMVPCEDFL--GWSAWSEWSSCS-------SDGIRLRHRRC--LVEQPGSMECRGAEFEKTAC 947          

HSP 5 Score: 51.2174 bits (121), Expect = 2.286e-6
Identity = 26/79 (32.91%), Postives = 40/79 (50.63%), Query Frame = 1
Query: 1234 SSIDFWKEESSLSNPVRSKVRAVDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSCYGMG 1470
            S +  W +   ++ PV +    +DG WS+WS W+ C      ++  + R R CNNP P+ GG  C G S +  +C   G
Sbjct:  532 SVLQHWHQAPQITCPVLNA--PIDGGWSTWSPWAVCQQHEQPDSNCQCRQRSCNNPQPQHGGATCEGISTQVTNCTQHG 608          
BLAST of Hemicentin-1 vs. Ensembl Fly
Match: AdamTS-B (gene:FBgn0029791 transcript:FBtr0301084)

HSP 1 Score: 54.6842 bits (130), Expect = 1.928e-7
Identity = 30/93 (32.26%), Postives = 46/93 (49.46%), Query Frame = 1
Query:  502 SPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPID 780
            + P  L G+N    + +   C        ++G W +WSEWS CS++C       +  + R C+NPVP +GG+ C GE    + C   P CP +
Sbjct:  584 TAPGTLCGRN---KWCQNGKCVRREELAAVNGGWGDWSEWSECSRSC----GGGVSTQQRECDNPVPANGGVFCIGERKRYKICRKRP-CPAE 668          

HSP 2 Score: 50.0618 bits (118), Expect = 4.524e-6
Identity = 24/59 (40.68%), Postives = 33/59 (55.93%), Query Frame = 1
Query: 1282 RSKVRAVDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            R ++ AV+G W  WS WS+CS  C    G  T+ R+C+NP P +GG  C G  +    C
Sbjct:  604 REELAAVNGGWGDWSEWSECSRSC--GGGVSTQQRECDNPVPANGGVFCIGERKRYKIC 660          
BLAST of Hemicentin-1 vs. Ensembl Fly
Match: AdamTS-B (gene:FBgn0029791 transcript:FBtr0301083)

HSP 1 Score: 53.9138 bits (128), Expect = 3.121e-7
Identity = 25/64 (39.06%), Postives = 37/64 (57.81%), Query Frame = 1
Query:  589 IHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPID 780
            ++G W +WSEWS CS++C       +  + R C+NPVP +GG+ C GE    + C   P CP +
Sbjct:  610 VNGGWGDWSEWSECSRSC----GGGVSTQQRECDNPVPANGGVFCIGERKRYKICRKRP-CPAE 668          

HSP 2 Score: 50.0618 bits (118), Expect = 5.317e-6
Identity = 24/59 (40.68%), Postives = 33/59 (55.93%), Query Frame = 1
Query: 1282 RSKVRAVDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            R ++ AV+G W  WS WS+CS  C    G  T+ R+C+NP P +GG  C G  +    C
Sbjct:  604 REELAAVNGGWGDWSEWSECSRSC--GGGVSTQQRECDNPVPANGGVFCIGERKRYKIC 660          
BLAST of Hemicentin-1 vs. Ensembl Fly
Match: gogo (gene:FBgn0052227 transcript:FBtr0074848)

HSP 1 Score: 51.2174 bits (121), Expect = 2.255e-6
Identity = 24/57 (42.11%), Postives = 29/57 (50.88%), Query Frame = 1
Query:  403 GMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNS 573
            G WG W+ W+ CS  C       G   R+R C+SPPP+ G K C G   ET  C  S
Sbjct:  457 GGWGPWSEWTPCSTNCLG-----GTRNRYRFCDSPPPRYGAKFCEGPSVETQKCGKS 508          
BLAST of Hemicentin-1 vs. Ensembl Zebrafish
Match: hmcn1 (hemicentin 1 [Source:ZFIN;Acc:ZDB-GENE-041014-322])

HSP 1 Score: 139.043 bits (349), Expect = 4.089e-34
Identity = 75/184 (40.76%), Postives = 95/184 (51.63%), Query Frame = 1
Query:  388 NEPVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDC 939
            N PVDG W SW +W  CS++C       G   R R+C +P PQ GG+ C G     D C N PC  PIHGNW  W+ W +CS+TC   Q      R R C+NP P +GG  C G     + C+    CP+DG+W  W   G C +    SC  G +   R CN PSP+  G+PC G   +L  C
Sbjct: 4672 NCPVDGKWSSWVSWGACSVSCGG-----GTRQRTRICANPTPQHGGRQCEGNDIHIDFCNNEPC--PIHGNWGPWNSWGSCSRTCNGGQMR----RYRTCDNPRPANGGRACTGSDSQIQKCN-TANCPVDGKWSSWESWGECSA----SCGGGERTRVRLCNSPSPSNSGRPCPGDSTQLSRC 4839          

HSP 2 Score: 137.117 bits (344), Expect = 2.023e-33
Identity = 76/190 (40.00%), Postives = 98/190 (51.58%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPV 963
            PV G WG+W  WS CS TC       G+ TR RLCN+PPP   G +C G  T+T  C    CPV   G WS W  W ACS +C        + R+R+C NP P+ GG +C+G  ++  FC+  P CPI G WG W   G C     ++C  G  R  R C+ P P   G+ C G   +++ C     CPV
Sbjct: 4617 PVAGNWGAWLPWSPCSETCGK-----GMQTRLRLCNNPPPSFEGPSCEGPDTQTQVCNERNCPV--DGKWSSWVSWGACSVSC----GGGTRQRTRICANPTPQHGGRQCEGNDIHIDFCNNEP-CPIHGNWGPWNSWGSCS----RTCNGGQMRRYRTCDNPRPANGGRACTGSDSQIQKC-NTANCPV 4789          

HSP 3 Score: 115.161 bits (287), Expect = 2.959e-26
Identity = 72/182 (39.56%), Postives = 93/182 (51.10%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDC 939
            PVDG W  W++W +CS TC       G  TR R C++PP Q GG+ C G   E   C   PCPV   GNW  W  WS CS+TC       +Q R RLCNNP P   G  C+G    ++ C+    CP+DG+W  W   G C      SC  G+++  R C  P+P   G+ CEG    ++ C
Sbjct: 4560 PVDGSWSEWSSWEECSRTCGQ-----GNRTRVRTCSNPPAQHGGRACEGKAVEAIMCSIRPCPVA--GNWGAWLPWSPCSETC----GKGMQTRLRLCNNPPPSFEGPSCEGPDTQTQVCNER-NCPVDGKWSSWVSWGACSV----SCGGGTRQRTRICANPTPQHGGRQCEGNDIHIDFC 4725          

HSP 4 Score: 109.383 bits (272), Expect = 2.320e-24
Identity = 68/181 (37.57%), Postives = 93/181 (51.38%), Query Frame = 1
Query:  397 VDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDC 939
            V G +  W  W  CS++C +     G+  R R CN P P  GG++C G  +ET  C   PCPV   G+WSEWS W  CS+TC        + R R C+NP  + GG  C+G+++ +  C   P CP+ G WG W    PC     ++C  G Q   R CN P P+ +G  CEG   + + C
Sbjct: 4504 VHGGFSEWMEWGACSVSCGT-----GVQRRLRQCNKPFPANGGRHCVGSASETRRCQGKPCPV--DGSWSEWSSWEECSRTCGQGN----RTRVRTCSNPPAQHGGRACEGKAVEAIMCSIRP-CPVAGNWGAWLPWSPCS----ETCGKGMQTRLRLCNNPPPSFEGPSCEGPDTQTQVC 4668          

HSP 5 Score: 92.0485 bits (227), Expect = 7.584e-19
Identity = 52/139 (37.41%), Postives = 68/139 (48.92%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAG 810
            P+ G WG W +W  CS TC+      G M R+R C++P P  GG+ CTG  ++   C  + CPV   G WS W  W  CS +C        + R RLCN+P P + G  C G+S     C+  P CP   Q     I G
Sbjct: 4731 PIHGNWGPWNSWGSCSRTCNG-----GQMRRYRTCDNPRPANGGRACTGSDSQIQKCNTANCPV--DGKWSSWESWGECSASC----GGGERTRVRLCNSPSPSNSGRPCPGDSTQLSRCNLQP-CPGGPQKARGSIIG 4857          

HSP 6 Score: 72.7886 bits (177), Expect = 7.948e-13
Identity = 43/111 (38.74%), Postives = 57/111 (51.35%), Query Frame = 1
Query:  583 VPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEG 915
            V +HG +SEW EW ACS +C       +Q R R CN P P +GG  C G +  +R C   P CP+DG W EW     C     ++C  G++   R C+ P     G+ CEG
Sbjct: 4502 VRVHGGFSEWMEWGACSVSC----GTGVQRRLRQCNKPFPANGGRHCVGSASETRRCQGKP-CPVDGSWSEWSSWEECS----RTCGQGNRTRVRTCSNPPAQHGGRACEG 4603          

HSP 7 Score: 61.6178 bits (148), Expect = 1.946e-9
Identity = 29/53 (54.72%), Postives = 35/53 (66.04%), Query Frame = 1
Query: 1300 VDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            VDGKWSSW  W +CSA C    G RTR R CN+PSP + G+PC G+S +   C
Sbjct: 4789 VDGKWSSWESWGECSASCG--GGERTRVRLCNSPSPSNSGRPCPGDSTQLSRC 4839          

HSP 8 Score: 58.5362 bits (140), Expect = 1.835e-8
Identity = 30/65 (46.15%), Postives = 35/65 (53.85%), Query Frame = 1
Query:  388 NEPVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCP 582
            N PVDG W SW +W +CS +C       G  TR RLCNSP P   G+ C G  T+   C   PCP
Sbjct: 4786 NCPVDGKWSSWESWGECSASCGG-----GERTRVRLCNSPSPSNSGRPCPGDSTQLSRCNLQPCP 4845          

HSP 9 Score: 55.4546 bits (132), Expect = 1.557e-7
Identity = 25/46 (54.35%), Postives = 28/46 (60.87%), Query Frame = 1
Query: 1300 VDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGN 1437
            VDGKWSSW  W  CS  C    G R R R C NP+P+ GG+ C GN
Sbjct: 4675 VDGKWSSWVSWGACSVSCG--GGTRQRTRICANPTPQHGGRQCEGN 4718          
BLAST of Hemicentin-1 vs. Ensembl Zebrafish
Match: hmcn1 (hemicentin 1 [Source:ZFIN;Acc:ZDB-GENE-041014-322])

HSP 1 Score: 139.043 bits (349), Expect = 4.320e-34
Identity = 75/184 (40.76%), Postives = 95/184 (51.63%), Query Frame = 1
Query:  388 NEPVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDC 939
            N PVDG W SW +W  CS++C       G   R R+C +P PQ GG+ C G     D C N PC  PIHGNW  W+ W +CS+TC   Q      R R C+NP P +GG  C G     + C+    CP+DG+W  W   G C +    SC  G +   R CN PSP+  G+PC G   +L  C
Sbjct: 4674 NCPVDGKWSSWVSWGACSVSCGG-----GTRQRTRICANPTPQHGGRQCEGNDIHIDFCNNEPC--PIHGNWGPWNSWGSCSRTCNGGQMR----RYRTCDNPRPANGGRACTGSDSQIQKCN-TANCPVDGKWSSWESWGECSA----SCGGGERTRVRLCNSPSPSNSGRPCPGDSTQLSRC 4841          

HSP 2 Score: 137.117 bits (344), Expect = 2.137e-33
Identity = 76/190 (40.00%), Postives = 98/190 (51.58%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPV 963
            PV G WG+W  WS CS TC       G+ TR RLCN+PPP   G +C G  T+T  C    CPV   G WS W  W ACS +C        + R+R+C NP P+ GG +C+G  ++  FC+  P CPI G WG W   G C     ++C  G  R  R C+ P P   G+ C G   +++ C     CPV
Sbjct: 4619 PVAGNWGAWLPWSPCSETCGK-----GMQTRLRLCNNPPPSFEGPSCEGPDTQTQVCNERNCPV--DGKWSSWVSWGACSVSC----GGGTRQRTRICANPTPQHGGRQCEGNDIHIDFCNNEP-CPIHGNWGPWNSWGSCS----RTCNGGQMRRYRTCDNPRPANGGRACTGSDSQIQKC-NTANCPV 4791          

HSP 3 Score: 115.161 bits (287), Expect = 3.040e-26
Identity = 72/182 (39.56%), Postives = 93/182 (51.10%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDC 939
            PVDG W  W++W +CS TC       G  TR R C++PP Q GG+ C G   E   C   PCPV   GNW  W  WS CS+TC       +Q R RLCNNP P   G  C+G    ++ C+    CP+DG+W  W   G C      SC  G+++  R C  P+P   G+ CEG    ++ C
Sbjct: 4562 PVDGSWSEWSSWEECSRTCGQ-----GNRTRVRTCSNPPAQHGGRACEGKAVEAIMCSIRPCPVA--GNWGAWLPWSPCSETC----GKGMQTRLRLCNNPPPSFEGPSCEGPDTQTQVCNER-NCPVDGKWSSWVSWGACSV----SCGGGTRQRTRICANPTPQHGGRQCEGNDIHIDFC 4727          

HSP 4 Score: 109.383 bits (272), Expect = 2.362e-24
Identity = 68/181 (37.57%), Postives = 93/181 (51.38%), Query Frame = 1
Query:  397 VDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDC 939
            V G +  W  W  CS++C +     G+  R R CN P P  GG++C G  +ET  C   PCPV   G+WSEWS W  CS+TC        + R R C+NP  + GG  C+G+++ +  C   P CP+ G WG W    PC     ++C  G Q   R CN P P+ +G  CEG   + + C
Sbjct: 4506 VHGGFSEWMEWGACSVSCGT-----GVQRRLRQCNKPFPANGGRHCVGSASETRRCQGKPCPV--DGSWSEWSSWEECSRTCGQGN----RTRVRTCSNPPAQHGGRACEGKAVEAIMCSIRP-CPVAGNWGAWLPWSPCS----ETCGKGMQTRLRLCNNPPPSFEGPSCEGPDTQTQVC 4670          

HSP 5 Score: 92.0485 bits (227), Expect = 7.786e-19
Identity = 52/139 (37.41%), Postives = 68/139 (48.92%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAG 810
            P+ G WG W +W  CS TC+      G M R+R C++P P  GG+ CTG  ++   C  + CPV   G WS W  W  CS +C        + R RLCN+P P + G  C G+S     C+  P CP   Q     I G
Sbjct: 4733 PIHGNWGPWNSWGSCSRTCNG-----GQMRRYRTCDNPRPANGGRACTGSDSQIQKCNTANCPV--DGKWSSWESWGECSASC----GGGERTRVRLCNSPSPSNSGRPCPGDSTQLSRCNLQP-CPGGPQKARGSIIG 4859          

HSP 6 Score: 72.7886 bits (177), Expect = 8.017e-13
Identity = 43/111 (38.74%), Postives = 57/111 (51.35%), Query Frame = 1
Query:  583 VPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEG 915
            V +HG +SEW EW ACS +C       +Q R R CN P P +GG  C G +  +R C   P CP+DG W EW     C     ++C  G++   R C+ P     G+ CEG
Sbjct: 4504 VRVHGGFSEWMEWGACSVSC----GTGVQRRLRQCNKPFPANGGRHCVGSASETRRCQGKP-CPVDGSWSEWSSWEECS----RTCGQGNRTRVRTCSNPPAQHGGRACEG 4605          

HSP 7 Score: 61.6178 bits (148), Expect = 1.963e-9
Identity = 29/53 (54.72%), Postives = 35/53 (66.04%), Query Frame = 1
Query: 1300 VDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            VDGKWSSW  W +CSA C    G RTR R CN+PSP + G+PC G+S +   C
Sbjct: 4791 VDGKWSSWESWGECSASCG--GGERTRVRLCNSPSPSNSGRPCPGDSTQLSRC 4841          

HSP 8 Score: 58.5362 bits (140), Expect = 1.835e-8
Identity = 30/65 (46.15%), Postives = 35/65 (53.85%), Query Frame = 1
Query:  388 NEPVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCP 582
            N PVDG W SW +W +CS +C       G  TR RLCNSP P   G+ C G  T+   C   PCP
Sbjct: 4788 NCPVDGKWSSWESWGECSASCGG-----GERTRVRLCNSPSPSNSGRPCPGDSTQLSRCNLQPCP 4847          

HSP 9 Score: 55.4546 bits (132), Expect = 1.557e-7
Identity = 25/46 (54.35%), Postives = 28/46 (60.87%), Query Frame = 1
Query: 1300 VDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGN 1437
            VDGKWSSW  W  CS  C    G R R R C NP+P+ GG+ C GN
Sbjct: 4677 VDGKWSSWVSWGACSVSCG--GGTRQRTRICANPTPQHGGRQCEGN 4720          
BLAST of Hemicentin-1 vs. Ensembl Zebrafish
Match: thbs2b (thrombospondin 2b [Source:ZFIN;Acc:ZDB-GENE-100623-1])

HSP 1 Score: 117.472 bits (293), Expect = 3.866e-27
Identity = 62/128 (48.44%), Postives = 77/128 (60.16%), Query Frame = 1
Query:  400 DGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDG 783
            DG W  W+ WS CS+TC       GL+TR R CN+P PQ GGK+C G   ET +C   PC  PI G W  WS W+ACS TC       L+ R R CN+P P+ GG KC G+S+ +  C+ L +CPIDG
Sbjct:  446 DGGWSLWSPWSSCSVTCGE-----GLITRIRHCNAPVPQRGGKDCEGEGRETQSCHTDPC--PIDGGWGPWSPWAACSATC----GGGLKSRVRECNSPEPQHGGRKCLGDSIENEVCNRL-ECPIDG 561          

HSP 2 Score: 62.003 bits (149), Expect = 1.532e-9
Identity = 29/64 (45.31%), Postives = 36/64 (56.25%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPV 585
            P+DG WG W+ W+ CS TC       GL +R R CNSP PQ GG+ C G   E + C    CP+
Sbjct:  501 PIDGGWGPWSPWAACSATCGG-----GLKSRVRECNSPEPQHGGRKCLGDSIENEVCNRLECPI 559          

HSP 3 Score: 60.4622 bits (145), Expect = 4.533e-9
Identity = 50/180 (27.78%), Postives = 66/180 (36.67%), Query Frame = 1
Query:  580 PVPIHGNWSEWSEWSACSKTC-----------------------------------RLPQSA-----------------PLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPV 963
            P+     WS WSEW+ C+ TC                                   R+ Q                    L  R R CN PVP+ GG  C+GE   ++ C   P CPIDG WG W     C +    +C  G +   R+CN P P   G+ C G   + E C   + CP+
Sbjct:  386 PMDSEDGWSPWSEWTQCTVTCGSGTQQRGRSCDDTSNTCSGPSIQTRKCSLGKCDRRVRQDGGWSLWSPWSSCSVTCGEGLITRIRHCNAPVPQRGGKDCEGEGRETQSCHTDP-CPIDGGWGPWSPWAACSA----TCGGGLKSRVRECNSPEPQHGGRKCLGDSIENEVC-NRLECPI 559          

HSP 4 Score: 51.9878 bits (123), Expect = 1.923e-6
Identity = 27/53 (50.94%), Postives = 30/53 (56.60%), Query Frame = 1
Query: 1303 DGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSCY 1461
            DG WS WS WS CS  C +  G  TR R CN P P+ GGK C G   E  SC+
Sbjct:  446 DGGWSLWSPWSSCSVTCGE--GLITRIRHCNAPVPQRGGKDCEGEGRETQSCH 496          

HSP 5 Score: 50.8322 bits (120), Expect = 3.820e-6
Identity = 24/53 (45.28%), Postives = 33/53 (62.26%), Query Frame = 1
Query: 1300 VDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            +DG W  WS W+ CSA C    G ++R R+CN+P P+ GG+ C G+S E   C
Sbjct:  502 IDGGWGPWSPWAACSATCG--GGLKSRVRECNSPEPQHGGRKCLGDSIENEVC 552          
BLAST of Hemicentin-1 vs. Ensembl Zebrafish
Match: thbs2b (thrombospondin 2b [Source:ZFIN;Acc:ZDB-GENE-100623-1])

HSP 1 Score: 117.087 bits (292), Expect = 4.291e-27
Identity = 62/128 (48.44%), Postives = 77/128 (60.16%), Query Frame = 1
Query:  400 DGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDG 783
            DG W  W+ WS CS+TC       GL+TR R CN+P PQ GGK+C G   ET +C   PC  PI G W  WS W+ACS TC       L+ R R CN+P P+ GG KC G+S+ +  C+ L +CPIDG
Sbjct:  419 DGGWSLWSPWSSCSVTCGE-----GLITRIRHCNAPVPQRGGKDCEGEGRETQSCHTDPC--PIDGGWGPWSPWAACSATC----GGGLKSRVRECNSPEPQHGGRKCLGDSIENEVCNRL-ECPIDG 534          

HSP 2 Score: 62.003 bits (149), Expect = 1.582e-9
Identity = 29/64 (45.31%), Postives = 36/64 (56.25%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPV 585
            P+DG WG W+ W+ CS TC       GL +R R CNSP PQ GG+ C G   E + C    CP+
Sbjct:  474 PIDGGWGPWSPWAACSATCGG-----GLKSRVRECNSPEPQHGGRKCLGDSIENEVCNRLECPI 532          

HSP 3 Score: 51.9878 bits (123), Expect = 1.888e-6
Identity = 27/53 (50.94%), Postives = 30/53 (56.60%), Query Frame = 1
Query: 1303 DGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSCY 1461
            DG WS WS WS CS  C +  G  TR R CN P P+ GGK C G   E  SC+
Sbjct:  419 DGGWSLWSPWSSCSVTCGE--GLITRIRHCNAPVPQRGGKDCEGEGRETQSCH 469          

HSP 4 Score: 50.8322 bits (120), Expect = 3.655e-6
Identity = 24/53 (45.28%), Postives = 33/53 (62.26%), Query Frame = 1
Query: 1300 VDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            +DG W  WS W+ CSA C    G ++R R+CN+P P+ GG+ C G+S E   C
Sbjct:  475 IDGGWGPWSPWAACSATCG--GGLKSRVRECNSPEPQHGGRKCLGDSIENEVC 525          
BLAST of Hemicentin-1 vs. Ensembl Zebrafish
Match: sema5ba (sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5Ba [Source:ZFIN;Acc:ZDB-GENE-070912-187])

HSP 1 Score: 112.464 bits (280), Expect = 1.392e-25
Identity = 97/362 (26.80%), Postives = 141/362 (38.95%), Query Frame = 1
Query:  388 NEPVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPVTLQ-----PPLNLHLTGNGSGLFNVSWSSVPYGKLASTYRIYKTIEDESNREIKTNYEDHNALPNKKITSMNYWAIIDLRNLLSLNTFQTLAVRMSSIDFWKEESSLSNPVRSKVRAVDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            N+  DG +G W  W  CS      +     + R R+CNSPPP+ GGKNC G   E  NC         +G W+ WS W  CS +C +      +VR R CNNP P+ GG  C G+S   RFC+    CP    W  W     C +     C  G     R C       +G  C G   + + C     CP   +     P + +++T  G          +   +LA  + +         R+++T +      PN  + +    ++++          +   VR+S                         WSSW  WS C+ +C K  GYRTR R C N   ++    C G+  E   C
Sbjct:  559 NQTTDGAYGPWAPWQPCSH--DDGEGTSTCLCRSRVCNSPPPRCGGKNCQGPTIEVSNCSR-------NGGWTPWSSWGQCSTSCEIG----FEVRQRSCNNPSPRHGGRVCVGQSREQRFCNEKVSCPQPIFWSSWSPWSKCSA----DCGGGVHSRSRNCE------NGNSCPGCALEYQAC-NLESCPEVRRNTPWTPWMPVNIT-QGGARQEQRVRYICRAQLADPHEL-----QLGKRKVETRF-----CPNDGMVTCETDSLVE-------ELLRMPGVRLSGTG----------------------WSSWEMWSACTQECAK--GYRTRKRSCTNTDGKNIPTACRGSPVEYQDC 854          
BLAST of Hemicentin-1 vs. Ensembl Xenopus
Match: eftud2 (elongation factor Tu GTP binding domain containing 2 [Source:Xenbase;Acc:XB-GENE-972643])

HSP 1 Score: 132.88 bits (333), Expect = 6.926e-32
Identity = 77/190 (40.53%), Postives = 97/190 (51.05%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPV 963
            PVDG W  W+TW +CS +C S     G  TR R C+ PP Q GGK C G   +   C   PCPV  HG W  W  W AC+KTC        ++R RLCNNP P   GL C+G+    + C    QCP+DG+W  W     C      SC  G ++  R C+ P+P   G  CEG + + E C   + CPV
Sbjct: 4465 PVDGNWSEWSTWEECSRSCGS-----GKRTRVRTCSDPPAQEGGKPCIGKAVDVAVCNVKPCPV--HGMWGPWQSWGACTKTCW----KGTKMRVRLCNNPTPSPDGLPCEGQDTQMQICGDR-QCPVDGKWSAWGSWTSC----SLSCGGGLRQRTRACSNPAPQYGGHKCEGNEHENEMCNADL-CPV 4637          

HSP 2 Score: 132.494 bits (332), Expect = 1.024e-31
Identity = 71/181 (39.23%), Postives = 99/181 (54.70%), Query Frame = 1
Query:  397 VDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDC 939
            V G +  W  W  CS+TC       G+  R RLC++P P  GG  C G  TET +C N  CPV   GNWSEWS W  CS++C     +  + R R C++P  ++GG  C G++++   C+  P CP+ G WG W   G C     K+C  G++   R CN P+P+ DG PCEG   +++ C
Sbjct: 4409 VHGGFSEWLPWQSCSVTCGQ-----GIQRRIRLCDNPLPANGGNYCQGAETETRSCQNKLCPV--DGNWSEWSTWEECSRSC----GSGKRTRVRTCSDPPAQEGGKPCIGKAVDVAVCNVKP-CPVHGMWGPWQSWGAC----TKTCWKGTKMRVRLCNNPTPSPDGLPCEGQDTQMQIC 4573          

HSP 3 Score: 123.25 bits (308), Expect = 9.607e-29
Identity = 69/182 (37.91%), Postives = 88/182 (48.35%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDC 939
            PVDG W +W +W+ CS++C       GL  R R C++P PQ GG  C G   E + C    CPV  HGNW  WS W +CS+TC   Q      R R C+NP P   G  C G    +  C+    CP  G WG+W     C      SC  G Q   R C+ P+ +  G+PC G   +L  C
Sbjct: 4579 PVDGKWSAWGSWTSCSLSCGG-----GLRQRTRACSNPAPQYGGHKCEGNEHENEMCNADLCPV--HGNWGPWSHWGSCSRTCNGGQMR----RYRACDNPAPSHSGRACTGTDTETNKCN-TDLCPAHGNWGQWEAWSKCSV----SCGGGEQIRTRVCHHPARSYTGRPCPGDSTQLLRC 4744          

HSP 4 Score: 93.9745 bits (232), Expect = 2.653e-19
Identity = 50/127 (39.37%), Postives = 67/127 (52.76%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCP 774
            PV G WG W+ W  CS TC+      G M R+R C++P P   G+ CTG  TET+ C    CP   HGNW +W  WS CS +C        Q+R+R+C++P     G  C G+S     C+ +  CP
Sbjct: 4636 PVHGNWGPWSHWGSCSRTCNG-----GQMRRYRACDNPAPSHSGRACTGTDTETNKCNTDLCPA--HGNWGQWEAWSKCSVSC----GGGEQIRTRVCHHPARSYTGRPCPGDSTQLLRCN-VQACP 4750          

HSP 5 Score: 82.0333 bits (201), Expect = 1.566e-15
Identity = 44/111 (39.64%), Postives = 56/111 (50.45%), Query Frame = 1
Query:  583 VPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEG 915
            V +HG +SEW  W +CS TC       +Q R RLC+NP+P +GG  C G    +R C     CP+DG W EW     C     +SC  G +   R C+ P     GKPC G
Sbjct: 4407 VQVHGGFSEWLPWQSCSVTC----GQGIQRRIRLCDNPLPANGGNYCQGAETETRSCQN-KLCPVDGNWSEWSTWEEC----SRSCGSGKRTRVRTCSDPPAQEGGKPCIG 4508          

HSP 6 Score: 58.5362 bits (140), Expect = 2.590e-8
Identity = 26/53 (49.06%), Postives = 31/53 (58.49%), Query Frame = 1
Query: 1300 VDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            VDGKWS+W  W+ CS  C    G R R R C+NP+P+ GG  C GN  E   C
Sbjct: 4580 VDGKWSAWGSWTSCSLSCG--GGLRQRTRACSNPAPQYGGHKCEGNEHENEMC 4630          

HSP 7 Score: 55.8398 bits (133), Expect = 1.901e-7
Identity = 26/59 (44.07%), Postives = 37/59 (62.71%), Query Frame = 1
Query: 1282 RSKVRAVDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            ++K+  VDG WS WS W +CS  C   +G RTR R C++P  ++GGKPC G + +   C
Sbjct: 4460 QNKLCPVDGNWSEWSTWEECSRSCG--SGKRTRVRTCSDPPAQEGGKPCIGKAVDVAVC 4516          
BLAST of Hemicentin-1 vs. Ensembl Xenopus
Match: eftud2 (elongation factor Tu GTP binding domain containing 2 [Source:Xenbase;Acc:XB-GENE-972643])

HSP 1 Score: 132.88 bits (333), Expect = 7.183e-32
Identity = 77/190 (40.53%), Postives = 97/190 (51.05%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPV 963
            PVDG W  W+TW +CS +C S     G  TR R C+ PP Q GGK C G   +   C   PCPV  HG W  W  W AC+KTC        ++R RLCNNP P   GL C+G+    + C    QCP+DG+W  W     C      SC  G ++  R C+ P+P   G  CEG + + E C   + CPV
Sbjct: 4466 PVDGNWSEWSTWEECSRSCGS-----GKRTRVRTCSDPPAQEGGKPCIGKAVDVAVCNVKPCPV--HGMWGPWQSWGACTKTCW----KGTKMRVRLCNNPTPSPDGLPCEGQDTQMQICGDR-QCPVDGKWSAWGSWTSC----SLSCGGGLRQRTRACSNPAPQYGGHKCEGNEHENEMCNADL-CPV 4638          

HSP 2 Score: 132.109 bits (331), Expect = 1.112e-31
Identity = 71/181 (39.23%), Postives = 99/181 (54.70%), Query Frame = 1
Query:  397 VDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDC 939
            V G +  W  W  CS+TC       G+  R RLC++P P  GG  C G  TET +C N  CPV   GNWSEWS W  CS++C     +  + R R C++P  ++GG  C G++++   C+  P CP+ G WG W   G C     K+C  G++   R CN P+P+ DG PCEG   +++ C
Sbjct: 4410 VHGGFSEWLPWQSCSVTCGQ-----GIQRRIRLCDNPLPANGGNYCQGAETETRSCQNKLCPV--DGNWSEWSTWEECSRSC----GSGKRTRVRTCSDPPAQEGGKPCIGKAVDVAVCNVKP-CPVHGMWGPWQSWGAC----TKTCWKGTKMRVRLCNNPTPSPDGLPCEGQDTQMQIC 4574          

HSP 3 Score: 123.25 bits (308), Expect = 1.023e-28
Identity = 69/182 (37.91%), Postives = 88/182 (48.35%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDC 939
            PVDG W +W +W+ CS++C       GL  R R C++P PQ GG  C G   E + C    CPV  HGNW  WS W +CS+TC   Q      R R C+NP P   G  C G    +  C+    CP  G WG+W     C      SC  G Q   R C+ P+ +  G+PC G   +L  C
Sbjct: 4580 PVDGKWSAWGSWTSCSLSCGG-----GLRQRTRACSNPAPQYGGHKCEGNEHENEMCNADLCPV--HGNWGPWSHWGSCSRTCNGGQMR----RYRACDNPAPSHSGRACTGTDTETNKCN-TDLCPAHGNWGQWEAWSKCSV----SCGGGEQIRTRVCHHPARSYTGRPCPGDSTQLLRC 4745          

HSP 4 Score: 93.5893 bits (231), Expect = 2.922e-19
Identity = 50/127 (39.37%), Postives = 67/127 (52.76%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCP 774
            PV G WG W+ W  CS TC+      G M R+R C++P P   G+ CTG  TET+ C    CP   HGNW +W  WS CS +C        Q+R+R+C++P     G  C G+S     C+ +  CP
Sbjct: 4637 PVHGNWGPWSHWGSCSRTCNG-----GQMRRYRACDNPAPSHSGRACTGTDTETNKCNTDLCPA--HGNWGQWEAWSKCSVSC----GGGEQIRTRVCHHPARSYTGRPCPGDSTQLLRCN-VQACP 4751          

HSP 5 Score: 82.0333 bits (201), Expect = 1.552e-15
Identity = 44/111 (39.64%), Postives = 56/111 (50.45%), Query Frame = 1
Query:  583 VPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEG 915
            V +HG +SEW  W +CS TC       +Q R RLC+NP+P +GG  C G    +R C     CP+DG W EW     C     +SC  G +   R C+ P     GKPC G
Sbjct: 4408 VQVHGGFSEWLPWQSCSVTC----GQGIQRRIRLCDNPLPANGGNYCQGAETETRSCQN-KLCPVDGNWSEWSTWEEC----SRSCGSGKRTRVRTCSDPPAQEGGKPCIG 4509          

HSP 6 Score: 58.5362 bits (140), Expect = 2.524e-8
Identity = 26/53 (49.06%), Postives = 31/53 (58.49%), Query Frame = 1
Query: 1300 VDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            VDGKWS+W  W+ CS  C    G R R R C+NP+P+ GG  C GN  E   C
Sbjct: 4581 VDGKWSAWGSWTSCSLSCG--GGLRQRTRACSNPAPQYGGHKCEGNEHENEMC 4631          

HSP 7 Score: 55.8398 bits (133), Expect = 1.967e-7
Identity = 26/59 (44.07%), Postives = 37/59 (62.71%), Query Frame = 1
Query: 1282 RSKVRAVDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            ++K+  VDG WS WS W +CS  C   +G RTR R C++P  ++GGKPC G + +   C
Sbjct: 4461 QNKLCPVDGNWSEWSTWEECSRSCG--SGKRTRVRTCSDPPAQEGGKPCIGKAVDVAVC 4517          
BLAST of Hemicentin-1 vs. Ensembl Xenopus
Match: eftud2 (elongation factor Tu GTP binding domain containing 2 [Source:Xenbase;Acc:XB-GENE-972643])

HSP 1 Score: 132.88 bits (333), Expect = 7.797e-32
Identity = 77/190 (40.53%), Postives = 97/190 (51.05%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPV 963
            PVDG W  W+TW +CS +C S     G  TR R C+ PP Q GGK C G   +   C   PCPV  HG W  W  W AC+KTC        ++R RLCNNP P   GL C+G+    + C    QCP+DG+W  W     C      SC  G ++  R C+ P+P   G  CEG + + E C   + CPV
Sbjct: 4505 PVDGNWSEWSTWEECSRSCGS-----GKRTRVRTCSDPPAQEGGKPCIGKAVDVAVCNVKPCPV--HGMWGPWQSWGACTKTCW----KGTKMRVRLCNNPTPSPDGLPCEGQDTQMQICGDR-QCPVDGKWSAWGSWTSC----SLSCGGGLRQRTRACSNPAPQYGGHKCEGNEHENEMCNADL-CPV 4677          

HSP 2 Score: 132.109 bits (331), Expect = 1.122e-31
Identity = 71/181 (39.23%), Postives = 99/181 (54.70%), Query Frame = 1
Query:  397 VDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDC 939
            V G +  W  W  CS+TC       G+  R RLC++P P  GG  C G  TET +C N  CPV   GNWSEWS W  CS++C     +  + R R C++P  ++GG  C G++++   C+  P CP+ G WG W   G C     K+C  G++   R CN P+P+ DG PCEG   +++ C
Sbjct: 4449 VHGGFSEWLPWQSCSVTCGQ-----GIQRRIRLCDNPLPANGGNYCQGAETETRSCQNKLCPV--DGNWSEWSTWEECSRSC----GSGKRTRVRTCSDPPAQEGGKPCIGKAVDVAVCNVKP-CPVHGMWGPWQSWGAC----TKTCWKGTKMRVRLCNNPTPSPDGLPCEGQDTQMQIC 4613          

HSP 3 Score: 123.25 bits (308), Expect = 1.023e-28
Identity = 69/182 (37.91%), Postives = 88/182 (48.35%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDC 939
            PVDG W +W +W+ CS++C       GL  R R C++P PQ GG  C G   E + C    CPV  HGNW  WS W +CS+TC   Q      R R C+NP P   G  C G    +  C+    CP  G WG+W     C      SC  G Q   R C+ P+ +  G+PC G   +L  C
Sbjct: 4619 PVDGKWSAWGSWTSCSLSCGG-----GLRQRTRACSNPAPQYGGHKCEGNEHENEMCNADLCPV--HGNWGPWSHWGSCSRTCNGGQMR----RYRACDNPAPSHSGRACTGTDTETNKCN-TDLCPAHGNWGQWEAWSKCSV----SCGGGEQIRTRVCHHPARSYTGRPCPGDSTQLLRC 4784          

HSP 4 Score: 93.5893 bits (231), Expect = 2.973e-19
Identity = 50/127 (39.37%), Postives = 67/127 (52.76%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCP 774
            PV G WG W+ W  CS TC+      G M R+R C++P P   G+ CTG  TET+ C    CP   HGNW +W  WS CS +C        Q+R+R+C++P     G  C G+S     C+ +  CP
Sbjct: 4676 PVHGNWGPWSHWGSCSRTCNG-----GQMRRYRACDNPAPSHSGRACTGTDTETNKCNTDLCPA--HGNWGQWEAWSKCSVSC----GGGEQIRTRVCHHPARSYTGRPCPGDSTQLLRCN-VQACP 4790          

HSP 5 Score: 82.0333 bits (201), Expect = 1.539e-15
Identity = 44/111 (39.64%), Postives = 56/111 (50.45%), Query Frame = 1
Query:  583 VPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEG 915
            V +HG +SEW  W +CS TC       +Q R RLC+NP+P +GG  C G    +R C     CP+DG W EW     C     +SC  G +   R C+ P     GKPC G
Sbjct: 4447 VQVHGGFSEWLPWQSCSVTC----GQGIQRRIRLCDNPLPANGGNYCQGAETETRSCQN-KLCPVDGNWSEWSTWEEC----SRSCGSGKRTRVRTCSDPPAQEGGKPCIG 4548          

HSP 6 Score: 58.5362 bits (140), Expect = 2.590e-8
Identity = 26/53 (49.06%), Postives = 31/53 (58.49%), Query Frame = 1
Query: 1300 VDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            VDGKWS+W  W+ CS  C    G R R R C+NP+P+ GG  C GN  E   C
Sbjct: 4620 VDGKWSAWGSWTSCSLSCG--GGLRQRTRACSNPAPQYGGHKCEGNEHENEMC 4670          

HSP 7 Score: 55.8398 bits (133), Expect = 1.967e-7
Identity = 26/59 (44.07%), Postives = 37/59 (62.71%), Query Frame = 1
Query: 1282 RSKVRAVDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            ++K+  VDG WS WS W +CS  C   +G RTR R C++P  ++GGKPC G + +   C
Sbjct: 4500 QNKLCPVDGNWSEWSTWEECSRSCG--SGKRTRVRTCSDPPAQEGGKPCIGKAVDVAVC 4556          
BLAST of Hemicentin-1 vs. Ensembl Xenopus
Match: SEMA5B (semaphorin 5B [Source:NCBI gene;Acc:100493363])

HSP 1 Score: 125.561 bits (314), Expect = 8.938e-30
Identity = 101/363 (27.82%), Postives = 141/363 (38.84%), Query Frame = 1
Query:  388 NEPVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDC------WFFIGCPVTLQPPLNLHLTGNGSGLFNVSWSSVPYGKLASTYRIYKTIEDESNREIKTNYEDHNALPNKKITSMNYWAIIDLRNLLSLNTFQTLAVRMSSIDFWKEESSLSNPVRSKVRAVDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            N  V G  G W++W  C  +    D     + R R+C++P P+ GG++C G   E  NC         +G W+ WS W+ CS +C +      QVR R C+NP P+ GG  C G+S   RFC+    CP+   W  W     C S     C  G+   QR C       +G  C G   +   C            P T   P+N+   G                +    Y     + D  N +      +    PN    +     ++D                            L    ++  R V G WS WS WS CS +C  E G+RTR R C+NP PR+GG PC G++ E   C
Sbjct:  210 NLTVHGGLGPWSSWQPCQHS----DGDSSCLCRSRVCDNPLPRCGGRDCDGTRIEIANCSR-------NGGWTPWSSWAQCSTSCGIG----FQVRQRTCSNPAPRFGGRVCVGQSREERFCNENSPCPVPIFWTSWGSWTKCSS----DCGGGTHSRQRSCE------NGNTCPGCAMEFRPCNSEPCPEVRRNTPWTPWTPVNITQGGARQ-------------EQRFRYTCRAQLADPHNLQFGRKKTETRFCPNDGSAACETDTLVD---------------------------DLMRNSKTPGRTVSGGWSPWSGWSSCSREC--ELGFRTRKRTCSNPEPRNGGLPCAGSAMEYQDC 505          

HSP 2 Score: 91.2781 bits (225), Expect = 1.138e-18
Identity = 83/275 (30.18%), Postives = 112/275 (40.73%), Query Frame = 1
Query:  337 VACMTSHRVSPYI--AIAPNEPVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPVTL-QPPLNLHLTGNGSGLFNVSWSSVP--YGKLASTYRIYKTIEDESNREIKTNYEDHNALPNK 1146
             AC T   V   +  +  P   V G W  W+ WS CS  C     + G  TR R C++P P+ GG  C G   E  +C   PCPV   G+WS WS W+ CS TC          R+R C NP P +GG  C G       C+     P +G W EW     C          GSQ   R C   +P      C G   +  DC  +   PV L    ++ +    G  L ++  + V   +G    T+ IY   +    R+ + +   H A PN 
Sbjct:  433 AACETDTLVDDLMRNSKTPGRTVSGGWSPWSGWSSCSREC-----ELGFRTRKRTCSNPEPRNGGLPCAGSAMEYQDCNPQPCPV--KGSWSCWSPWTQCSATC----GGGHYQRTRTCTNPPPSNGGDICIGLHTEEALCNTY---PCEGGWAEWSEWSMCHED-------GSQYRNRYCEIHNPGP--TQCLGNSTQFRDC-IYNEIPVILPASSIDENSECGGFSLIHLIATGVSCFFGSSLLTFVIYVYCQ-RCQRQSQESTVIHPATPNH 682          
BLAST of Hemicentin-1 vs. Ensembl Xenopus
Match: THBS2 (thrombospondin 2 [Source:NCBI gene;Acc:100494997])

HSP 1 Score: 122.865 bits (307), Expect = 9.828e-29
Identity = 67/128 (52.34%), Postives = 76/128 (59.38%), Query Frame = 1
Query:  400 DGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDG 783
            DG W  W+ WS CS+TC       G +TR RLCNSP PQLGGKNCTG   ET  C   PC  PI+G W  WS WS+C+ TC       L+ RSRLCNNP P+ GG KC GE      C+    CPIDG
Sbjct:  387 DGGWSHWSPWSACSVTCG-----IGNITRIRLCNSPKPQLGGKNCTGAGRETKQCEGIPC--PINGKWGPWSPWSSCTVTC----GGGLRERSRLCNNPKPQYGGKKCGGEPKEKEMCNK-QDCPIDG 502          

HSP 2 Score: 96.6709 bits (239), Expect = 2.612e-20
Identity = 64/179 (35.75%), Postives = 85/179 (47.49%), Query Frame = 1
Query:  409 WGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIH--GNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDC 939
            W  W+ W++CS+TC S     G   R R C++        +C G   +T  C    C   I   G WS WS WSACS TC +        R RLCN+P P+ GG  C G    ++ C+ +P CPI+G+WG W     C      +C  G +   R CN P P   GK C G  ++ E C
Sbjct:  334 WSPWSEWTECSVTCGS-----GTQQRGRSCDAT-----SSSCEGSSIQTRTCNLGKCDNRIRQDGGWSHWSPWSACSVTCGIGNI----TRIRLCNSPKPQLGGKNCTGAGRETKQCEGIP-CPINGKWGPWSPWSSCTV----TCGGGLRERSRLCNNPKPQYGGKKCGGEPKEKEMC 493          

HSP 3 Score: 63.5438 bits (153), Expect = 7.106e-10
Identity = 29/64 (45.31%), Postives = 37/64 (57.81%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPV 585
            P++G WG W+ WS C++TC       GL  R RLCN+P PQ GGK C G   E + C    CP+
Sbjct:  442 PINGKWGPWSPWSSCTVTCGG-----GLRERSRLCNNPKPQYGGKKCGGEPKEKEMCNKQDCPI 500          

HSP 4 Score: 53.5286 bits (127), Expect = 8.032e-7
Identity = 26/53 (49.06%), Postives = 32/53 (60.38%), Query Frame = 1
Query: 1300 VDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            ++GKW  WS WS C+  C    G R R+R CNNP P+ GGK C G  +EK  C
Sbjct:  443 INGKWGPWSPWSSCTVTCG--GGLRERSRLCNNPKPQYGGKKCGGEPKEKEMC 493          
BLAST of Hemicentin-1 vs. Ensembl Mouse
Match: Hmcn1 (hemicentin 1 [Source:MGI Symbol;Acc:MGI:2685047])

HSP 1 Score: 132.88 bits (333), Expect = 4.801e-32
Identity = 74/190 (38.95%), Postives = 101/190 (53.16%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPV 963
            PV G+W +W  WS CS +C       G  TR RLCN+PPP  GG +C+G  T+   C    CPV   G W+ WS WSAC+ +C        + R+R C++PVP+ GG KC+G  + S FC+  P CP  G W  W   G C     ++C  G  R  R C+ P P+  G+ C G   +++ C   + CPV
Sbjct: 4640 PVHGVWNAWQPWSACSKSCGK-----GSQTRMRLCNNPPPSFGGAHCSGAETQMQVCNERHCPV--DGRWATWSSWSACTVSC----GGGARKRTRDCSDPVPQYGGNKCEGTGVQSDFCNSDP-CPTHGNWSPWSGWGTCS----RTCNGGQMRRYRTCDNPRPSNGGRACGGPDTQIQRCNTDM-CPV 4812          

HSP 2 Score: 130.568 bits (327), Expect = 2.777e-31
Identity = 69/182 (37.91%), Postives = 92/182 (50.55%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDC 939
            PVDG W +W++WS C+++C       G   R R C+ P PQ GG  C G   ++D C + PCP   HGNWS WS W  CS+TC   Q      R R C+NP P +GG  C G     + C+    CP+DG WG W+    C      SC  G +  +R C+ P P   G+ C G   ++  C
Sbjct: 4697 PVDGRWATWSSWSACTVSCGG-----GARKRTRDCSDPVPQYGGNKCEGTGVQSDFCNSDPCPT--HGNWSPWSGWGTCSRTCNGGQ----MRRYRTCDNPRPSNGGRACGGPDTQIQRCN-TDMCPVDGSWGTWHSWSHCSV----SCGGGERTRKRLCDNPVPTKGGRSCPGDATQVSRC 4862          

HSP 3 Score: 130.183 bits (326), Expect = 3.646e-31
Identity = 73/182 (40.11%), Postives = 91/182 (50.00%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDC 939
            PVDG W  W+ W  CS +C      +G  TR R C++PP Q GG+ C G   ET  C   PCPV  HG W+ W  WSACSK+C        Q R RLCNNP P  GG  C G     + C+    CP+DG+W  W     C      SC  G+++  R C+ P P   G  CEG   + + C
Sbjct: 4583 PVDGHWSEWSFWEDCSRSCG-----HGNQTRTRTCSNPPAQHGGRPCEGHAVETIMCNIRPCPV--HGVWNAWQPWSACSKSC----GKGSQTRMRLCNNPPPSFGGAHCSGAETQMQVCNER-HCPVDGRWATWSSWSACTV----SCGGGARKRTRDCSDPVPQYGGNKCEGTGVQSDFC 4748          

HSP 4 Score: 127.487 bits (319), Expect = 3.247e-30
Identity = 69/181 (38.12%), Postives = 95/181 (52.49%), Query Frame = 1
Query:  397 VDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDC 939
            V G +  W+ W  CS+TC       G+  R RLC++PPP  GG+ C G  +E  +C N  CPV   G+WSEWS W  CS++C        Q R+R C+NP  + GG  C+G ++ +  C+  P CP+ G W  W     C     KSC  GSQ   R CN P P+  G  C G + +++ C
Sbjct: 4527 VHGGFSLWSAWRPCSVTCGK-----GIQKRSRLCDNPPPANGGRPCQGADSEARHCHNKLCPV--DGHWSEWSFWEDCSRSCGHGN----QTRTRTCSNPPAQHGGRPCEGHAVETIMCNIRP-CPVHGVWNAWQPWSACS----KSCGKGSQTRMRLCNNPPPSFGGAHCSGAETQMQVC 4691          

HSP 5 Score: 88.1965 bits (217), Expect = 1.138e-17
Identity = 47/114 (41.23%), Postives = 59/114 (51.75%), Query Frame = 1
Query:  574 PCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEG 915
            P  V +HG +S WS W  CS TC       +Q RSRLC+NP P +GG  C G    +R C +   CP+DG W EW     C     +SC  G+Q   R C+ P     G+PCEG
Sbjct: 4522 PVIVQVHGGFSLWSAWRPCSVTC----GKGIQKRSRLCDNPPPANGGRPCQGADSEARHC-HNKLCPVDGHWSEWSFWEDCS----RSCGHGNQTRTRTCSNPPAQHGGRPCEG 4626          

HSP 6 Score: 88.1965 bits (217), Expect = 1.286e-17
Identity = 50/139 (35.97%), Postives = 66/139 (47.48%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAG 810
            P  G W  W+ W  CS TC+      G M R+R C++P P  GG+ C G  T+   C    CPV   G+W  W  WS CS +C        + R RLC+NPVP  GG  C G++     C+ +  CP   Q     + G
Sbjct: 4754 PTHGNWSPWSGWGTCSRTCNG-----GQMRRYRTCDNPRPSNGGRACGGPDTQIQRCNTDMCPV--DGSWGTWHSWSHCSVSC----GGGERTRKRLCDNPVPTKGGRSCPGDATQVSRCN-MQACPGGPQRARGSVIG 4880          

HSP 7 Score: 62.7734 bits (151), Expect = 1.183e-9
Identity = 26/53 (49.06%), Postives = 35/53 (66.04%), Query Frame = 1
Query: 1300 VDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            VDG WS WS+W DCS  C   +G +TR R C+NP  + GG+PC G++ E + C
Sbjct: 4584 VDGHWSEWSFWEDCSRSCG--HGNQTRTRTCSNPPAQHGGRPCEGHAVETIMC 4634          

HSP 8 Score: 53.5286 bits (127), Expect = 7.826e-7
Identity = 24/53 (45.28%), Postives = 30/53 (56.60%), Query Frame = 1
Query: 1300 VDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            VDG W +W  WS CS  C    G RTR R C+NP P  GG+ C G++ +   C
Sbjct: 4812 VDGSWGTWHSWSHCSVSCG--GGERTRKRLCDNPVPTKGGRSCPGDATQVSRC 4862          

HSP 9 Score: 53.1434 bits (126), Expect = 9.364e-7
Identity = 23/53 (43.40%), Postives = 31/53 (58.49%), Query Frame = 1
Query: 1300 VDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            VDG+W++WS WS C+  C    G R R RDC++P P+ GG  C G   +   C
Sbjct: 4698 VDGRWATWSSWSACTVSCG--GGARKRTRDCSDPVPQYGGNKCEGTGVQSDFC 4748          

HSP 10 Score: 51.9878 bits (123), Expect = 2.315e-6
Identity = 24/57 (42.11%), Postives = 32/57 (56.14%), Query Frame = 1
Query: 1291 VRAVDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSCY 1461
            +  V G +S WS W  CS  C K  G + R+R C+NP P +GG+PC G   E   C+
Sbjct: 4524 IVQVHGGFSLWSAWRPCSVTCGK--GIQKRSRLCDNPPPANGGRPCQGADSEARHCH 4578          
BLAST of Hemicentin-1 vs. Ensembl Mouse
Match: Hmcn1 (hemicentin 1 [Source:MGI Symbol;Acc:MGI:2685047])

HSP 1 Score: 132.88 bits (333), Expect = 5.595e-32
Identity = 74/190 (38.95%), Postives = 101/190 (53.16%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPV 963
            PV G+W +W  WS CS +C       G  TR RLCN+PPP  GG +C+G  T+   C    CPV   G W+ WS WSAC+ +C        + R+R C++PVP+ GG KC+G  + S FC+  P CP  G W  W   G C     ++C  G  R  R C+ P P+  G+ C G   +++ C   + CPV
Sbjct: 4640 PVHGVWNAWQPWSACSKSCGK-----GSQTRMRLCNNPPPSFGGAHCSGAETQMQVCNERHCPV--DGRWATWSSWSACTVSC----GGGARKRTRDCSDPVPQYGGNKCEGTGVQSDFCNSDP-CPTHGNWSPWSGWGTC----SRTCNGGQMRRYRTCDNPRPSNGGRACGGPDTQIQRCNTDM-CPV 4812          

HSP 2 Score: 130.568 bits (327), Expect = 3.148e-31
Identity = 69/182 (37.91%), Postives = 92/182 (50.55%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDC 939
            PVDG W +W++WS C+++C       G   R R C+ P PQ GG  C G   ++D C + PCP   HGNWS WS W  CS+TC   Q      R R C+NP P +GG  C G     + C+    CP+DG WG W+    C      SC  G +  +R C+ P P   G+ C G   ++  C
Sbjct: 4697 PVDGRWATWSSWSACTVSCGG-----GARKRTRDCSDPVPQYGGNKCEGTGVQSDFCNSDPCPT--HGNWSPWSGWGTCSRTCNGGQ----MRRYRTCDNPRPSNGGRACGGPDTQIQRCN-TDMCPVDGSWGTWHSWSHCSV----SCGGGERTRKRLCDNPVPTKGGRSCPGDATQVSRC 4862          

HSP 3 Score: 130.183 bits (326), Expect = 3.879e-31
Identity = 73/182 (40.11%), Postives = 91/182 (50.00%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDC 939
            PVDG W  W+ W  CS +C      +G  TR R C++PP Q GG+ C G   ET  C   PCPV  HG W+ W  WSACSK+C        Q R RLCNNP P  GG  C G     + C+    CP+DG+W  W     C      SC  G+++  R C+ P P   G  CEG   + + C
Sbjct: 4583 PVDGHWSEWSFWEDCSRSCG-----HGNQTRTRTCSNPPAQHGGRPCEGHAVETIMCNIRPCPV--HGVWNAWQPWSACSKSC----GKGSQTRMRLCNNPPPSFGGAHCSGAETQMQVCNER-HCPVDGRWATWSSWSACTV----SCGGGARKRTRDCSDPVPQYGGNKCEGTGVQSDFC 4748          

HSP 4 Score: 127.102 bits (318), Expect = 3.549e-30
Identity = 69/181 (38.12%), Postives = 95/181 (52.49%), Query Frame = 1
Query:  397 VDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDC 939
            V G +  W+ W  CS+TC       G+  R RLC++PPP  GG+ C G  +E  +C N  CPV   G+WSEWS W  CS++C        Q R+R C+NP  + GG  C+G ++ +  C+  P CP+ G W  W     C     KSC  GSQ   R CN P P+  G  C G + +++ C
Sbjct: 4527 VHGGFSLWSAWRPCSVTCGK-----GIQKRSRLCDNPPPANGGRPCQGADSEARHCHNKLCPV--DGHWSEWSFWEDCSRSCGHGN----QTRTRTCSNPPAQHGGRPCEGHAVETIMCNIRP-CPVHGVWNAWQPWSAC----SKSCGKGSQTRMRLCNNPPPSFGGAHCSGAETQMQVC 4691          

HSP 5 Score: 88.1965 bits (217), Expect = 1.198e-17
Identity = 47/114 (41.23%), Postives = 59/114 (51.75%), Query Frame = 1
Query:  574 PCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEG 915
            P  V +HG +S WS W  CS TC       +Q RSRLC+NP P +GG  C G    +R C +   CP+DG W EW     C     +SC  G+Q   R C+ P     G+PCEG
Sbjct: 4522 PVIVQVHGGFSLWSAWRPCSVTC----GKGIQKRSRLCDNPPPANGGRPCQGADSEARHC-HNKLCPVDGHWSEWSFWEDC----SRSCGHGNQTRTRTCSNPPAQHGGRPCEG 4626          

HSP 6 Score: 88.1965 bits (217), Expect = 1.389e-17
Identity = 50/139 (35.97%), Postives = 66/139 (47.48%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAG 810
            P  G W  W+ W  CS TC+      G M R+R C++P P  GG+ C G  T+   C    CPV   G+W  W  WS CS +C        + R RLC+NPVP  GG  C G++     C+ +  CP   Q     + G
Sbjct: 4754 PTHGNWSPWSGWGTCSRTCNG-----GQMRRYRTCDNPRPSNGGRACGGPDTQIQRCNTDMCPV--DGSWGTWHSWSHCSVSC----GGGERTRKRLCDNPVPTKGGRSCPGDATQVSRCN-MQACPGGPQRARGSVIG 4880          

HSP 7 Score: 62.7734 bits (151), Expect = 1.152e-9
Identity = 26/53 (49.06%), Postives = 35/53 (66.04%), Query Frame = 1
Query: 1300 VDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            VDG WS WS+W DCS  C   +G +TR R C+NP  + GG+PC G++ E + C
Sbjct: 4584 VDGHWSEWSFWEDCSRSCG--HGNQTRTRTCSNPPAQHGGRPCEGHAVETIMC 4634          

HSP 8 Score: 53.5286 bits (127), Expect = 7.493e-7
Identity = 24/53 (45.28%), Postives = 30/53 (56.60%), Query Frame = 1
Query: 1300 VDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            VDG W +W  WS CS  C    G RTR R C+NP P  GG+ C G++ +   C
Sbjct: 4812 VDGSWGTWHSWSHCSVSCG--GGERTRKRLCDNPVPTKGGRSCPGDATQVSRC 4862          

HSP 9 Score: 53.1434 bits (126), Expect = 8.966e-7
Identity = 23/53 (43.40%), Postives = 31/53 (58.49%), Query Frame = 1
Query: 1300 VDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            VDG+W++WS WS C+  C    G R R RDC++P P+ GG  C G   +   C
Sbjct: 4698 VDGRWATWSSWSACTVSCG--GGARKRTRDCSDPVPQYGGNKCEGTGVQSDFC 4748          

HSP 10 Score: 51.9878 bits (123), Expect = 2.198e-6
Identity = 24/57 (42.11%), Postives = 32/57 (56.14%), Query Frame = 1
Query: 1291 VRAVDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSCY 1461
            +  V G +S WS W  CS  C K  G + R+R C+NP P +GG+PC G   E   C+
Sbjct: 4524 IVQVHGGFSLWSAWRPCSVTCGK--GIQKRSRLCDNPPPANGGRPCQGADSEARHCH 4578          
BLAST of Hemicentin-1 vs. Ensembl Mouse
Match: Sema5a (sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5A [Source:MGI Symbol;Acc:MGI:107556])

HSP 1 Score: 119.013 bits (297), Expect = 1.333e-27
Identity = 108/360 (30.00%), Postives = 149/360 (41.39%), Query Frame = 1
Query:  388 NEPVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPVTLQPPLNLHLTGNGSGLFNVSWSSVPYGKLASTYRIYKTI---EDESNREIKTNYEDHNALPNKKITSMNYWAIIDLRNLLSLNTFQTLAVRMSSIDFWKEESSLSNPVRSKVRAVDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            N  VDG +G W+ W+ C+ T  +       + R R C+SP PQ GG  C G   E  NC         +G W+ W+ WS CS TC +      QVR R C+NP P+ GG  C G++   R+C+    CP    W  W   GP E R    C  G Q  +R C                E   DC    GC V  QP                + ++ P  K  + +  +  +   ++  + E +  Y     LP+  +  +     I++R   S  T       +S  DF +         R     V+G WS+W+ WS CS  C +  G R R R CNNP P+ GG PC G S E   C
Sbjct:  536 NLTVDGSFGPWSPWTPCTHTDGTA--VGSCLCRSRSCDSPAPQCGGWQCEGPRMEITNCSR-------NGGWTPWTSWSPCSTTCGIG----FQVRQRSCSNPTPRHGGRVCVGQNREERYCNEHLLCPPHVFWTGW---GPWE-RCTAQCGGGIQARRRTC----------------ENGPDC---AGCNVEYQP---------------CNTNACPELKKTTPWTPWTPVNISDNGGHYEQRFRYTCKARLPDPNLLEVGR-QRIEMRYCSSDGTSGCSTDGLSG-DFLRAG-------RYSAHTVNGAWSAWTSWSQCSRDCSR--GIRNRKRVCNNPEPKFGGMPCLGPSLEFQEC 833          

HSP 2 Score: 71.633 bits (174), Expect = 1.660e-12
Identity = 68/183 (37.16%), Postives = 83/183 (45.36%), Query Frame = 1
Query:  397 VDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWF 945
            V+G W +WT+WS+CS  CS      G+  R R+CN+P P+ GG  C G   E   C   PCPV   G WS WS WS CS TC         +R+R C+NP P  GG  C G       C+    CP    W EW     C+       A G+Q   RQC    P   G  C G   +   C F
Sbjct:  783 VNGAWSAWTSWSQCSRDCSR-----GIRNRKRVCNNPEPKFGGMPCLGPSLEFQECNILPCPV--DGVWSCWSSWSKCSATC----GGGHYMRTRSCSNPAPAYGGDICLGLHTEEALCN-TQTCP--ESWSEWSDWSVCD-------ASGTQVRARQCILLFP--VGSQCSGNTTESRPCVF 942          

HSP 3 Score: 56.6102 bits (135), Expect = 7.375e-8
Identity = 49/132 (37.12%), Postives = 67/132 (50.76%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFC----DYLPQCPI 777
            PVDG+W  W++WSKCS TC       G   R R C++P P  GG  C G+ TE   C    CP     +WSEWS+WS C        ++  QVR+R C    P   G +C G +  SR C    +++P+  +
Sbjct:  839 PVDGVWSCWSSWSKCSATCGG-----GHYMRTRSCSNPAPAYGGDICLGLHTEEALCNTQTCPE----SWSEWSDWSVC-------DASGTQVRARQCILLFPV--GSQCSGNTTESRPCVFDSNFIPEVSV 952          
BLAST of Hemicentin-1 vs. Ensembl Mouse
Match: Cfp (complement factor properdin [Source:MGI Symbol;Acc:MGI:97545])

HSP 1 Score: 112.849 bits (281), Expect = 2.812e-26
Identity = 91/338 (26.92%), Postives = 130/338 (38.46%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVP--KDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPVTLQPPLNLHLTGNGSGLFNVSWSSVPYGKLASTYRIYKTI--EDESNREIKTNYEDHNALPNKKITSMNYWAIIDLRNLLSLNTFQTLAVRMSSIDFWKEESSLSNPVRSKVRAVDGKWSSWSYWSDCSAKCHKENGYRTRNRDCN 1395
            P  G W  W  W  CS+TCS      G   R R+C++P P+ GG +C G   ++  C       P HG W+ W  WS CS +C      P + RSR C+ P P  +  G  C G +   + C  LP CP+ G WG W    PC      +C LG    QR C+ P+P   G  C G   + + C   + CPV                  N  W +  +GK +   R+  +I  E    ++ ++          K         + D+R+  +++                               + G WS WS WS C+  C   N  R R R C 
Sbjct:  130 PEMGGWSEWGPWGPCSVTCSK-----GTQIRQRVCDNPAPKCGG-HCPGEAQQSQACDTQK-TCPTHGAWASWGPWSPCSGSCLGGAQEPKETRSRSCSAPAPSHQPPGKPCSGPAYEHKACSGLPPCPVAGGWGPWSPLSPCSV----TCGLGQTLEQRTCDHPAPRHGGPFCAGDATRNQMCNKAVPCPV------------------NGEWEA--WGKWSDCSRLRMSINCEGTPGQQSRSRSCGGRKFNGKPCAGK----LQDIRHCYNIHNC----------------------------IMKGSWSQWSTWSLCTPPC-SPNATRVRQRLCT 403          

HSP 2 Score: 69.707 bits (169), Expect = 3.440e-12
Identity = 48/141 (34.04%), Postives = 63/141 (44.68%), Query Frame = 1
Query:  385 PNEPVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSK---TCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEW 798
            P  PV G WG W+  S CS+TC       G     R C+ P P+ GG  C G  T    C N   P P++G W  W +WS CS+   +     +   Q RSR C     K  G  C G+  + R C  +  C + G W +W
Sbjct:  248 PPCPVAGGWGPWSPLSPCSVTCG-----LGQTLEQRTCDHPAPRHGGPFCAGDATRNQMC-NKAVPCPVNGEWEAWGKWSDCSRLRMSINCEGTPGQQSRSRSCGG--RKFNGKPCAGKLQDIRHCYNIHNCIMKGSWSQW 380          

HSP 3 Score: 53.5286 bits (127), Expect = 4.661e-7
Identity = 39/111 (35.14%), Postives = 55/111 (49.55%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQY--GLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIH-----GNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPK 705
            PV+G W +W  WS CS    S++ +   G  +R R C     +  GK C G   +  +C+N      IH     G+WS+WS WS C+  C  P +   +VR RLC   +PK
Sbjct:  309 PVNGEWEAWGKWSDCSRLRMSINCEGTPGQQSRSRSCGGR--KFNGKPCAGKLQDIRHCYN------IHNCIMKGSWSQWSTWSLCTPPCS-PNAT--RVRQRLCTPLLPK 408          
BLAST of Hemicentin-1 vs. Ensembl Mouse
Match: Sema5b (sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5B [Source:MGI Symbol;Acc:MGI:107555])

HSP 1 Score: 114.775 bits (286), Expect = 3.018e-26
Identity = 100/367 (27.25%), Postives = 142/367 (38.69%), Query Frame = 1
Query:  400 DGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPVTLQPPLNLHLTGNGSGLFNVSWSSVPYGKLASTYRIYKTIEDESNREIK----------TNYEDHNALPNKKITSMNYWAIIDLRNL-LSLNTFQTLAVRMSSIDFWKEESSLSNPVRSKV---RAVDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            DG +G W+ W  C       D     + R R C+SP P+ GG  C G      NC         +G W+ WS W+ CS +C +      QVR R C+NP P+ GG  C G+S   RFC+    CP+   W  W     C +    +C  G Q  +R C       +G  C G        W                  G GSG    S   V   +   T + +KT   E+  E++           N     A   ++        + D   L       +T             ++ + + +RS       ++G W++W  WS CS  C  E G+R R R C NP PR+GG PC G++ E   C
Sbjct:  551 DGGFGPWSPWKPCEHL--DGDNSGSCLCRARSCDSPRPRCGGLECLGPSIHIANCSR-------NGAWTAWSSWAQCSTSCGIG----FQVRQRSCSNPAPRHGGRICVGKSREERFCNENTPCPVPIFWASWGSWSKCSN----NCGGGVQSRRRSCE------NGNSCPGCGVVRSRGW------------------GAGSGE-TYSPGGVGGSEATLTPKEFKTCNPEACPEVRRNTPWTPWLPVNVTQGGARQEQRFRFTCRAPLPDPHGLQFGKRRTETRTCPADGTGACDTDALVEDLLRSGSTSPHTLNGGWATWGPWSSCSRDC--ELGFRVRKRTCTNPEPRNGGLPCVGDAAEYQDC 873          

HSP 2 Score: 70.4774 bits (171), Expect = 3.672e-12
Identity = 59/189 (31.22%), Postives = 73/189 (38.62%), Query Frame = 1
Query:  340 ACMTSHRVSPYIAIAPNEP--VDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNK--PSPNA 894
            AC T   V   +      P  ++G W +W  WS CS  C     + G   R R C +P P+ GG  C G   E  +C    CPV   G WS W+ WS CS +C          R+R C +P P  G   C G       C     CP    W  W   G C          G+Q   R C +  P P A
Sbjct:  802 ACDTDALVEDLLRSGSTSPHTLNGGWATWGPWSSCSRDC-----ELGFRVRKRTCTNPEPRNGGLPCVGDAAEYQDCNPQACPV--RGAWSCWTAWSQCSASC----GGGHYQRTRSCTSPAPSPGEDICLGLHTEEALCS-TQACPEG--WSLWSEWGVCTED-------GAQSRSRSCEELLPGPGA 969          

HSP 3 Score: 53.5286 bits (127), Expect = 6.444e-7
Identity = 59/221 (26.70%), Postives = 77/221 (34.84%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNS-----------------------PPPQLGGKNCTGIFTETDNCFNSPCP-----------VPIHGNWSEWSEWSACSKTCRLPQSAP--LQV-RSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCP--IDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDC 939
            PV   W SW +WSKCS  C       G+ +R R C +                        P  +GG   T    E   C    CP           +P++       +      TCR P   P  LQ  + R      P DG   CD ++L           P  ++G W  W     C SRD   C LG +  +R C  P P   G PC G   + +DC
Sbjct:  662 PVPIFWASWGSWSKCSNNCGG-----GVQSRRRSCENGNSCPGCGVVRSRGWGAGSGETYSPGGVGGSEATLTPKEFKTCNPEACPEVRRNTPWTPWLPVNVTQGGARQEQRFRFTCRAPLPDPHGLQFGKRRTETRTCPADGTGACDTDALVEDLLRSGSTSPHTLNGGWATWGPWSSC-SRD---CELGFRVRKRTCTNPEPRNGGLPCVGDAAEYQDC 873          
BLAST of Hemicentin-1 vs. UniProt/SwissProt
Match: sp|D3YXG0|HMCN1_MOUSE (Hemicentin-1 OS=Mus musculus OX=10090 GN=Hmcn1 PE=1 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 3.358e-31
Identity = 74/190 (38.95%), Postives = 101/190 (53.16%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPV 963
            PV G+W +W  WS CS +C       G  TR RLCN+PPP  GG +C+G  T+   C    CPV   G W+ WS WSAC+ +C        + R+R C++PVP+ GG KC+G  + S FC+  P CP  G W  W   G C     ++C  G  R  R C+ P P+  G+ C G   +++ C   + CPV
Sbjct: 4640 PVHGVWNAWQPWSACSKSCGK-----GSQTRMRLCNNPPPSFGGAHCSGAETQMQVCNERHCPV--DGRWATWSSWSACTVSC----GGGARKRTRDCSDPVPQYGGNKCEGTGVQSDFCNSDP-CPTHGNWSPWSGWGTCS----RTCNGGQMRRYRTCDNPRPSNGGRACGGPDTQIQRCNTDM-CPV 4812          

HSP 2 Score: 130.568 bits (327), Expect = 1.942e-30
Identity = 69/182 (37.91%), Postives = 92/182 (50.55%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDC 939
            PVDG W +W++WS C+++C       G   R R C+ P PQ GG  C G   ++D C + PCP   HGNWS WS W  CS+TC   Q      R R C+NP P +GG  C G     + C+    CP+DG WG W+    C      SC  G +  +R C+ P P   G+ C G   ++  C
Sbjct: 4697 PVDGRWATWSSWSACTVSCGG-----GARKRTRDCSDPVPQYGGNKCEGTGVQSDFCNSDPCPT--HGNWSPWSGWGTCSRTCNGGQ----MRRYRTCDNPRPSNGGRACGGPDTQIQRCN-TDMCPVDGSWGTWHSWSHCSV----SCGGGERTRKRLCDNPVPTKGGRSCPGDATQVSRC 4862          

HSP 3 Score: 130.183 bits (326), Expect = 2.551e-30
Identity = 73/182 (40.11%), Postives = 91/182 (50.00%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDC 939
            PVDG W  W+ W  CS +C      +G  TR R C++PP Q GG+ C G   ET  C   PCPV  HG W+ W  WSACSK+C        Q R RLCNNP P  GG  C G     + C+    CP+DG+W  W     C      SC  G+++  R C+ P P   G  CEG   + + C
Sbjct: 4583 PVDGHWSEWSFWEDCSRSCG-----HGNQTRTRTCSNPPAQHGGRPCEGHAVETIMCNIRPCPV--HGVWNAWQPWSACSKSC----GKGSQTRMRLCNNPPPSFGGAHCSGAETQMQVCNER-HCPVDGRWATWSSWSACTV----SCGGGARKRTRDCSDPVPQYGGNKCEGTGVQSDFC 4748          

HSP 4 Score: 127.487 bits (319), Expect = 2.271e-29
Identity = 69/181 (38.12%), Postives = 95/181 (52.49%), Query Frame = 1
Query:  397 VDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDC 939
            V G +  W+ W  CS+TC       G+  R RLC++PPP  GG+ C G  +E  +C N  CPV   G+WSEWS W  CS++C        Q R+R C+NP  + GG  C+G ++ +  C+  P CP+ G W  W     C     KSC  GSQ   R CN P P+  G  C G + +++ C
Sbjct: 4527 VHGGFSLWSAWRPCSVTCGK-----GIQKRSRLCDNPPPANGGRPCQGADSEARHCHNKLCPV--DGHWSEWSFWEDCSRSCGHGN----QTRTRTCSNPPAQHGGRPCEGHAVETIMCNIRP-CPVHGVWNAWQPWSACS----KSCGKGSQTRMRLCNNPPPSFGGAHCSGAETQMQVC 4691          

HSP 5 Score: 88.1965 bits (217), Expect = 7.962e-17
Identity = 47/114 (41.23%), Postives = 59/114 (51.75%), Query Frame = 1
Query:  574 PCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEG 915
            P  V +HG +S WS W  CS TC       +Q RSRLC+NP P +GG  C G    +R C +   CP+DG W EW     C     +SC  G+Q   R C+ P     G+PCEG
Sbjct: 4522 PVIVQVHGGFSLWSAWRPCSVTC----GKGIQKRSRLCDNPPPANGGRPCQGADSEARHC-HNKLCPVDGHWSEWSFWEDCS----RSCGHGNQTRTRTCSNPPAQHGGRPCEG 4626          

HSP 6 Score: 88.1965 bits (217), Expect = 8.997e-17
Identity = 50/139 (35.97%), Postives = 66/139 (47.48%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAG 810
            P  G W  W+ W  CS TC+      G M R+R C++P P  GG+ C G  T+   C    CPV   G+W  W  WS CS +C        + R RLC+NPVP  GG  C G++     C+ +  CP   Q     + G
Sbjct: 4754 PTHGNWSPWSGWGTCSRTCNG-----GQMRRYRTCDNPRPSNGGRACGGPDTQIQRCNTDMCPV--DGSWGTWHSWSHCSVSC----GGGERTRKRLCDNPVPTKGGRSCPGDATQVSRCN-MQACPGGPQRARGSVIG 4880          

HSP 7 Score: 62.7734 bits (151), Expect = 8.275e-9
Identity = 26/53 (49.06%), Postives = 35/53 (66.04%), Query Frame = 1
Query: 1300 VDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            VDG WS WS+W DCS  C   +G +TR R C+NP  + GG+PC G++ E + C
Sbjct: 4584 VDGHWSEWSFWEDCSRSCG--HGNQTRTRTCSNPPAQHGGRPCEGHAVETIMC 4634          

HSP 8 Score: 53.5286 bits (127), Expect = 5.475e-6
Identity = 24/53 (45.28%), Postives = 30/53 (56.60%), Query Frame = 1
Query: 1300 VDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            VDG W +W  WS CS  C    G RTR R C+NP P  GG+ C G++ +   C
Sbjct: 4812 VDGSWGTWHSWSHCSVSCG--GGERTRKRLCDNPVPTKGGRSCPGDATQVSRC 4862          

HSP 9 Score: 53.1434 bits (126), Expect = 6.550e-6
Identity = 23/53 (43.40%), Postives = 31/53 (58.49%), Query Frame = 1
Query: 1300 VDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            VDG+W++WS WS C+  C    G R R RDC++P P+ GG  C G   +   C
Sbjct: 4698 VDGRWATWSSWSACTVSCG--GGARKRTRDCSDPVPQYGGNKCEGTGVQSDFC 4748          
BLAST of Hemicentin-1 vs. UniProt/SwissProt
Match: sp|Q96RW7|HMCN1_HUMAN (Hemicentin-1 OS=Homo sapiens OX=9606 GN=HMCN1 PE=1 SV=2)

HSP 1 Score: 132.494 bits (332), Expect = 4.372e-31
Identity = 74/190 (38.95%), Postives = 98/190 (51.58%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPV 963
            PV G W +W  W  CS +C       G  TR RLCN+PPP  GG  C G  T+   C    C  PIHG W+ W+ WSACS +C        + R+R C++PVP+ GG KC+G  + S FC+  P CP  G W  W   G C     ++C  G  R  R C+ P P+  G+ C G   +++ C   + CPV
Sbjct: 4641 PVHGAWSAWQPWGTCSESCGK-----GTQTRARLCNNPPPAFGGSYCDGAETQMQVCNERNC--PIHGKWATWASWSACSVSC----GGGARQRTRGCSDPVPQYGGRKCEGSDVQSDFCNSDP-CPTHGNWSPWSGWGTC----SRTCNGGQMRRYRTCDNPPPSNGGRACGGPDSQIQRCNTDM-CPV 4813          

HSP 2 Score: 130.954 bits (328), Expect = 1.452e-30
Identity = 69/182 (37.91%), Postives = 93/182 (51.10%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDC 939
            P+ G W +W +WS CS++C       G   R R C+ P PQ GG+ C G   ++D C + PCP   HGNWS WS W  CS+TC   Q      R R C+NP P +GG  C G     + C+    CP+DG WG W+    C +    SC  G +  +R C+ P P   G+PC G   ++  C
Sbjct: 4698 PIHGKWATWASWSACSVSCGG-----GARQRTRGCSDPVPQYGGRKCEGSDVQSDFCNSDPCPT--HGNWSPWSGWGTCSRTCNGGQMR----RYRTCDNPPPSNGGRACGGPDSQIQRCN-TDMCPVDGSWGSWHSWSQCSA----SCGGGEKTRKRLCDHPVPVKGGRPCPGDTTQVTRC 4863          

HSP 3 Score: 130.183 bits (326), Expect = 2.669e-30
Identity = 71/181 (39.23%), Postives = 93/181 (51.38%), Query Frame = 1
Query:  397 VDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDC 939
            V G +  W+ W  CS+TC       G+  R RLCN P P  GGK C G   E  NC N PCPV   G+WSEWS W  C+++C        Q R+R CNNP  + GG  C+G ++    C+  P CP+ G W  W   G C     +SC  G+Q   R CN P P   G  C+G + +++ C
Sbjct: 4528 VHGGFSQWSAWRACSVTCGK-----GIQKRSRLCNQPLPANGGKPCQGSDLEMRNCQNKPCPV--DGSWSEWSLWEECTRSCGRGN----QTRTRTCNNPSVQHGGRPCEGNAVEIIMCNIRP-CPVHGAWSAWQPWGTC----SESCGKGTQTRARLCNNPPPAFGGSYCDGAETQMQVC 4692          

HSP 4 Score: 122.865 bits (307), Expect = 6.222e-28
Identity = 69/174 (39.66%), Postives = 86/174 (49.43%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEG 915
            PVDG W  W+ W +C+ +C       G  TR R CN+P  Q GG+ C G   E   C   PCPV  HG WS W  W  CS++C        Q R+RLCNNP P  GG  CDG     + C+    CPI G+W  W     C      SC  G+++  R C+ P P   G+ CEG
Sbjct: 4584 PVDGSWSEWSLWEECTRSCGR-----GNQTRTRTCNNPSVQHGGRPCEGNAVEIIMCNIRPCPV--HGAWSAWQPWGTCSESC----GKGTQTRARLCNNPPPAFGGSYCDGAETQMQVCNER-NCPIHGKWATWASWSACSV----SCGGGARQRTRGCSDPVPQYGGRKCEG 4741          

HSP 5 Score: 100.523 bits (249), Expect = 1.091e-20
Identity = 52/114 (45.61%), Postives = 63/114 (55.26%), Query Frame = 1
Query:  574 PCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEG 915
            P  V +HG +S+WS W ACS TC       +Q RSRLCN P+P +GG  C G  L  R C   P CP+DG W EW +   C     +SC  G+Q   R CN PS    G+PCEG
Sbjct: 4523 PVIVQVHGGFSQWSAWRACSVTC----GKGIQKRSRLCNQPLPANGGKPCQGSDLEMRNCQNKP-CPVDGSWSEWSLWEEC----TRSCGRGNQTRTRTCNNPSVQHGGRPCEG 4627          

HSP 6 Score: 88.1965 bits (217), Expect = 8.764e-17
Identity = 49/139 (35.25%), Postives = 67/139 (48.20%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAG 810
            P  G W  W+ W  CS TC+      G M R+R C++PPP  GG+ C G  ++   C    CPV   G+W  W  WS CS +C        + R RLC++PVP  GG  C G++     C+ +  CP   Q     + G
Sbjct: 4755 PTHGNWSPWSGWGTCSRTCNG-----GQMRRYRTCDNPPPSNGGRACGGPDSQIQRCNTDMCPV--DGSWGSWHSWSQCSASC----GGGEKTRKRLCDHPVPVKGGRPCPGDTTQVTRCN-VQACPGGPQRARGSVIG 4881          

HSP 7 Score: 63.5438 bits (153), Expect = 4.699e-9
Identity = 27/53 (50.94%), Postives = 35/53 (66.04%), Query Frame = 1
Query: 1300 VDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            VDG WS WS W +C+  C +  G +TR R CNNPS + GG+PC GN+ E + C
Sbjct: 4585 VDGSWSEWSLWEECTRSCGR--GNQTRTRTCNNPSVQHGGRPCEGNAVEIIMC 4635          

HSP 8 Score: 56.6102 bits (135), Expect = 5.882e-7
Identity = 25/53 (47.17%), Postives = 32/53 (60.38%), Query Frame = 1
Query: 1300 VDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            VDG W SW  WS CSA C    G +TR R C++P P  GG+PC G++ +   C
Sbjct: 4813 VDGSWGSWHSWSQCSASCG--GGEKTRKRLCDHPVPVKGGRPCPGDTTQVTRC 4863          
BLAST of Hemicentin-1 vs. UniProt/SwissProt
Match: sp|D3ZTD8|SEM5A_RAT (Semaphorin-5A OS=Rattus norvegicus OX=10116 GN=Sema5a PE=1 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 8.295e-27
Identity = 108/360 (30.00%), Postives = 149/360 (41.39%), Query Frame = 1
Query:  388 NEPVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPVTLQPPLNLHLTGNGSGLFNVSWSSVPYGKLASTYRIYKTI---EDESNREIKTNYEDHNALPNKKITSMNYWAIIDLRNLLSLNTFQTLAVRMSSIDFWKEESSLSNPVRSKVRAVDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            N  VDG +G W+ W+ C+ T  +       + R R C+SP PQ GG  C G   E  NC         +G W+ W+ WS CS TC +      QVR R C+NP P+ GG  C G++   R+C+    CP    W  W   GP E R    C  G Q  +R C                E   DC    GC V  QP                + ++ P  K  + +  +  +   ++  + E +  Y     LP+  +  +     I++R   S  T       +S  DF +         R     V+G WS+W+ WS CS  C +  G R R R CNNP P+ GG PC G S E   C
Sbjct:  536 NLTVDGSFGPWSPWTPCTHTDGTA--VGSCLCRSRSCDSPAPQCGGWQCEGPRMEITNCSR-------NGGWTPWTSWSPCSTTCGIG----FQVRQRSCSNPTPRHGGRVCVGQNREERYCNEHLLCPPHVFWTGW---GPWE-RCTAQCGGGIQARRRTC----------------ENGPDC---AGCNVEYQP---------------CNTNACPELKKTTPWTPWTPVNISDNGGHYEQRFRYTCKARLPDPNLLEVGR-QRIEMRYCSSDGTSGCSTDGLSG-DFLRAG-------RYSAHTVNGAWSAWTSWSQCSRDCSR--GIRNRKRVCNNPEPKYGGMPCLGPSLEFQEC 833          

HSP 2 Score: 71.2478 bits (173), Expect = 1.311e-11
Identity = 68/184 (36.96%), Postives = 85/184 (46.20%), Query Frame = 1
Query:  397 VDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPID-GQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWF 945
            V+G W +WT+WS+CS  CS      G+  R R+CN+P P+ GG  C G   E   C   PCPV   G WS WS WS CS TC         +R+R C NP P  GG  C G       C+    CP +  +W EW +   C+       A G+Q   RQC    P   G  C G   +   C F
Sbjct:  783 VNGAWSAWTSWSQCSRDCSR-----GIRNRKRVCNNPEPKYGGMPCLGPSLEFQECNILPCPV--DGVWSCWSSWSKCSATC----GGGHYMRTRSCTNPAPAYGGDICLGLHTEEALCN-TQTCPENWSEWSEWSV---CD-------ASGTQVRTRQCILLFP--VGSQCSGNTTESRPCVF 942          

HSP 3 Score: 59.6918 bits (143), Expect = 5.318e-8
Identity = 51/132 (38.64%), Postives = 66/132 (50.00%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFC----DYLPQCPI 777
            PVDG+W  W++WSKCS TC       G   R R C +P P  GG  C G+ TE   C    CP     NWSEWSEWS C        ++  QVR+R C    P   G +C G +  SR C    +++P+  +
Sbjct:  839 PVDGVWSCWSSWSKCSATCGG-----GHYMRTRSCTNPAPAYGGDICLGLHTEEALCNTQTCP----ENWSEWSEWSVC-------DASGTQVRTRQCILLFPV--GSQCSGNTTESRPCVFDSNFIPEVSV 952          
BLAST of Hemicentin-1 vs. UniProt/SwissProt
Match: sp|B3EWZ3|CADN_ACRMI (Coadhesin (Fragment) OS=Acropora millepora OX=45264 PE=1 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 1.423e-26
Identity = 67/180 (37.22%), Postives = 92/180 (51.11%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLE 933
            P++G + +W  W+ CS+TC       G   R RLC++P P  GG  C G  +E   C   PCPV  +GNWS W +WS CS  C   +S     R R C+NP P + GL C G    S+ C+    CP+DG W  W  + PC +    +C  G+ +  R+CN P P   G  C G + + E
Sbjct:  401 PINGNYSNWGQWTACSVTCGQ-----GTRERTRLCDNPAPAQGGSQCQGPSSELVGCTEIPCPV--NGNWSSWGDWSNCSSGCGPGKS----YRYRDCDNPAPANNGLNCTGPDQESKDCNST-ACPVDGGWSAWS-STPCSA----TCGQGTLKRTRECNNPKPQYGGASCFGNETEQE 563          

HSP 2 Score: 103.605 bits (257), Expect = 1.014e-21
Identity = 61/175 (34.86%), Postives = 79/175 (45.14%), Query Frame = 1
Query:  397 VDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIK 921
            V+G W  W+ +  C+  C       G   R R C  P P  GG  C G+  E   C  + C   ++G WS W  WS CS TC   Q +    R R C NP PK+GG  C G S  S  C  +  CP+DG W  W     C     ++C  G Q   R C+ P P   G+ C G++
Sbjct:  167 VNGAWSHWSPYGPCTHAC------LGTAKRTRTCADPAPVFGGSPCEGVNEEEKIC--NDCVGTVNGGWSPWGLWSRCSTTCNPGQRS----RQRTCTNPSPKNGGTDCSGPSTQSEPCQ-VQFCPVDGGWSAWSGLSRC----TRACGGGRQYQSRTCSNPFPGHGGRDCVGVR 324          

HSP 3 Score: 101.679 bits (252), Expect = 3.511e-21
Identity = 63/181 (34.81%), Postives = 89/181 (49.17%), Query Frame = 1
Query:  397 VDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDC 939
            V+G W  W  WS+CS TC+      G  +R R C +P P+ GG +C+G  T+++ C    CPV   G WS WS  S C++ C        Q +SR C+NP P  GG  C G    S  C+    CP+ G W  W     C     ++C  G +   R CN P+P+ +G  C G  + ++ C
Sbjct:  223 VNGGWSPWGLWSRCSTTCNP-----GQRSRQRTCTNPSPKNGGTDCSGPSTQSEPCQVQFCPV--DGGWSAWSGLSRCTRAC----GGGRQYQSRTCSNPFPGHGGRDCVGVRSLSFTCN-TQCCPVHGGWSPWGSFSSC----TRTCGGGQKSRTRVCNSPAPSCNGITCPGGNQDIQPC 387          

HSP 4 Score: 98.5969 bits (244), Expect = 4.108e-20
Identity = 64/197 (32.49%), Postives = 96/197 (48.73%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDG-----ESLNSRFCDYLPQC--PIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPV 963
            PVDG W +W+  S+C+  C       G   + R C++P P  GG++C G+ + +  C    CPV  HG WS W  +S+C++TC   Q +    R+R+CN+P P   G+ C G     +  N + C   P    PI+G +  W     C      +C  G++   R C+ P+P   G  C+G   +L  C   I CPV
Sbjct:  279 PVDGGWSAWSGLSRCTRACGG-----GRQYQSRTCSNPFPGHGGRDCVGVRSLSFTCNTQCCPV--HGGWSPWGSFSSCTRTCGGGQKS----RTRVCNSPAPSCNGITCPGGNQDIQPCNQQTCPTSPSTSFPINGNYSNWGQWTACSV----TCGQGTRERTRLCDNPAPAQGGSQCQGPSSELVGC-TEIPCPV 459          

HSP 5 Score: 58.9214 bits (141), Expect = 1.045e-7
Identity = 39/130 (30.00%), Postives = 56/130 (43.08%), Query Frame = 1
Query:  580 PVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQC--PIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPV 963
            P  ++G WS WS +  C+  C          R+R C +P P  GG  C+G +   + C+    C   ++G W  W +   C +    +C  G +  QR C  PSP   G  C G   + E C     CPV
Sbjct:  164 PAAVNGAWSHWSPYGPCTHAC-----LGTAKRTRTCADPAPVFGGSPCEGVNEEEKICN---DCVGTVNGGWSPWGLWSRCST----TCNPGQRSRQRTCTNPSPKNGGTDCSGPSTQSEPCQVQF-CPV 280          

HSP 6 Score: 53.9138 bits (128), Expect = 3.370e-6
Identity = 26/56 (46.43%), Postives = 33/56 (58.93%), Query Frame = 1
Query: 1291 VRAVDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            V  V+G WS W  WS CS  C+   G R+R R C NPSP++GG  C+G S +   C
Sbjct:  220 VGTVNGGWSPWGLWSRCSTTCNP--GQRSRQRTCTNPSPKNGGTDCSGPSTQSEPC 273          
BLAST of Hemicentin-1 vs. UniProt/SwissProt
Match: sp|P27918|PROP_HUMAN (Properdin OS=Homo sapiens OX=9606 GN=CFP PE=1 SV=2)

HSP 1 Score: 115.546 bits (288), Expect = 2.337e-26
Identity = 72/192 (37.50%), Postives = 87/192 (45.31%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVP--KDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPV 963
            P  G W  W  W  CS+TCS      G  TR R CN P P+ GG +C G   E++ C       P HG W+ W  W+ CS +C      P + RSR C+ P P  K  G  C G +   R C  LP CP+ G WG W    PC      +C LG    QR CN P P   G  C G   +   C   + CPV
Sbjct:  134 PEMGGWSGWGPWEPCSVTCSK-----GTRTRRRACNHPAPKCGG-HCPGQAQESEACDTQQV-CPTHGAWATWGPWTPCSASCHGGPHEPKETRSRKCSAPEPSQKPPGKPCPGLAYEQRRCTGLPPCPVAGGWGPWGPVSPCPV----TCGLGQTMEQRTCNHPVPQHGGPFCAGDATRTHICNTAVPCPV 314          

HSP 2 Score: 99.7525 bits (247), Expect = 4.257e-21
Identity = 65/196 (33.16%), Postives = 91/196 (46.43%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPP--QLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCAL----GSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPV 963
            P  G W +W  W+ CS +C     +    TR R C++P P  +  GK C G+  E   C   P P P+ G W  W   S C  TC L Q+    +  R CN+PVP+ GG  C G++  +  C+    CP+DG+W  W    PC  R+ KS +     G Q   R C       DG  C G ++ +  C+    CP+
Sbjct:  191 PTHGAWATWGPWTPCSASCHGGPHEP-KETRSRKCSAPEPSQKPPGKPCPGLAYEQRRCTGLP-PCPVAGGWGPWGPVSPCPVTCGLGQT----MEQRTCNHPVPQHGGPFCAGDATRTHICNTAVPCPVDGEWDSWGEWSPCIRRNMKSISCQEIPGQQSRGRTCR--GRKFDGHRCAGQQQDIRHCYSIQHCPL 378          

HSP 3 Score: 89.3521 bits (220), Expect = 1.172e-17
Identity = 64/189 (33.86%), Postives = 81/189 (42.86%), Query Frame = 1
Query:  409 WGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFT-ETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNAD--GKPCEGIKEKLEDCWFFIGCPVT 966
            W  W+TW+ CS+TCS      G   R+R C     Q  GK   G    +   C +  C  P  G WS W  W  CS TC    S   + R R CN+P PK GG  C G++  S  CD    CP  G W  W    PC +          +   R+C+ P P+    GKPC G+  +   C     CPV 
Sbjct:   80 WSLWSTWAPCSVTCSE-----GSQLRYRRCVGWNGQCSGKVAPGTLEWQLQACEDQQC-CPEMGGWSGWGPWEPCSVTC----SKGTRTRRRACNHPAPKCGG-HCPGQAQESEACDTQQVCPTHGAWATWGPWTPCSASCHGGPHEPKETRSRKCSAPEPSQKPPGKPCPGLAYEQRRCTGLPPCPVA 257          

HSP 4 Score: 79.7221 bits (195), Expect = 1.360e-14
Identity = 54/148 (36.49%), Postives = 64/148 (43.24%), Query Frame = 1
Query:  385 PNEPVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSAC----SKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPC 816
            P  PV G WG W   S C +TC       G     R CN P PQ GG  C G  T T  C N+  P P+ G W  W EWS C     K+    +    Q R R C     K  G +C G+  + R C  +  CP+ G W EW   G C
Sbjct:  252 PPCPVAGGWGPWGPVSPCPVTCG-----LGQTMEQRTCNHPVPQHGGPFCAGDATRTHIC-NTAVPCPVDGEWDSWGEWSPCIRRNMKSISCQEIPGQQSRGRTCRGR--KFDGHRCAGQQQDIRHCYSIQHCPLKGSWSEWSTWGLC 391          

HSP 5 Score: 54.6842 bits (130), Expect = 1.459e-6
Identity = 38/110 (34.55%), Postives = 50/110 (45.45%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKC------SITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPK 705
            PVDG W SW  WS C      SI+C  +    G  +R R C     +  G  C G   +  +C++     P+ G+WSEWS W  C   C      P + R RLC   +PK
Sbjct:  313 PVDGEWDSWGEWSPCIRRNMKSISCQEIP---GQQSRGRTCRGR--KFDGHRCAGQQQDIRHCYSIQ-HCPLKGSWSEWSTWGLCMPPC---GPNPTRARQRLCTPLLPK 413          
BLAST of Hemicentin-1 vs. TrEMBL
Match: A0A2B4SK26 (Hemicentin-1 OS=Stylophora pistillata OX=50429 GN=HMCN1 PE=4 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 4.322e-46
Identity = 129/356 (36.24%), Postives = 176/356 (49.44%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPVTLQPPLNLHLTGNGSGLFNVSWSSVPYGKLASTYRIYKTIEDESNREIKTNYEDHNALPNKKITSMNYWAIIDLRNLLSLNTFQTLAVRMSSIDFWKEESSLSNPVRSKVRA-VDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            PVDG WG W+ WS CS TC    +Q G  +R R CNSP PQ GG+ C G  ++T  C N   P P+ GNW  WSEWS C+KTC+  +    Q R+R CN+P  + GG KCDGES  ++ C+    CP+DG WG W     C     K+C  G Q   R+CN P+P   GK C+G +++ + C   I CP  L      HL    +     + S V  G     Y + K +  +S  E+  N+ +         T              +L T Q    +    D   +ES + N    KV   VDG W +WS WS C+  C  + G ++R R+CN+P+P  GGK C+G  +E   C
Sbjct:  231 PVDGNWGKWSAWSTCSKTC----IQ-GKQSRTRKCNSPAPQYGGRKCDGHSSQTQIC-NQKVPCPVDGNWGGWSEWSTCTKTCKQGK----QSRTRKCNSPAAQYGGRKCDGESSQTQICNQKVPCPVDGSWGAWSEWSTCT----KTCKQGKQSRTRECNSPAPQYGGKNCDGDRKESQVCNEKIPCPDHL-----FHLFARTT--METTGSPV-IGHFTVVYLVAKPL-IQSEAEVDGNWGEWGEWST--CTKTCKQGEQSRSRKCNLPTPQYGGRK---CDGEGKESQVCN---DKVPCPVDGNWGAWSEWSTCTKTC--KQGKQSRTRECNSPAPLYGGKKCDGEGKETQVC 553          

HSP 2 Score: 170.244 bits (430), Expect = 1.568e-41
Identity = 115/358 (32.12%), Postives = 167/358 (46.65%), Query Frame = 1
Query:  397 VDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPVTLQPPLNLHLTGNGSGLFNVSWSSVPYGKLASTYRIYKTIEDESNREIKT---NYEDHNALPNKKITSMNYWAIIDLRNLLSLNTFQTLAVRMSS-IDFWKEESSLSNPVRSKVRAVDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            V+G WG W  WS C+ TC     + G  +R R CNSP PQ GGK C G       C N+  P P+ GNW +WS WS CSKTC   +    Q R+R CN+P P+ GG KCDG S  ++ C+    CP+DG WG W     C     K+C  G Q   R+CN P+    G+ C+G   + + C   + CPV                  + SW +  + + ++  +  K  +    RE  +    Y   N   ++K + +    I    +L  L    T+    S  I  +     ++ P+      VDG W  W  WS C+  C  + G ++R+R CN P+P+ GG+ C+G  +E   C
Sbjct:  174 VNGNWGQWGQWSMCTKTC-----KEGKQSRKRECNSPAPQYGGKACEGESIGVRIC-NANVPCPVDGNWGKWSAWSTCSKTCIQGK----QSRTRKCNSPAPQYGGRKCDGHSSQTQICNQKVPCPVDGNWGGWSEWSTCT----KTCKQGKQSRTRKCNSPAAQYGGRKCDGESSQTQICNQKVPCPV------------------DGSWGA--WSEWSTCTKTCKQGKQSRTRECNSPAPQYGGKNCDGDRKESQVCNEKIPCPDHLFHLFARTTMETTGSPVIGHFTVVYLVAKPLIQSEAEVDGNWGEWGEWSTCTKTC--KQGEQSRSRKCNLPTPQYGGRKCDGEGKESQVC 495          

HSP 3 Score: 154.066 bits (388), Expect = 4.702e-36
Identity = 82/182 (45.05%), Postives = 104/182 (57.14%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDC 939
            PVDG WG W+ WS C+ TC     + G  +R R CNSP P+ GGKNC G   ET  C N   P P+ GNW EWSEWS C+KTC+  +    Q R+R C+NP P+ GG KC+GE+  ++ C+    CP+DG WGEW     C     KSC  G    +R C+ P+P   GK CEG   +   C
Sbjct:  560 PVDGNWGEWSVWSTCTKTC-----KQGKQSRSRQCNSPAPKYGGKNCDGEGKETQVC-NDKSPCPVDGNWGEWSEWSTCTKTCKQGK----QSRTRKCDNPAPQYGGRKCEGEADENQICNDKTPCPVDGNWGEWGAWTKCS----KSCGGGEHSRKRLCDSPAPAHGGKICEGAFRQRRPC 727          

HSP 4 Score: 153.68 bits (387), Expect = 6.276e-36
Identity = 84/190 (44.21%), Postives = 106/190 (55.79%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPV 963
            PVDG WG+W+ WS C+ TC     + G  +R R CNSP P  GGK C G   ET  C N   P P+ GNW EWS WS C+KTC+  +    Q RSR CN+P PK GG  CDGE   ++ C+    CP+DG WGEW     C     K+C  G Q   R+C+ P+P   G+ CEG  ++ + C     CPV
Sbjct:  502 PVDGNWGAWSEWSTCTKTC-----KQGKQSRTRECNSPAPLYGGKKCDGEGKETQVC-NDKVPCPVDGNWGEWSVWSTCTKTCKQGK----QSRSRQCNSPAPKYGGKNCDGEGKETQVCNDKSPCPVDGNWGEWSEWSTCT----KTCKQGKQSRTRKCDNPAPQYGGRKCEGEADENQICNDKTPCPV 677          

HSP 5 Score: 150.984 bits (380), Expect = 6.132e-35
Identity = 83/195 (42.56%), Postives = 105/195 (53.85%), Query Frame = 1
Query:  379 IAPNEPVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPV 963
            I     VDG WG W  WS C+ TC     + G  +R R CN P PQ GG+ C G   E+  C N   P P+ GNW  WSEWS C+KTC+  +    Q R+R CN+P P  GG KCDGE   ++ C+    CP+DG WGEW +   C     K+C  G Q   RQCN P+P   GK C+G  ++ + C     CPV
Sbjct:  439 IQSEAEVDGNWGEWGEWSTCTKTC-----KQGEQSRSRKCNLPTPQYGGRKCDGEGKESQVC-NDKVPCPVDGNWGAWSEWSTCTKTCKQGK----QSRTRECNSPAPLYGGKKCDGEGKETQVCNDKVPCPVDGNWGEWSVWSTCT----KTCKQGKQSRSRQCNSPAPKYGGKNCDGEGKETQVCNDKSPCPV 619          

HSP 6 Score: 132.88 bits (333), Expect = 5.486e-29
Identity = 72/190 (37.89%), Postives = 98/190 (51.58%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPV 963
            PVDG WG W+ WS C+ TC     + G  +R R C++P PQ GG+ C G   E   C N   P P+ GNW EW  W+ CSK+C          R RLC++P P  GG  C+G     R C+    CP+DG WG W     C +    +C  G+++ +R C+ P P  +GK C G+  +   C  +  CPV
Sbjct:  618 PVDGNWGEWSEWSTCTKTC-----KQGKQSRTRKCDNPAPQYGGRKCEGEADENQIC-NDKTPCPVDGNWGEWGAWTKCSKSC----GGGEHSRKRLCDSPAPAHGGKICEGAFRQRRPCNEN-NCPVDGSWGSWAPWSACSA----TCGYGNRQRKRVCDNPKPAYNGKSCVGVGYQKARCHAYYPCPV 792          

HSP 7 Score: 119.783 bits (299), Expect = 1.326e-24
Identity = 69/182 (37.91%), Postives = 88/182 (48.35%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDC 939
            PVDG WG W  W+KCS +C       G  +R RLC+SP P  GGK C G F +   C  + CPV   G+W  W+ WSACS TC        + R R+C+NP P   G  C G       C     CP+DG W  W     C     K+C L  ++  R C  P P   G  C G+ +++E C
Sbjct:  676 PVDGNWGEWGAWTKCSKSCGG-----GEHSRKRLCDSPAPAHGGKICEGAFRQRRPCNENNCPV--DGSWGSWAPWSACSATCGYGN----RQRKRVCDNPKPAYNGKSCVGVGYQKARCHAYYPCPVDGNWTSWGAWTSCT----KTCGLSYRKRSRSCANPPPQYGGSGCVGLNDQVERC 842          

HSP 8 Score: 100.908 bits (250), Expect = 1.403e-18
Identity = 50/128 (39.06%), Postives = 72/128 (56.25%), Query Frame = 1
Query:  580 PVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPV 963
            P  ++GNW +W +WS C+KTC+  +    Q R R CN+P P+ GG  C+GES+  R C+    CP+DG WG+W     C     K+C  G Q   R+CN P+P   G+ C+G   + + C   + CPV
Sbjct:  171 PKLVNGNWGQWGQWSMCTKTCKEGK----QSRKRECNSPAPQYGGKACEGESIGVRICNANVPCPVDGNWGKWSAWSTCS----KTCIQGKQSRTRKCNSPAPQYGGRKCDGHSSQTQICNQKVPCPV 290          

HSP 9 Score: 93.2041 bits (230), Expect = 3.787e-16
Identity = 54/129 (41.86%), Postives = 70/129 (54.26%), Query Frame = 1
Query:  388 NEPVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCP 774
            N PVDG WGSW  WS CS TC      YG   R R+C++P P   GK+C G+  +   C ++  P P+ GNW+ W  W++C+KTC L      + RSR C NP P+ GG  C G +     C   P CP
Sbjct:  731 NCPVDGSWGSWAPWSACSATCG-----YGNRQRKRVCDNPKPAYNGKSCVGVGYQKARC-HAYYPCPVDGNWTSWGAWTSCTKTCGL----SYRKRSRSCANPPPQYGGSGCVGLNDQVERCKDKP-CP 848          
BLAST of Hemicentin-1 vs. TrEMBL
Match: R7V9A7 (Methyltransf_FA domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_224576 PE=4 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 2.277e-39
Identity = 122/369 (33.06%), Postives = 166/369 (44.99%), Query Frame = 1
Query:  397 VDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETD--NCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPVTLQPPLNLHLTGNGSGLFNVSWSSVPYGKLASTYRIYKTIEDES----------NREIKTNYEDHNALPNKKITSMNYWAIIDLRNLLSLNTFQTLAVR---MSSIDFWKEESSLSNPVRSKVRAVDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            ++G WG+W  WS CS TC       G+  R R C+ P PQ GG+ C G   E +   C +  CPV  HG WS W +W++CS +C       + +R+RLC+NP P +GG  C+G    S  C  +P CP+DG W  W     C +    SC  G++ + R C+ P+P  +G PCEG  E  E+C F   CPV           G  S   N +  S   G LA+  R ++  +D S          +     N E  N   N    S N+W+   +   L L T          M        E S +         +DG WS W YW +CSA C    G +TR+R C NP P   G  C GN    ++C
Sbjct:  243 INGNWGAWGGWSTCSFTCGG-----GIQQRTRTCSDPAPQYGGQECDGATGEQEARTCNHDECPV--HGAWSSWEDWTSCSASC----GPGVSIRTRLCDNPTPLNGGESCEGNQEESDACVDIP-CPVDGNWSAWSAWSECSA----SCNHGNRTHFRSCDNPTPAYNGLPCEGEAEAQEEC-FIEYCPVD----------GGWSEWSNWTECSETCG-LATKVR-FRVCDDPSPAYGGNNCSGSDNETVNCEWINCEVNGSWASWNHWSDCSVSCGLGLTTRTRNCSDPPPMYGGLICAGEFSDNTTCNDGPCPIDGSWSPWGYWGECSATCG--GGLKTRSRTCTNPQPLHDGTQCVGNDRVNITC 580          

HSP 2 Score: 121.709 bits (304), Expect = 2.207e-25
Identity = 72/190 (37.89%), Postives = 97/190 (51.05%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPV 963
            PV G W SW  W+ CS +C       G+  R RLC++P P  GG++C G   E+D C + PCPV   GNWS WS WS CS +C        +   R C+NP P   GL C+GE+     C ++  CP+DG W EW     C     ++C L ++   R C+ PSP   G  C G   +  +C  +I C V
Sbjct:  301 PVHGAWSSWEDWTSCSASCGP-----GVSIRTRLCDNPTPLNGGESCEGNQEESDACVDIPCPV--DGNWSAWSAWSECSASCNHGN----RTHFRSCDNPTPAYNGLPCEGEAEAQEEC-FIEYCPVDGGWSEWSNWTEC----SETCGLATKVRFRVCDDPSPAYGGNNCSGSDNETVNC-EWINCEV 473          

HSP 3 Score: 118.627 bits (296), Expect = 2.890e-24
Identity = 73/176 (41.48%), Postives = 93/176 (52.84%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMT--RFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEG 915
            PVDG W  W+ W++CS TC       GL T  RFR+C+ P P  GG NC+G   ET NC    C V  +G+W+ W+ WS CS +C L     L  R+R C++P P  GGL C GE  ++  C+  P CPIDG W  W   G C +    +C  G +   R C  P P  DG  C G
Sbjct:  415 PVDGGWSEWSNWTECSETC-------GLATKVRFRVCDDPSPAYGGNNCSGSDNETVNCEWINCEV--NGSWASWNHWSDCSVSCGLG----LTTRTRNCSDPPPMYGGLICAGEFSDNTTCNDGP-CPIDGSWSPWGYWGECSA----TCGGGLKTRSRTCTNPQPLHDGTQCVG 572          

HSP 4 Score: 114.39 bits (285), Expect = 5.887e-23
Identity = 69/191 (36.13%), Postives = 97/191 (50.79%), Query Frame = 1
Query:  397 VDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGES--LNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPV 963
            VDG W +W  WS+CS +C       G+  R R C+ P P+ GG  C G   +   C  + C   I+GNW  W  WS CS TC       +Q R+R C++P P+ GG +CDG +    +R C++  +CP+ G W  W     C +    SC  G     R C+ P+P   G+ CEG +E+ + C   I CPV
Sbjct:  186 VDGGWSNWGIWSECSTSCGP-----GVQLRSRTCDDPSPEYGGAECPGSAEDQQQCSVAGCA--INGNWGAWGGWSTCSFTC----GGGIQQRTRTCSDPAPQYGGQECDGATGEQEARTCNH-DECPVHGAWSSWEDWTSCSA----SCGPGVSIRTRLCDNPTPLNGGESCEGNQEESDAC-VDIPCPV 359          

HSP 5 Score: 93.2041 bits (230), Expect = 3.719e-16
Identity = 51/122 (41.80%), Postives = 63/122 (51.64%), Query Frame = 1
Query:  397 VDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYL 762
            V+G W SW  WS CS++C       GL TR R C+ PPP  GG  C G F++   C + PC  PI G+WS W  W  CS TC       L+ RSR C NP P   G +C G    +  C+ L
Sbjct:  473 VNGSWASWNHWSDCSVSCG-----LGLTTRTRNCSDPPPMYGGLICAGEFSDNTTCNDGPC--PIDGSWSPWGYWGECSATC----GGGLKTRSRTCTNPQPLHDGTQCVGNDRVNITCNIL 583          

HSP 6 Score: 68.9366 bits (167), Expect = 1.955e-8
Identity = 64/244 (26.23%), Postives = 96/244 (39.34%), Query Frame = 1
Query:  775 IDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPVTLQPPLNLHLTGNGSGLFNVSWSSVPYGKLASTYRIYKTIEDESNR------EIKTNYEDHNALPNKKITSMNYWAIIDLRNLLSLNTFQTLAVRMSSID----FWKEESSLSNPVRSKVRA-----VDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSCY 1461
            +DG W  W I   C +    SC  G Q   R C+ PSP   G  C G  E  + C    GC +            NG+      WS+  +       +  +T  D + +      +  T  ++     + +      W+  +     S +    +++R    D        ES   N   S         VDG WS+WS WS+CSA C+  +G RT  R C+NP+P   G PC G +E +  C+
Sbjct:  186 VDGGWSNWGIWSECST----SCGPGVQLRSRTCDDPSPEYGGAECPGSAEDQQQC-SVAGCAI------------NGNWGAWGGWSTCSFTCGGGIQQRTRTCSDPAPQYGGQECDGATGEQEARTCNHDECPVHGAWSSWEDWTSCSASCGPGVSIRTRLCDNPTPLNGGESCEGNQEESDACVDIPCPVDGNWSAWSAWSECSASCN--HGNRTHFRSCDNPTPAYNGLPCEGEAEAQEECF 410          
BLAST of Hemicentin-1 vs. TrEMBL
Match: A0A3M6URB4 (Uncharacterized protein OS=Pocillopora damicornis OX=46731 GN=pdam_00011446 PE=4 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 4.536e-39
Identity = 86/190 (45.26%), Postives = 109/190 (57.37%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPV 963
            PVDG WG W+ WS C+ TC     + G  +R R+CN+P PQ GGK C G   ET  C N   P P+ GNW EW EWS C+KTCR  +    Q RSR CN+P PK GG KC GE + ++ C+    CP+DG WG+W     C     K+C  G Q   R+CN PSP   GK C+G  ++ + C   + CPV
Sbjct:  329 PVDGNWGEWSEWSSCTKTC-----KQGKQSRTRVCNAPAPQYGGKKCDGEGKETQVC-NDKVPCPVDGNWGEWGEWSTCTKTCRQGK----QSRSRECNSPAPKYGGKKCAGEGMETQVCNDKVPCPVDGNWGKWSEWSTC----TKTCKQGKQSRTRECNSPSPQYGGKKCDGDGKETQVCNDKVPCPV 504          

HSP 2 Score: 159.844 bits (403), Expect = 5.416e-38
Identity = 113/369 (30.62%), Postives = 167/369 (45.26%), Query Frame = 1
Query:  397 VDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPVTLQPPLNLHLTGNGSG--LFNVSWSSVPYGKLASTYRIYKTIEDESNREIKTNYEDHNALPNKKI--------TSMNYWAIIDLRNLLSLNTFQTLAVRMSSIDFWKE----ESSLSNPVRSKVRA-VDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            VDG WG+W +WS+CS +C       G   R R CN+P P  GGK C G    + +C  + CPV   GNW EWS+WS CSK+C+  +    Q R+R CN+P  + GG  C G+   +R C+    CP++G WG+W     C     K+C  G Q  +R+CN P+P   GK CEG    +  C   + CP          + GN  G   ++    +   GK + T +    I     R+          + N+K+           + W+    +        +T      +  +  +    E   +     KV   VDG W  W  WS C+  C +  G ++R+R+CN+P+P+ GGK C G   E   C
Sbjct:   99 VDGNWGNWGSWSECSKSCGG-----GRQGRKRECNNPKPAYGGKACPGTSASSRDCNTNECPV--DGNWGEWSQWSTCSKSCKQGK----QSRTRKCNSPAAQYGGKACKGDGEETRVCNNDVPCPVNGNWGQWGQWSAC----TKTCKEGKQSRKRECNSPTPQYGGKACEGKAVGIRICNANVPCP----------VDGNWGGWSEWSTCTKTCKQGKQSRTRKCNSPIPQYGGRKC-DGQSSQTQICNQKVPCPVDGNWGEWSEWSSC-TKTCKQGKQSRTRVCNAPAPQYGGKKCDGEGKETQVCNDKVPCPVDGNWGEWGEWSTCTKTCRQ--GKQSRSRECNSPAPKYGGKKCAGEGMETQVC 438          

HSP 3 Score: 158.688 bits (400), Expect = 1.307e-37
Identity = 84/190 (44.21%), Postives = 109/190 (57.37%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPV 963
            PVDG WG W+ WS C+ TC     + G  +R R CNSP PQ GG+ C G  ++T  C N   P P+ GNW EWSEWS+C+KTC+  +    Q R+R+CN P P+ GG KCDGE   ++ C+    CP+DG WGEW     C     K+C  G Q   R+CN P+P   GK C G   + + C   + CPV
Sbjct:  271 PVDGNWGGWSEWSTCTKTC-----KQGKQSRTRKCNSPIPQYGGRKCDGQSSQTQIC-NQKVPCPVDGNWGEWSEWSSCTKTCKQGK----QSRTRVCNAPAPQYGGKKCDGEGKETQVCNDKVPCPVDGNWGEWGEWSTC----TKTCRQGKQSRSRECNSPAPKYGGKKCAGEGMETQVCNDKVPCPV 446          

HSP 4 Score: 151.754 bits (382), Expect = 2.900e-35
Identity = 81/190 (42.63%), Postives = 107/190 (56.32%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPV 963
            PVDG WG W  WS C+ TC     + G  +R R CNSP P+ GGK C G   ET  C N   P P+ GNW +WSEWS C+KTC+  +    Q R+R CN+P P+ GG KCDG+   ++ C+    CP+DG WG W     C     K+C  G Q   R+C+ P+P   G+ CEG  ++ + C   + CPV
Sbjct:  387 PVDGNWGEWGEWSTCTKTC-----RQGKQSRSRECNSPAPKYGGKKCAGEGMETQVC-NDKVPCPVDGNWGKWSEWSTCTKTCKQGK----QSRTRECNSPSPQYGGKKCDGDGKETQVCNDKVPCPVDGNWGGWSEWSTC----TKTCKQGKQSRTRKCDSPAPKYGGRECEGEADENQICNDKVPCPV 562          

HSP 5 Score: 151.754 bits (382), Expect = 3.461e-35
Identity = 82/190 (43.16%), Postives = 107/190 (56.32%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPV 963
            PV+G WG W  WS C+ TC     + G  +R R CNSP PQ GGK C G       C N+  P P+ GNW  WSEWS C+KTC+  +    Q R+R CN+P+P+ GG KCDG+S  ++ C+    CP+DG WGEW     C     K+C  G Q   R CN P+P   GK C+G  ++ + C   + CPV
Sbjct:  213 PVNGNWGQWGQWSACTKTC-----KEGKQSRKRECNSPTPQYGGKACEGKAVGIRIC-NANVPCPVDGNWGGWSEWSTCTKTCKQGK----QSRTRKCNSPIPQYGGRKCDGQSSQTQICNQKVPCPVDGNWGEWSEWSSC----TKTCKQGKQSRTRVCNAPAPQYGGKKCDGEGKETQVCNDKVPCPV 388          

HSP 6 Score: 148.288 bits (373), Expect = 4.440e-34
Identity = 82/198 (41.41%), Postives = 109/198 (55.05%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPVTLQPPLNL 987
            PVDG WG W+ WS C+ TC     + G  +R R CNSP PQ GGK C G   ET  C N   P P+ GNW  WSEWS C+KTC+  +    Q R+R C++P PK GG +C+GE+  ++ C+    CP+DG WG+W     C     K+C  G Q   R C+ P P   GK C+G  E  +  W   G   + +P L++
Sbjct:  445 PVDGNWGKWSEWSTCTKTC-----KQGKQSRTRECNSPSPQYGGKKCDGDGKETQVC-NDKVPCPVDGNWGGWSEWSTCTKTCKQGK----QSRTRKCDSPAPKYGGRECEGEADENQICNDKVPCPVDGNWGQWGAWNTCS----KTCKEGKQSRTRACDSPKPQYGGKKCDG--ESGQTQWMETG--ASGEPGLHV 624          

HSP 7 Score: 147.902 bits (372), Expect = 6.673e-34
Identity = 79/190 (41.58%), Postives = 106/190 (55.79%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPV 963
            PVDG WG W+ WS CS +C     + G  +R R CNSP  Q GGK C G   ET  C N+  P P++GNW +W +WSAC+KTC+  +    Q R R CN+P P+ GG  C+G+++  R C+    CP+DG WG W     C     K+C  G Q   R+CN P P   G+ C+G   + + C   + CPV
Sbjct:  155 PVDGNWGEWSQWSTCSKSC-----KQGKQSRTRKCNSPAAQYGGKACKGDGEETRVC-NNDVPCPVNGNWGQWGQWSACTKTCKEGK----QSRKRECNSPTPQYGGKACEGKAVGIRICNANVPCPVDGNWGGWSEWSTC----TKTCKQGKQSRTRKCNSPIPQYGGRKCDGQSSQTQICNQKVPCPV 330          
BLAST of Hemicentin-1 vs. TrEMBL
Match: A0A3P9HHB8 (Ig-like domain-containing protein OS=Oryzias latipes OX=8090 PE=4 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 7.783e-39
Identity = 121/361 (33.52%), Postives = 155/361 (42.94%), Query Frame = 1
Query:  397 VDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPVTLQPPLNLHLTGNGSGLFNVSWSSVPYGKLASTYRIYKTIEDESNREIKTNYEDHNALPNKKITS----MNYWAIIDLRN---LLSLNTFQTLAVRMSSIDFWKEESSLSNPVRSKVRAVDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            VDG W  W+ W +CS TC       G  TRFR C++P PQ GGK C G   E   C   PCPV   GNW  W  W  CS+TC       +Q R RLCNNP P+  G +C+G    S+ C     CP+ G+W  W   GPC      SC  G+++  R C  P+P   G+ CEG    ++ C     CP+          +GN             +G  +S     KT      R  +T      A   +        M   +I+       L  +N+F+  +      D W     L N  R     VDG WSSW  W  CS  C    G RTR R CNNP+P  GG+ C G+S     C
Sbjct:   75 VDGNWSEWSVWEECSQTCGQ-----GNRTRFRTCSNPEPQYGGKRCEGKAVEVIMCSVRPCPV--AGNWGSWLPWGPCSETC----GRGMQSRIRLCNNPPPQFDGSQCEGTDTQSKMC-LERLCPVHGKWSSWMNWGPCS----VSCGGGTRQRTRLCANPAPQHGGRSCEGNGVHMDFC-NTDPCPI----------SGN-------------WGTWSSWGSCSKTCNGGQMRRYRTCDSPRPAFGGRACAGAEEQMQRCSIVSCPGRSALFPVNSFRLFSFWF-VFDVW-----LRNTTR-----VDGNWSSWQPWGQCSVSCG--GGERTRIRLCNNPAPSYGGRQCPGDSSLLSRC 382          

HSP 2 Score: 139.428 bits (350), Expect = 9.039e-33
Identity = 77/189 (40.74%), Postives = 98/189 (51.85%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCP 960
            PV G WGSW  W  CS TC       G+ +R RLCN+PPPQ  G  C G  T++  C    CPV  HG WS W  W  CS +C        + R+RLC NP P+ GG  C+G  ++  FC+  P CPI G WG W   G C     K+C  G  R  R C+ P P   G+ C G +E+++ C   + CP
Sbjct:  131 PVAGNWGSWLPWGPCSETCGR-----GMQSRIRLCNNPPPQFDGSQCEGTDTQSKMCLERLCPV--HGKWSSWMNWGPCSVSC----GGGTRQRTRLCANPAPQHGGRSCEGNGVHMDFCNTDP-CPISGNWGTWSSWGSCS----KTCNGGQMRRYRTCDSPRPAFGGRACAGAEEQMQRC-SIVSCP 302          
BLAST of Hemicentin-1 vs. TrEMBL
Match: A0A210Q4U0 (Hemicentin-1 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT12649 PE=4 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 1.497e-38
Identity = 115/371 (31.00%), Postives = 164/371 (44.20%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPV-PIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPVTLQPPLNLHLTGNGSGLFNVSWSSVPYGKLASTYRIYKTIEDESNRE-----IKTNYEDHNALPNKKITSMNYWAIIDLRNLLSLNTFQTLAVRMSSID----------FWKEESSLSNPVRSKVRAVDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            PVDG WG W +W+ CS++C     + G  TR R CN+P P   G+ C+G   E++ C  SP  + PI G W  W++W  CS +C +      + RSR CNNP P   G  C GE  +S  C     CPIDGQW  W     C +    SC  G++   RQCN P+P  +G  C G +  LE C   I CP+  Q            GL+N  W+S        T    +     +        +    E     P        +W + D  +  S++       R    +           + ++      +   +  +DG+WS W+ W+ CS  C  ENG RTR+R CNNP+P   G+ C G+ +E   C
Sbjct:  281 PVDGQWGLWNSWTSCSVSC-----ENGTRTRTRRCNNPAPAYNGRPCSGDERESEGC--SPGIMCPIDGQWGVWNDWMPCSVSCDIG----TRTRSRQCNNPAPAHNGRTCLGEQNDSEACSPGIMCPIDGQWSSWNGWSSCSA----SCENGTRTRSRQCNNPAPAHNGHTCPGNEHDLEGCTAGIMCPIDGQ-----------WGLWN-GWTSCSVSCENGTRTRSRQCNSPAPAHNGGACLGDQNESEACSPGIMCPIDGHWGLWDDWSSCSVSCENGTRTRYRQCNNPAPAHNGRSCFGDQDESERCISGIMCPIDGQWSHWNDWTSCSVSC--ENGTRTRSRQCNNPAPAHNGRSCLGDQDESEGC 622          

HSP 2 Score: 147.517 bits (371), Expect = 7.960e-34
Identity = 117/375 (31.20%), Postives = 162/375 (43.20%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPV-PIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPVTLQPPLNLHLTGNGSGLFNVSWSSVPYGKLASTYRIYKTI---------------EDESNREIKTNYEDHNALPNKKITSMNYWAI--IDLRNLLSLNTFQ--TLAVRMSSIDFWKEESSLSNPVRSKVRAVDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            P+DG WG W  W  CS++C       G  TR R CN+P P   G+ C G   +++ C  SP  + PI G WS W+ WS+CS +C        + RSR CNNP P   G  C G   +   C     CPIDGQWG W     C      SC  G++   RQCN P+P  +G  C G + + E C   I CP+      + H      GL++  WSS        T   Y+                 +DES R I           + + +  N W    +   N     + Q    A   +      ++          +  +DG+W  W+ W+ CS  C  ENG RTR+R CNNP+P   G+ C+G+ +E   C
Sbjct:  339 PIDGQWGVWNDWMPCSVSC-----DIGTRTRSRQCNNPAPAHNGRTCLGEQNDSEAC--SPGIMCPIDGQWSSWNGWSSCSASCE----NGTRTRSRQCNNPAPAHNGHTCPGNEHDLEGCTAGIMCPIDGQWGLWNGWTSC----SVSCENGTRTRSRQCNSPAPAHNGGACLGDQNESEACSPGIMCPI------DGHW-----GLWD-DWSSCSVSCENGTRTRYRQCNNPAPAHNGRSCFGDQDESERCISGIM----CPIDGQWSHWNDWTSCSVSCENGTRTRSRQCNNPAPAHNGRSCLGDQDESEGCTSGIMCPIDGQWGVWNGWTSCSVSC--ENGTRTRSRQCNNPTPVHNGRSCSGDQDESEGC 680          

HSP 3 Score: 138.658 bits (348), Expect = 8.846e-31
Identity = 110/371 (29.65%), Postives = 160/371 (43.13%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPV-PIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPVTLQPPLNLHLTGNGSGLFNVSWSSVPY----GKLASTYRIYKTIEDESNREIKTNYEDHNALPNKKITSMN-YWA--------IIDLRNLLSLNTFQ--TLAVRMSSIDFWKEESSLSNPVRSKVRAVDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            P+DG WG W  W+ CS++C     + G  TR R CNSP P   G  C G   E++ C  SP  + PI G+W  W +WS+CS +C        + R R CNNP P   G  C G+   S  C     CPIDGQW  W     C      SC  G++   RQCN P+P  +G+ C G +++ E      GC   +  P++        G++N  W+S       G    + +        + R    + ++     +  +  ++  W+         +   N     + Q    A   +      E  S        +  VDG+W  W+ WS CS  C  E G + R+R+C++P P   G  C GNS E  SC
Sbjct:  455 PIDGQWGLWNGWTSCSVSC-----ENGTRTRSRQCNSPAPAHNGGACLGDQNESEAC--SPGIMCPIDGHWGLWDDWSSCSVSCE----NGTRTRYRQCNNPAPAHNGRSCFGDQDESERCISGIMCPIDGQWSHWNDWTSC----SVSCENGTRTRSRQCNNPAPAHNGRSCLGDQDESE------GCTSGIMCPIDGQW-----GVWN-GWTSCSVSCENGTRTRSRQCNNPTPVHNGRSCSGDQDESEGCTSGIMCPIDGQWSQWTGWTPCSVSCENGTRTRSRQCNNPAPAHNGHSCPGEGDSSEECTPGIMCPVDGQWGKWTEWSSCSVTC--ECGEKIRSRECDSPYPEHDGMACTGNSSETASC 796          

HSP 4 Score: 124.405 bits (311), Expect = 4.158e-26
Identity = 71/189 (37.57%), Postives = 95/189 (50.26%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCP 960
            P+DG WG W  W+ CS++C     + G  TR R CN+P P   G++C+G   E++ C  S    PI G WS+W+ W+ CS +C        + RSR CNNP P   G  C GE  +S  C     CP+DGQWG+W     C      +C  G +   R+C+ P P  DG  C G   +   C   I CP
Sbjct:  629 PIDGQWGVWNGWTSCSVSC-----ENGTRTRSRQCNNPTPVHNGRSCSGDQDESEGC-TSGIMCPIDGQWSQWTGWTPCSVSCE----NGTRTRSRQCNNPAPAHNGHSCPGEGDSSEECTPGIMCPVDGQWGKWTEWSSC----SVTCECGEKIRSRECDSPYPEHDGMACTGNSSETASCGADILCP 803          

HSP 5 Score: 107.071 bits (266), Expect = 1.767e-20
Identity = 103/363 (28.37%), Postives = 146/363 (40.22%), Query Frame = 1
Query:  412 GSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPVTLQPPLNLHLTGNGSGLFNVSWSSVPYGKLASTYRIYKTIEDESNREIKTNYEDHNALPNKKITSMN-YWAIIDLRNLLSLNTFQTLAVRM-------------SSIDFWKEESSLSNPVRSKVRAVDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            GSWTT + C++TC       G + R   C+       G  CT   TE   C    CPV   G W  W+ W++CS +C        + R+R CNNP P   G  C G+   S  C     CPIDGQWG W    PC      SC +G++   RQCN P+P  +G+ C G +   E C   I CP+  Q       + NG   ++   +S   G    + +        +      N  D        +  ++  W + +     S++       R              + +    E  + S  +   +    G W  W   S CS  C  ENG RTR R CNNP+P   G+ C G+ +E   C
Sbjct:  239 GSWTT-TPCTVTCGG-----GTIQRLITCS-------GDGCT-PRTELLPCGTMTCPV--DGQWGLWNSWTSCSVSCE----NGTRTRTRRCNNPAPAYNGRPCSGDERESEGCSPGIMCPIDGQWGVWNDWMPC----SVSCDIGTRTRSRQCNNPAPAHNGRTCLGEQNDSEACSPGIMCPIDGQ-----WSSWNG---WSSCSASCENGTRTRSRQCNNPAPAHNGHTCPGNEHDLEGCTAGIMCPIDGQWGLWNGWTSCSVSCENGTRTRSRQCNSPAPAHNGGACLGDQNESEACSPGIMCPIDGHWGLWDDW---SSCSVSC--ENGTRTRYRQCNNPAPAHNGRSCFGDQDESERC 564          
BLAST of Hemicentin-1 vs. Ensembl Cavefish
Match: ENSAMXT00000044661.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001762.1:6524:8010:-1 gene:ENSAMXG00000044078.1 transcript:ENSAMXT00000044661.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 117.087 bits (292), Expect = 5.206e-29
Identity = 71/179 (39.66%), Postives = 88/179 (49.16%), Query Frame = 1
Query:  406 MWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVP-IHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDC 939
            +W SW +W  CS++C       G   R RLC SP PQ GG+ C G     D   N P   P ++GNW  WS W +CS+TC   Q      R R C NP P +GG  C G     + C     CP+DG WG W   G C +    SC  G Q+  R CN PSP+  G+PC G   +L  C
Sbjct:  102 LWSSWVSWGPCSVSCGG-----GTRQRTRLCASPAPQHGGRQCEGNDIHIDF-SNYPFTAPTVNGNWGPWSSWGSCSRTCNGGQ----MRRYRTCENPRPANGGRACAGADTEIQKCS-TESCPVDGNWGLWQPWGECSA----SCGSGEQKRVRICNSPSPSNKGRPCPGDSTQLSKC 265          

HSP 2 Score: 103.219 bits (256), Expect = 3.956e-24
Identity = 66/209 (31.58%), Postives = 89/209 (42.58%), Query Frame = 1
Query:  397 VDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCP---------------------------VPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCP-IDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDC 939
            V G WG+W  WS CS TC       G+ TR RLCN+PPP   G  C G  T+T  C    CP                           +     WS W  W  CS +C        + R+RLC +P P+ GG +C+G  ++  F +Y    P ++G WG W   G C     ++C  G  R  R C  P P   G+ C G   +++ C
Sbjct:   13 VAGNWGAWLPWSPCSETCGK-----GMQTRIRLCNNPPPSFDGPPCKGAETQTQVCTERNCPGKKLNIQYSPKTGLQKCQLTSRRSDKTIDCSDLWSSWVSWGPCSVSC----GGGTRQRTRLCASPAPQHGGRQCEGNDIHIDFSNYPFTAPTVNGNWGPWSSWGSCS----RTCNGGQMRRYRTCENPRPANGGRACAGADTEIQKC 208          

HSP 3 Score: 87.0409 bits (214), Expect = 1.473e-18
Identity = 54/138 (39.13%), Postives = 68/138 (49.28%), Query Frame = 1
Query:  361 VSPYIAIAPNEPVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCP 774
             S Y   AP   V+G WG W++W  CS TC+      G M R+R C +P P  GG+ C G  TE   C    CPV   GNW  W  W  CS +C     +  Q R R+CN+P P + G  C G+S     C+  P CP
Sbjct:  148 FSNYPFTAPT--VNGNWGPWSSWGSCSRTCNG-----GQMRRYRTCENPRPANGGRACAGADTEIQKCSTESCPV--DGNWGLWQPWGECSASC----GSGEQKRVRICNSPSPSNKGRPCPGDSTQLSKCNIRP-CP 271          

HSP 4 Score: 77.411 bits (189), Expect = 2.818e-15
Identity = 84/320 (26.25%), Postives = 112/320 (35.00%), Query Frame = 1
Query:  583 VPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDY-----------------LPQCPIDGQ-----------WGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPVTLQPPLNLHLTGNGSGLFNVSWSSVPYGKLASTYRIYKTIEDESNREIKTNYEDHNALPNKKITSMNYWAIIDLRNLLSLNTFQTLAVRMSSIDFWKEESSLSNPVRSKVRAVDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            + + GNW  W  WS CS+TC       +Q R RLCNNP P   G  C G    ++ C                   L +C +  +           W  W   GPC      SC  G+++  R C  P+P   G+ CEG    ++    F   P T         T NG+     SW S          R Y+T E                                  N    N  +  A   + I     ES            VDG W  W  W +CSA C   +G + R R CN+PSP + G+PC G+S +   C
Sbjct:   11 LSVAGNWGAWLPWSPCSETC----GKGMQTRIRLCNNPPPSFDGPPCKGAETQTQVCTERNCPGKKLNIQYSPKTGLQKCQLTSRRSDKTIDCSDLWSSWVSWGPCSV----SCGGGTRQRTRLCASPAPQHGGRQCEGNDIHID----FSNYPFTAP-------TVNGNWGPWSSWGSCSRTCNGGQMRRYRTCE----------------------------------NPRPANGGRACAGADTEIQKCSTESC----------PVDGNWGLWQPWGECSASCG--SGEQKRVRICNSPSPSNKGRPCPGDSTQLSKC 265          
BLAST of Hemicentin-1 vs. Ensembl Cavefish
Match: thbs1a (thrombospondin 1a [Source:ZFIN;Acc:ZDB-GENE-120402-2])

HSP 1 Score: 122.479 bits (306), Expect = 6.749e-29
Identity = 63/128 (49.22%), Postives = 79/128 (61.72%), Query Frame = 1
Query:  400 DGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDG 783
            DG W  W+ WS CS+TC       G++TR RLCNSP PQ+GG++C G   +T+ C  SPCPV  +G W  WS W  CS TC       LQ R RLCNNP+PK GG +C G++  +R C+    CPIDG
Sbjct:  405 DGGWSHWSPWSSCSVTCGE-----GVITRIRLCNSPTPQMGGRDCQGEGRQTEPCKMSPCPV--NGGWGPWSLWDTCSVTC----GGGLQTRHRLCNNPMPKHGGKECVGDAKGTRLCNS-EDCPIDG 520          

HSP 2 Score: 63.1586 bits (152), Expect = 5.107e-10
Identity = 30/64 (46.88%), Postives = 37/64 (57.81%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPV 585
            PV+G WG W+ W  CS+TC       GL TR RLCN+P P+ GGK C G    T  C +  CP+
Sbjct:  460 PVNGGWGPWSLWDTCSVTCGG-----GLQTRHRLCNNPMPKHGGKECVGDAKGTRLCNSEDCPI 518          

HSP 3 Score: 56.225 bits (134), Expect = 7.273e-8
Identity = 44/157 (28.03%), Postives = 54/157 (34.39%), Query Frame = 1
Query:  601 WSEWSEWSACSKTCRLP---------------QSAPLQVRS-------------------------------------RLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEG 915
            WS WSEW+ CS TC                  +   +Q R                                      RLCN+P P+ GG  C GE   +  C   P CP++G WG W +   C      +C  G Q   R CN P P   GK C G
Sbjct:  352 WSPWSEWTHCSVTCGRGIQQRGRSCDRINSNCEGTSVQTRDCYLQECDKRFRQDGGWSHWSPWSSCSVTCGEGVITRIRLCNSPTPQMGGRDCQGEGRQTEPCKMSP-CPVNGGWGPWSLWDTCSV----TCGGGLQTRHRLCNNPMPKHGGKECVG 503          

HSP 4 Score: 49.6766 bits (117), Expect = 7.132e-6
Identity = 26/67 (38.81%), Postives = 35/67 (52.24%), Query Frame = 1
Query: 1258 ESSLSNPVRSKVRAVDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            E   + P +     V+G W  WS W  CS  C    G +TR+R CNNP P+ GGK C G+++    C
Sbjct:  447 EGRQTEPCKMSPCPVNGGWGPWSLWDTCSVTCG--GGLQTRHRLCNNPMPKHGGKECVGDAKGTRLC 511          
BLAST of Hemicentin-1 vs. Ensembl Cavefish
Match: thbs1a (thrombospondin 1a [Source:ZFIN;Acc:ZDB-GENE-120402-2])

HSP 1 Score: 122.479 bits (306), Expect = 6.829e-29
Identity = 63/128 (49.22%), Postives = 79/128 (61.72%), Query Frame = 1
Query:  400 DGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDG 783
            DG W  W+ WS CS+TC       G++TR RLCNSP PQ+GG++C G   +T+ C  SPCPV  +G W  WS W  CS TC       LQ R RLCNNP+PK GG +C G++  +R C+    CPIDG
Sbjct:  439 DGGWSHWSPWSSCSVTCGE-----GVITRIRLCNSPTPQMGGRDCQGEGRQTEPCKMSPCPV--NGGWGPWSLWDTCSVTC----GGGLQTRHRLCNNPMPKHGGKECVGDAKGTRLCNS-EDCPIDG 554          

HSP 2 Score: 63.1586 bits (152), Expect = 4.834e-10
Identity = 30/64 (46.88%), Postives = 37/64 (57.81%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPV 585
            PV+G WG W+ W  CS+TC       GL TR RLCN+P P+ GGK C G    T  C +  CP+
Sbjct:  494 PVNGGWGPWSLWDTCSVTCGG-----GLQTRHRLCNNPMPKHGGKECVGDAKGTRLCNSEDCPI 552          

HSP 3 Score: 56.225 bits (134), Expect = 7.316e-8
Identity = 44/157 (28.03%), Postives = 54/157 (34.39%), Query Frame = 1
Query:  601 WSEWSEWSACSKTCRLP---------------QSAPLQVRS-------------------------------------RLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEG 915
            WS WSEW+ CS TC                  +   +Q R                                      RLCN+P P+ GG  C GE   +  C   P CP++G WG W +   C      +C  G Q   R CN P P   GK C G
Sbjct:  386 WSPWSEWTHCSVTCGRGIQQRGRSCDRINSNCEGTSVQTRDCYLQECDKRFRQDGGWSHWSPWSSCSVTCGEGVITRIRLCNSPTPQMGGRDCQGEGRQTEPCKMSP-CPVNGGWGPWSLWDTCSV----TCGGGLQTRHRLCNNPMPKHGGKECVG 537          

HSP 4 Score: 50.0618 bits (118), Expect = 6.311e-6
Identity = 26/67 (38.81%), Postives = 35/67 (52.24%), Query Frame = 1
Query: 1258 ESSLSNPVRSKVRAVDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            E   + P +     V+G W  WS W  CS  C    G +TR+R CNNP P+ GGK C G+++    C
Sbjct:  481 EGRQTEPCKMSPCPVNGGWGPWSLWDTCSVTCG--GGLQTRHRLCNNPMPKHGGKECVGDAKGTRLC 545          
BLAST of Hemicentin-1 vs. Ensembl Cavefish
Match: thbs1b (thrombospondin-1-like [Source:NCBI gene;Acc:103031445])

HSP 1 Score: 118.627 bits (296), Expect = 1.379e-27
Identity = 62/128 (48.44%), Postives = 77/128 (60.16%), Query Frame = 1
Query:  400 DGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDG 783
            DG W  W+ WS CS+TC S     G++TR RLCNSP PQ+GGK+C G   +T+ C  SPC  PI+G W  WS W  CS TC        Q R RLCN+P PK GG  C G++  ++ C+    CPIDG
Sbjct:  443 DGNWSHWSPWSSCSVTCGS-----GVITRIRLCNSPTPQMGGKDCQGQGRQTEKCEKSPC--PINGGWGPWSPWDKCSLTC----GGGTQSRKRLCNDPAPKYGGKDCVGDATATQICNK-QACPIDG 558          

HSP 2 Score: 102.449 bits (254), Expect = 2.155e-22
Identity = 63/188 (33.51%), Postives = 89/188 (47.34%), Query Frame = 1
Query:  382 APNEPVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCP--VPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDC 939
             P++  +  W  W+ W+ CS++C       G+  R R C+         NC G   +T +C+   C       GNWS WS WS+CS TC     + +  R RLCN+P P+ GG  C G+   +  C+  P CPI+G WG W     C      +C  G+Q  +R CN P+P   GK C G     + C
Sbjct:  381 TPSDSAEDGWSPWSEWTHCSVSCGR-----GIQQRGRSCDRI-----NNNCEGTSVQTRDCYLQECDKRFKQDGNWSHWSPWSSCSVTC----GSGVITRIRLCNSPTPQMGGKDCQGQGRQTEKCEKSP-CPINGGWGPWSPWDKC----SLTCGGGTQSRKRLCNDPAPKYGGKDCVGDATATQIC 549          

HSP 3 Score: 64.3142 bits (155), Expect = 2.395e-10
Identity = 29/64 (45.31%), Postives = 37/64 (57.81%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPV 585
            P++G WG W+ W KCS+TC       G  +R RLCN P P+ GGK+C G  T T  C    CP+
Sbjct:  498 PINGGWGPWSPWDKCSLTCGG-----GTQSRKRLCNDPAPKYGGKDCVGDATATQICNKQACPI 556          
BLAST of Hemicentin-1 vs. Ensembl Cavefish
Match: thbs2b (thrombospondin 2 [Source:NCBI gene;Acc:103028711])

HSP 1 Score: 115.161 bits (287), Expect = 1.826e-26
Identity = 61/128 (47.66%), Postives = 78/128 (60.94%), Query Frame = 1
Query:  400 DGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDG 783
            DG W  W+ WS CS+TC       G++TR R CNSP PQ GGK+C G   ET +C   PC  PI G W  WS W++CS TC       L+ R R CN+PVP+ GG KC G+S+ +  C+ L +CPI+G
Sbjct:  447 DGGWSLWSPWSACSVTCGE-----GVITRIRHCNSPIPQRGGKDCEGEGRETQSCQAEPC--PIDGGWGPWSPWASCSATC----GGGLKSRERECNSPVPQHGGRKCMGDSVENEVCNKL-ECPING 562          

HSP 2 Score: 61.2326 bits (147), Expect = 2.273e-9
Identity = 29/64 (45.31%), Postives = 36/64 (56.25%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPV 585
            P+DG WG W+ W+ CS TC       GL +R R CNSP PQ GG+ C G   E + C    CP+
Sbjct:  502 PIDGGWGPWSPWASCSATCGG-----GLKSRERECNSPVPQHGGRKCMGDSVENEVCNKLECPI 560          

HSP 3 Score: 52.7582 bits (125), Expect = 9.331e-7
Identity = 24/53 (45.28%), Postives = 33/53 (62.26%), Query Frame = 1
Query: 1300 VDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            +DG W  WS W+ CSA C    G ++R R+CN+P P+ GG+ C G+S E   C
Sbjct:  503 IDGGWGPWSPWASCSATCG--GGLKSRERECNSPVPQHGGRKCMGDSVENEVC 553          

HSP 4 Score: 50.8322 bits (120), Expect = 3.238e-6
Identity = 27/52 (51.92%), Postives = 30/52 (57.69%), Query Frame = 1
Query: 1303 DGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            DG WS WS WS CS  C +  G  TR R CN+P P+ GGK C G   E  SC
Sbjct:  447 DGGWSLWSPWSACSVTCGE--GVITRIRHCNSPIPQRGGKDCEGEGRETQSC 496          

HSP 5 Score: 50.8322 bits (120), Expect = 3.620e-6
Identity = 40/124 (32.26%), Postives = 51/124 (41.13%), Query Frame = 1
Query:  580 PVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCP----IDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDC 939
            P+     WS WSEW+ C+ TC     +  Q R R C+     D    C G S+ +R C  L +C      DG W  W     C      +C  G     R CN P P   GK CEG   + + C
Sbjct:  387 PMDSDDGWSPWSEWTQCTVTC----GSGTQQRGRSCD-----DSSNTCSGPSIQTRRCS-LGKCDRRVRQDGGWSLWSPWSACSV----TCGEGVITRIRHCNSPIPQRGGKDCEGEGRETQSC 496          
BLAST of Hemicentin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000072.1 (pep scaffold:Pmarinus_7.0:GL479818:18487:29074:1 gene:ENSPMAG00000000067.1 transcript:ENSPMAT00000000072.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 102.449 bits (254), Expect = 4.171e-25
Identity = 72/182 (39.56%), Postives = 95/182 (52.20%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDC 939
            PV G+WG W+ WS CS TC       GL TR R C+   PQ GG +C G + +T  C  + CPV   G W++WS+WS CS TC        Q RSR C  P+   GG +C G    +R CD  P CP+DG+WG W   G C +    +C  G +  QR+C    P   G  C+G  ++  +C
Sbjct:   50 PVHGVWGEWSPWSLCSYTCG-----RGLRTRMRHCSV--PQHGGSSCEGPYNQTKVCNIALCPV--DGQWADWSKWSTCSVTCE----NGTQQRSRECVGPI--YGGTECVGPGTENRRCDNNP-CPVDGRWGVWAAWGECSA----TCGSGLRWRQRKCW--GPFHGGLLCQGGDKEPANC 209          

HSP 2 Score: 73.1738 bits (178), Expect = 4.918e-15
Identity = 51/127 (40.16%), Postives = 59/127 (46.46%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCP 774
            PVDG W  W+ WS CS+TC     + G   R R C    P  GG  C G  TE   C N+PCPV   G W  W+ W  CS TC     + L+ R R C  P    GGL C G       C   P+CP
Sbjct:  105 PVDGQWADWSKWSTCSVTC-----ENGTQQRSRECVG--PIYGGTECVGPGTENRRCDNNPCPV--DGRWGVWAAWGECSATC----GSGLRWRQRKCWGPF--HGGLLCQGGDKEPANCTN-PRCP 215          

HSP 3 Score: 71.633 bits (174), Expect = 1.531e-14
Identity = 53/155 (34.19%), Postives = 74/155 (47.74%), Query Frame = 1
Query:  418 WTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKP 882
            W+ WS CS +C       G   R R+C +         C+G   E   C +S    P+HG W EWS WS CS TC       L+ R R C+  VP+ GG  C+G    ++ C+ +  CP+DGQW +W     C      +C  G+Q+  R+C  P
Sbjct:    3 WSEWSVCSSSCGE-----GSQVRARVCLASSKSAA---CSGPLREIRVCDSSS-VCPVHGVWGEWSPWSLCSYTC----GRGLRTRMRHCS--VPQHGGSSCEGPYNQTKVCN-IALCPVDGQWADWSKWSTC----SVTCENGTQQRSRECVGP 137          

HSP 4 Score: 50.8322 bits (120), Expect = 1.579e-7
Identity = 41/122 (33.61%), Postives = 52/122 (42.62%), Query Frame = 1
Query:  607 EWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPVTLQ 972
            EWSEWS CS +C        QVR+R+C   +       C G     R CD    CP+ G WGEW     C      +C  G +   R C+   P   G  CEG   + + C   + CPV  Q
Sbjct:    2 EWSEWSVCSSSC----GEGSQVRARVC---LASSKSAACSGPLREIRVCDSSSVCPVHGVWGEWSPWSLC----SYTCGRGLRTRMRHCSV--PQHGGSSCEGPYNQTKVCNIAL-CPVDGQ 109          

HSP 5 Score: 46.2098 bits (108), Expect = 5.696e-6
Identity = 30/65 (46.15%), Postives = 31/65 (47.69%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVP 588
            PVDG WG W  W +CS TC S     GL  R R C  P    GG  C G   E  NC N  CP P
Sbjct:  160 PVDGRWGVWAAWGECSATCGS-----GLRWRQRKCWGP--FHGGLLCQGGDKEPANCTNPRCPGP 217          
BLAST of Hemicentin-1 vs. Ensembl Sea Lamprey
Match: thbs1a (thrombospondin 1a [Source:ZFIN;Acc:ZDB-GENE-120402-2])

HSP 1 Score: 106.301 bits (264), Expect = 2.393e-24
Identity = 58/128 (45.31%), Postives = 70/128 (54.69%), Query Frame = 1
Query:  400 DGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDG 783
            DG W  W+ WS CS+TC +     G+ TR RLCNSP PQ+GG  C G   E   C   PCPV   G +  WS WSAC  TC       L+ R+RLCNNP P+  G  C G    +  C+  P CP+DG
Sbjct:  431 DGGWSFWSPWSSCSVTCGA-----GVNTRIRLCNSPVPQMGGDECDGSGRENQKCEMEPCPV--DGQYGPWSPWSACPVTC----GGALRERARLCNNPKPQYNGKDCLGSDRETEICNKKP-CPVDG 546          

HSP 2 Score: 97.4413 bits (241), Expect = 1.702e-21
Identity = 64/177 (36.16%), Postives = 85/177 (48.02%), Query Frame = 1
Query:  409 WGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDC 939
            W  W+ W++CS+TC S     G   R R C+S      G +  G   +   C      V   G WS WS WS+CS TC     A +  R RLCN+PVP+ GG +CDG    ++ C+  P CP+DGQ+G W     C      +C    +   R CN P P  +GK C G   + E C
Sbjct:  378 WSPWSEWTECSVTCGS-----GTQQRGRSCDSVNNPCEGPSIQGRTCQLKACDKR---VRQDGGWSFWSPWSSCSVTC----GAGVNTRIRLCNSPVPQMGGDECDGSGRENQKCEMEP-CPVDGQYGPWSPWSACPV----TCGGALRERARLCNNPKPQYNGKDCLGSDRETEIC 537          

HSP 3 Score: 64.6994 bits (156), Expect = 3.708e-11
Identity = 31/64 (48.44%), Postives = 37/64 (57.81%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPV 585
            PVDG +G W+ WS C +TC        L  R RLCN+P PQ  GK+C G   ET+ C   PCPV
Sbjct:  486 PVDGQYGPWSPWSACPVTCGGA-----LRERARLCNNPKPQYNGKDCLGSDRETEICNKKPCPV 544          

HSP 4 Score: 47.7506 bits (112), Expect = 6.984e-6
Identity = 25/52 (48.08%), Postives = 29/52 (55.77%), Query Frame = 1
Query: 1303 DGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            DG WS WS WS CS  C    G  TR R CN+P P+ GG  C+G+  E   C
Sbjct:  431 DGGWSFWSPWSSCSVTCGA--GVNTRIRLCNSPVPQMGGDECDGSGRENQKC 480          
BLAST of Hemicentin-1 vs. Ensembl Sea Lamprey
Match: THBS2 (thrombospondin 2 [Source:HGNC Symbol;Acc:HGNC:11786])

HSP 1 Score: 101.679 bits (252), Expect = 7.295e-23
Identity = 56/128 (43.75%), Postives = 70/128 (54.69%), Query Frame = 1
Query:  400 DGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDG 783
            DG W  W+ WS CS++C       G+ TR RLCNSP P LGG+ C G   E   C   PC  PI GNW  W+ WS C  +C       L+  +RLCNNP P+  G KC G+   +  C+   +CPIDG
Sbjct:  409 DGGWSHWSPWSSCSVSCGD-----GVSTRIRLCNSPVPVLGGRECNGQGRENVPCNKEPC--PIDGNWGPWTLWSPCPVSC----GGGLREHTRLCNNPEPQFNGKKCVGDGRETDICNK-EECPIDG 524          

HSP 2 Score: 97.8265 bits (242), Expect = 1.167e-21
Identity = 69/217 (31.80%), Postives = 98/217 (45.16%), Query Frame = 1
Query:  298 LCICMICSVIGSIVACMTSHRVSPY-IAIAPNEPVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCP--VPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDC 939
            +C  + CS +  + A +      P  I +   E     W  W+ W++CS++C +     G   R R C+          C G   +   C    C   V   G WS WS WS+CS +C       +  R RLCN+PVP  GG +C+G+   +  C+  P CPIDG WG W +  PC      SC  G + + R CN P P  +GK C G   + + C
Sbjct:  322 MCRQLSCSPVACMNAVVLEGECCPTCITVDKGE----GWSPWSEWTECSVSCGT-----GSQQRGRSCDRI-----SSTCEGPSIQIRKCHTKSCDKRVKRDGGWSHWSPWSSCSVSC----GDGVSTRIRLCNSPVPVLGGRECNGQGRENVPCNKEP-CPIDGNWGPWTLWSPCPV----SCGGGLREHTRLCNNPEPQFNGKKCVGDGRETDIC 515          

HSP 3 Score: 64.6994 bits (156), Expect = 3.759e-11
Identity = 30/64 (46.88%), Postives = 35/64 (54.69%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPV 585
            P+DG WG WT WS C ++C       GL    RLCN+P PQ  GK C G   ETD C    CP+
Sbjct:  464 PIDGNWGPWTLWSPCPVSCGG-----GLREHTRLCNNPEPQFNGKKCVGDGRETDICNKEECPI 522          

HSP 4 Score: 51.2174 bits (121), Expect = 4.797e-7
Identity = 27/52 (51.92%), Postives = 30/52 (57.69%), Query Frame = 1
Query: 1303 DGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            DG WS WS WS CS  C   +G  TR R CN+P P  GG+ CNG   E V C
Sbjct:  409 DGGWSHWSPWSSCSVSCG--DGVSTRIRLCNSPVPVLGGRECNGQGRENVPC 458          
BLAST of Hemicentin-1 vs. Ensembl Sea Lamprey
Match: cfp (complement factor properdin [Source:ZFIN;Acc:ZDB-GENE-030131-9247])

HSP 1 Score: 97.4413 bits (241), Expect = 3.030e-22
Identity = 64/170 (37.65%), Postives = 81/170 (47.65%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLG--GKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKC----DGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRD--QKSC--ALGSQRYQRQC 873
            P  G WGSW +W +CS TC        +  R R C+SP P L   G  C G   +T  C +   P P+ G W  WS WS CS TC L      +V +RLC++P P+ GG  C    DG    +  CD   +CP DG+W EW     C S    +  C   +G Q  QR C
Sbjct:  117 PTHGAWGSWLSWGECSKTCRDDGA---VRRRSRACDSPAPSLAPAGSQCPGASQDTGPCLDLD-PCPVDGAWGGWSGWSGCSVTCGL----GTRVHTRLCDSPAPRYGGRLCPGSEDGRQSQAELCDSHNKCPADGKWTEWSSWSTCMSNTPYENRCRPRVGKQTMQRIC 278          

HSP 2 Score: 75.0998 bits (183), Expect = 7.953e-15
Identity = 60/174 (34.48%), Postives = 77/174 (44.25%), Query Frame = 1
Query:  349 TSHRVSPYIAIAPNEPVDGMWGSWTTWSKCSITCSSVDVQYGLMTRF--RLCNSPPPQLGGKNC----TGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTC----RLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQC---------PIDGQWGEWYIAGP 813
             S    P + + P  PVDG WG W+ WS CS+TC       GL TR   RLC+SP P+ GG+ C     G  ++ + C +S    P  G W+EWS WS C        R       Q   R+C     ++ G  C GE    R C  L  C         P  G+WGEW +  P
Sbjct:  165 ASQDTGPCLDLDPC-PVDGAWGGWSGWSGCSVTC-------GLGTRVHTRLCDSPAPRYGGRLCPGSEDGRQSQAELC-DSHNKCPADGKWTEWSSWSTCMSNTPYENRCRPRVGKQTMQRICMG--QEEEGTACIGEGFIIRACYNLENCTARELKVKNPEWGEWGEWSLCQP 327          

HSP 3 Score: 69.707 bits (169), Expect = 3.861e-13
Identity = 93/368 (25.27%), Postives = 132/368 (35.87%), Query Frame = 1
Query:  415 SWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCF-----NSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPN--ADGKPCEGIKEKLEDCWFFIGCPVTLQPPLNLHLTGNGSGLFNVSWSSVPYG-----------KLASTYRIYKTIEDESNREIKTNYED-HNALP-NKKITSMNYWAIIDLRNLLSLNTFQTLAVR--MSSIDFWKEESS---------------LSNPVRSKVRAVDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSP 1407
            +W+ WS CS +C S     G+ +R ++C      +G   C  +    D  F     N+    P+ G W  W +WSACS TC   Q    + R+R C        G++CDG    S  C     CP  G WG W   G C    +   A+  +R  R C+ P+P+    G  C G  +    C     CPV           G   G    S  SV  G             A  Y        E  R+ +    D HN  P + K T  + W+   + N    N  +    +  M  I   +EE                 L N    +++  + +W  W  WS C   C + +    R R C  P P
Sbjct:   11 AWSDWSPCSASCGS-----GVSSRAKVC------IGTGACNELHP-LDQRFQVRICNAGVCCPVRGAWGSWGQWSACSVTCEAGQ----KRRTRTCEGA--HACGVRCDGPGSESVACQTGQICPTHGAWGSWLSWGECSKTCRDDGAV--RRRSRACDSPAPSLAPAGSQCPGASQDTGPCLDLDPCPV----------DGAWGGWSGWSGCSVTCGLGTRVHTRLCDSPAPRYGGRLCPGSEDGRQSQAELCDSHNKCPADGKWTEWSSWSTC-MSNTPYENRCRPRVGKQTMQRICMGQEEEGTACIGEGFIIRACYNLENCTARELKVKNPEWGEWGEWSLCQPPCGQCS-ISVRRRVCKTPLP 346          

HSP 4 Score: 55.4546 bits (132), Expect = 1.570e-8
Identity = 69/286 (24.13%), Postives = 96/286 (33.57%), Query Frame = 1
Query:  604 SEWSEWSACSKTCR--LPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPVTLQPPLNLHLTGNGSGLFNVSWSSVPYGKLASTYRIYKTIEDESNREIKTNYEDHNALPNKKITSMNYWAIIDLRNLLSLNTFQTLAVRMSSIDFWKEESSLSNPVRSKVRAVDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVS 1455
            S WS+WS CS +C   +   A + + +  CN   P D       +    R C+    CP+ G WG W     C      +C  G +R  R C     +A G  C+G   +   C     CP                       +   +G   S     KT  D+     ++   D  A       S    A  D    L L+                               VDG W  WS WS CS  C    G R   R C++P+PR GG+ C G+ + + S
Sbjct:   10 SAWSDWSPCSASCGSGVSSRAKVCIGTGACNELHPLD-------QRFQVRICNAGVCCPVRGAWGSWGQWSACSV----TCEAGQKRRTRTCE--GAHACGVRCDGPGSESVACQTGQICP-----------------------THGAWGSWLSWGECSKTCRDDGAVRRRSRACDSPAPSLAPAGSQCPGASQDTGPCLDLDPC----------------------------PVDGAWGGWSGWSGCSVTCGL--GTRVHTRLCDSPAPRYGGRLCPGSEDGRQS 229          
BLAST of Hemicentin-1 vs. Ensembl Sea Lamprey
Match: cfp (complement factor properdin [Source:ZFIN;Acc:ZDB-GENE-030131-9247])

HSP 1 Score: 97.4413 bits (241), Expect = 3.098e-22
Identity = 64/170 (37.65%), Postives = 81/170 (47.65%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLG--GKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKC----DGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRD--QKSC--ALGSQRYQRQC 873
            P  G WGSW +W +CS TC        +  R R C+SP P L   G  C G   +T  C +   P P+ G W  WS WS CS TC L      +V +RLC++P P+ GG  C    DG    +  CD   +CP DG+W EW     C S    +  C   +G Q  QR C
Sbjct:  121 PTHGAWGSWLSWGECSKTCRDDGA---VRRRSRACDSPAPSLAPAGSQCPGASQDTGPCLDLD-PCPVDGAWGGWSGWSGCSVTCGL----GTRVHTRLCDSPAPRYGGRLCPGSEDGRQSQAELCDSHNKCPADGKWTEWSSWSTCMSNTPYENRCRPRVGKQTMQRIC 282          

HSP 2 Score: 75.485 bits (184), Expect = 5.243e-15
Identity = 60/172 (34.88%), Postives = 77/172 (44.77%), Query Frame = 1
Query:  349 TSHRVSPYIAIAPNEPVDGMWGSWTTWSKCSITCSSVDVQYGLMTRF--RLCNSPPPQLGGKNC----TGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTC----RLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQC-------PIDGQWGEWYIAGP 813
             S    P + + P  PVDG WG W+ WS CS+TC       GL TR   RLC+SP P+ GG+ C     G  ++ + C +S    P  G W+EWS WS C        R       Q   R+C     ++ G  C GE    R C  L  C       P  G+WGEW +  P
Sbjct:  169 ASQDTGPCLDLDPC-PVDGAWGGWSGWSGCSVTC-------GLGTRVHTRLCDSPAPRYGGRLCPGSEDGRQSQAELC-DSHNKCPADGKWTEWSSWSTCMSNTPYENRCRPRVGKQTMQRICMG--QEEEGTACIGEGFIIRACYNLENCTALKVKNPEWGEWGEWSLCQP 329          

HSP 3 Score: 68.9366 bits (167), Expect = 6.501e-13
Identity = 61/206 (29.61%), Postives = 84/206 (40.78%), Query Frame = 1
Query:  367 PYIAIAPNEPVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCF-----NSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPN--ADGKPCEGIKEKLEDCWFFIGCPV 963
            P    APN        +W+ WS CS +C S     G+ +R ++C      +G   C  +    D  F     N+    P+ G W  W +WSACS TC   Q    + R+R C        G++CDG    S  C     CP  G WG W   G C    +   A+  +R  R C+ P+P+    G  C G  +    C     CPV
Sbjct:    1 PKCRCAPNR--KAFQSAWSDWSPCSASCGS-----GVSSRAKVC------IGTGACNELHP-LDQRFQVRICNAGVCCPVRGAWGSWGQWSACSVTCEAGQ----KRRTRTCEGA--HACGVRCDGPGSESVACQTGQICPTHGAWGSWLSWGECSKTCRDDGAV--RRRSRACDSPAPSLAPAGSQCPGASQDTGPCLDLDPCPV 184          

HSP 4 Score: 55.8398 bits (133), Expect = 1.264e-8
Identity = 70/286 (24.48%), Postives = 98/286 (34.27%), Query Frame = 1
Query:  604 SEWSEWSACSKTCR--LPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPVTLQPPLNLHLTGNGSGLFNVSWSSVPYGKLASTYRIYKTIEDESNREIKTNYEDHNALPNKKITSMNYWAIIDLRNLLSLNTFQTLAVRMSSIDFWKEESSLSNPVRSKVRAVDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVS 1455
            S WS+WS CS +C   +   A + + +  CN   P D       +    R C+    CP+ G WG W     C      +C  G +R  R C     +A G  C+G   +   C     CP             +G+           +G   S     KT  D+     ++   D  A       S    A  D    L L+                               VDG W  WS WS CS  C    G R   R C++P+PR GG+ C G+ + + S
Sbjct:   14 SAWSDWSPCSASCGSGVSSRAKVCIGTGACNELHPLD-------QRFQVRICNAGVCCPVRGAWGSWGQWSACSV----TCEAGQKRRTRTCE--GAHACGVRCDGPGSESVACQTGQICPT------------HGA-----------WGSWLSWGECSKTCRDDGAVRRRSRACDSPAPSLAPAGSQCPGASQDTGPCLDLDPC----------------------------PVDGAWGGWSGWSGCSVTCGL--GTRVHTRLCDSPAPRYGGRLCPGSEDGRQS 233          
BLAST of Hemicentin-1 vs. Ensembl Nematostella
Match: EDO37341 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFY2])

HSP 1 Score: 135.961 bits (341), Expect = 1.016e-35
Identity = 120/383 (31.33%), Postives = 175/383 (45.69%), Query Frame = 1
Query:  397 VDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPVTLQPPLNLHLTGNGSGLFN--VSWSSVPYGKLASTYRIYKTIEDESNREIKTNYED--HNALPNKKITSMNYWAIIDL---RNLLSLNTFQTLAVRMSSIDFWKEESSLSNPV-RSKVRA-----VDGK------------WSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSCYGMG 1470
            VDG +  WT WS+CS TC S  +Q     R R+C +PPP  GGK+C G   E   C  + CPV  +G ++ WSEWS C+ +C  P++   ++R R C NP P++GGLKC G +  ++ C  +  CP+DG  G W    PC S+   + AL   R +R+C+ P P   GKPC G + +L +C     CPV               G F+    WS  P      T+   K     +N   K   ++  H  +  K+       A+ D          + +     + S+  +        NP  R+  R      +D K            ++ W+ WS+CS +C + +  R+R R C NP P +GGKPC GN  E   C   G
Sbjct:    1 VDGGFTQWTKWSECSETCGSDSIQM----RMRVCTNPPPSNGGKDCQGWRFEVKYCNLTKCPV--NGGYTSWSEWSPCTPSC-GPRA--FKMRQRTCTNPPPRNGGLKCFGGAKETKAC-RVEDCPVDGGLGAWSKWSPC-SKTCNTTAL--SRRERKCDSPPPRNGGKPCAGERVELRNC-GTEPCPV--------------DGGFSPWSEWSHCPS-VACGTHFFSKRTRTCTNPMPKYGGKNCTHAWIERKRC------ALPDCPVDGGFSEWSAWSACPSKCSTAAYSHRRRRCDNPEPRNGGRTCVGPEIDAKLCWRDNCPVNGGFTPWTAWSNCSQECGRTS-IRSRERYCTNPVPENGGKPCKGNQFEIKICKFKG 347          

HSP 2 Score: 110.923 bits (276), Expect = 9.231e-27
Identity = 79/191 (41.36%), Postives = 100/191 (52.36%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSAC-SKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPV 963
            PVDG  G+W+ WS CS TC++      L  R R C+SPPP+ GGK C G   E  NC   PCPV   G +S WSEWS C S  C    +     R+R C NP+PK GG  C    +  + C  LP CP+DG + EW     C S+   S A  S R +R+C+ P P   G+ C G +   + CW    CPV
Sbjct:  116 PVDGGLGAWSKWSPCSKTCNTT----ALSRRERKCDSPPPRNGGKPCAGERVELRNCGTEPCPV--DGGFSPWSEWSHCPSVAC---GTHFFSKRTRTCTNPMPKYGGKNCTHAWIERKRC-ALPDCPVDGGFSEWSAWSACPSKC--STAAYSHR-RRRCDNPEPRNGGRTCVGPEIDAKLCW-RDNCPV 292          

HSP 3 Score: 102.449 bits (254), Expect = 6.800e-24
Identity = 68/192 (35.42%), Postives = 97/192 (50.52%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKC-SITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPVT 966
            PVDG +  W+ WS C S+ C +    +    R R C +P P+ GGKNCT  + E   C    CPV   G +SEWS WSAC   C    +A    R R C+NP P++GG  C G  ++++ C +   CP++G +  W     C     ++     +RY   C  P P   GKPC+G + +++ C  F GC  T
Sbjct:  174 PVDGGFSPWSEWSHCPSVACGT----HFFSKRTRTCTNPMPKYGGKNCTHAWIERKRCALPDCPV--DGGFSEWSAWSACPSKC---STAAYSHRRRRCDNPEPRNGGRTCVGPEIDAKLC-WRDNCPVNGGFTPWTAWSNCSQECGRTSIRSRERY---CTNPVPENGGKPCKGNQFEIKIC-KFKGCKGT 351          

HSP 4 Score: 92.4337 bits (228), Expect = 1.941e-20
Identity = 65/175 (37.14%), Postives = 83/175 (47.43%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQ---RQCNKPSPNADGKPC 909
            PV+G + SW+ WS C+ +C           R R C +PPP+ GG  C G   ET  C    CPV   G    WS+WS CSKTC    +  L  R R C++P P++GG  C GE +  R C   P CP+DG +  W     C      S A G+  +    R C  P P   GK C
Sbjct:   58 PVNGGYTSWSEWSPCTPSCGP----RAFKMRQRTCTNPPPRNGGLKCFGGAKETKACRVEDCPV--DGGLGAWSKWSPCSKTC---NTTALSRRERKCDSPPPRNGGKPCAGERVELRNCGTEP-CPVDGGFSPWSEWSHCP-----SVACGTHFFSKRTRTCTNPMPKYGGKNC 217          

HSP 5 Score: 79.337 bits (194), Expect = 3.964e-16
Identity = 43/125 (34.40%), Postives = 65/125 (52.00%), Query Frame = 1
Query:  385 PNEPVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDY 759
            P+ PVDG +  W+ WS C   CS+    +    R R C++P P+ GG+ C G   +   C+   CPV  +G ++ W+ WS CS+ C       ++ R R C NPVP++GG  C G     + C +
Sbjct:  230 PDCPVDGGFSEWSAWSACPSKCSTAAYSH----RRRRCDNPEPRNGGRTCVGPEIDAKLCWRDNCPV--NGGFTPWTAWSNCSQEC---GRTSIRSRERYCTNPVPENGGKPCKGNQFEIKICKF 345          
BLAST of Hemicentin-1 vs. Ensembl Nematostella
Match: EDO31044 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZ33])

HSP 1 Score: 132.88 bits (333), Expect = 1.632e-34
Identity = 116/375 (30.93%), Postives = 165/375 (44.00%), Query Frame = 1
Query:  397 VDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCD--GESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPC-EGIKEKLEDCWFFIG-CPV-------TLQPPLNLHLTGNGSGLFNVSWSSVPYGKLASTYRIYKTIEDESNREIKTNYEDHNALPNKKITSMNYWAIID--LRNLLSLNTFQTLAVRMSSIDFWKEESSLSNPVRSKVRA------VDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCN--GNSEEKVSC 1458
            VDG +  W+ ++ CS+TC+      G  TR RLC SPPPQ GG NCTG F+ET  C   PC  PI+GN+++WSE++ CSKTC        + R+R C NP P+ GG+ C   G  +++  C+  P CP+DG +  W    PC      +C  G     R C++P+P   G+ C E +    E+   F   CP+       +     +L   G          S  P G+  +  R+   +E              N  P       + W       R       ++T +          E  SL  P R   +       V+G +  W+ +S CSA C    G   R R C+NPSP+ GGK C+  G   E  SC
Sbjct:    7 VDGGFAEWSDFTSCSVTCAQ-----GSRTRRRLCTSPPPQHGGLNCTGAFSETTPCNLRPC--PINGNYTQWSEYTPCSKTC----GGGTRHRTRSCTNPAPQYGGVNCTVIGNPVDTIECNTSP-CPVDGGYTSWTEFSPCS----VTCGRGLSTRSRACSEPAPQYGGRNCSEFLGPNTEEVPCFPKLCPIDGFYGNWSAFTRCSLSCGGGTQSRNRSCDSPSPVGEGLNCTRLGPALE----------IRVCNTQPCPIHGGFSEWTDFGNCTRECDGGVHYRTRSCTNPVPFAGGEGCSLLGPARESRQCNTNPCPVNGAYGPWAPFSPCSATCG--GGRMVRRRYCDNPSPQHGGKNCSSLGRPVESSSC 353          

HSP 2 Score: 105.916 bits (263), Expect = 5.003e-25
Identity = 66/184 (35.87%), Postives = 96/184 (52.17%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCT--GIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCD--GESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLE 933
            P+DG +G+W+ +++CS++C       G  +R R C+SP P   G NCT  G   E   C   PCP  IHG +SEW+++  C++ C       +  R+R C NPVP  GG  C   G +  SR C+  P CP++G +G W    PC +    +C  G    +R C+ PSP   GK C  +   +E
Sbjct:  182 PIDGFYGNWSAFTRCSLSCGG-----GTQSRNRSCDSPSPVGEGLNCTRLGPALEIRVCNTQPCP--IHGGFSEWTDFGNCTREC----DGGVHYRTRSCTNPVPFAGGEGCSLLGPARESRQCNTNP-CPVNGAYGPWAPFSPCSA----TCGGGRMVRRRYCDNPSPQHGGKNCSSLGRPVE 349          

HSP 3 Score: 97.8265 bits (242), Expect = 2.622e-22
Identity = 71/185 (38.38%), Postives = 90/185 (48.65%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCT---GIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCD--GESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLE 933
            PVDG + SWT +S CS+TC       GL TR R C+ P PQ GG+NC+   G  TE   CF   C  PI G +  WS ++ CS +C        Q R+R C++P P   GL C   G +L  R C+  P CPI G + EW   G C     + C  G     R C  P P A G+ C  +    E
Sbjct:  122 PVDGGYTSWTEFSPCSVTCG-----RGLSTRSRACSEPAPQYGGRNCSEFLGPNTEEVPCFPKLC--PIDGFYGNWSAFTRCSLSC----GGGTQSRNRSCDSPSPVGEGLNCTRLGPALEIRVCNTQP-CPIHGGFSEWTDFGNC----TRECDGGVHYRTRSCTNPVPFAGGEGCSLLGPARE 290          

HSP 4 Score: 71.2478 bits (173), Expect = 1.681e-13
Identity = 79/311 (25.40%), Postives = 124/311 (39.87%), Query Frame = 1
Query:  583 VPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPVTLQPPLNLHLTGNGSGLFNVSWSSVPYGKLASTYR--IYKTIEDESNRE----IKTNYEDHNALPNKKITSMNYWAIIDLRNLLSLNTFQTLAVRMSSIDFWKEESSLSNPVR-----------SKVRAVDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCN--GNSEEKVSC 1458
            V + G ++EWS++++CS TC    +   + R RLC +P P+ GGL C G    +  C+  P CPI+G + +W    PC     K+C  G++   R C  P+P   G  C  I   ++     I C  +  P     + G  +     S  SV  G+  ST      +       R     +  N E+    P K      ++         SL+       R  S D         N  R           ++   + G +S W+ + +C+ +C  + G   R R C NP P  GG+ C+  G + E   C
Sbjct:    5 VLVDGGFAEWSDFTSCSVTC----AQGSRTRRRLCTSPPPQHGGLNCTGAFSETTPCNLRP-CPINGNYTQWSEYTPCS----KTCGGGTRHRTRSCTNPAPQYGGVNCTVIGNPVDT----IECNTSPCP-----VDGGYTSWTEFSPCSVTCGRGLSTRSRACSEPAPQYGGRNCSEFLGPNTEEVPCFP-KLCPIDGFYGNWSAFTRCSLSCGGGTQSRNRSCDSPSPVGEGLNCTRLGPALEIRVCNTQPCPIHGGFSEWTDFGNCTREC--DGGVHYRTRSCTNPVPFAGGEGCSLLGPARESRQC 294          

HSP 5 Score: 62.003 bits (149), Expect = 1.837e-10
Identity = 42/125 (33.60%), Postives = 60/125 (48.00%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCT--GIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCD--GESLNSRFCD 756
            P+ G +  WT +  C+  C       G+  R R C +P P  GG+ C+  G   E+  C  +PCPV  +G +  W+ +S CS TC         VR R C+NP P+ GG  C   G  + S  C+
Sbjct:  241 PIHGGFSEWTDFGNCTRECDG-----GVHYRTRSCTNPVPFAGGEGCSLLGPARESRQCNTNPCPV--NGAYGPWAPFSPCSATC----GGGRMVRRRYCDNPSPQHGGKNCSSLGRPVESSSCN 354          

HSP 6 Score: 49.2914 bits (116), Expect = 2.451e-6
Identity = 28/65 (43.08%), Postives = 37/65 (56.92%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCT--GIFTETDNCFNSPCP 582
            PV+G +G W  +S CS TC       G M R R C++P PQ GGKNC+  G   E+ +C  + CP
Sbjct:  300 PVNGAYGPWAPFSPCSATCGG-----GRMVRRRYCDNPSPQHGGKNCSSLGRPVESSSCNTNKCP 359          
BLAST of Hemicentin-1 vs. Ensembl Nematostella
Match: EDO39576 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9H7])

HSP 1 Score: 120.553 bits (301), Expect = 4.288e-30
Identity = 105/368 (28.53%), Postives = 149/368 (40.49%), Query Frame = 1
Query:  379 IAPNEPVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQ-CPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPVTLQPPLNLHLTGNGSGLFNVSWSSVPYGKLASTYRIYKTIEDESNREIKTNYEDHN-ALPNKKITSMNYWAIIDLRNLLSLNTFQTLAVRMSSIDFWKEESSLSNP------VRSKVRAVDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            + P   V+G W  WT W  CS TC       G+ +R R CN P     G  C G  TE   C    CPV  +GN++ WS W+ CS++C       +  R R C+NP P+ GG  C             PQ CPI G WG W +   C S+    C  G +   R+C+ P+P   G  C G   ++  C     CPV          T   +       S              K+ E +   E+   Y D N  + +   T    W    +         ++ A    + +F     +   P        ++  A DG W +W  WS+C+A C +  G+  R+R CN+P P +GGKPC G + E   C
Sbjct:    1 MFPLSTVNGTWSPWTGWQSCSATCGD-----GVQSRTRTCNFPQDANPGSMCEGDDTEQKPCKIKRCPV--NGNFTSWSSWTECSRSC----GKGIMSRYRECSNPTPRFGGKNCSHIGSAREVVHCNPQNCPIHGNWGAWKMWSFCSSK----CGPGKRERIRKCDNPAPRYGGAGCPGSDRQIMPC-SLSDCPVDGNWGQWSEFTHCSATCGAAKRSRTRNCDNPPPAHGGKSCEGDEMEEV---YCDLNPCMVHGGYTEWGGWTQCAV-TCGGGKRQRSRACTSPTPEFGGLNCTHLGPDVQEDDCNTRPCAPDGNWGTWGTWSNCTASCGR--GFVKRSRVCNSPLPSNGGKPCAGFAHETAEC 346          

HSP 2 Score: 74.7146 bits (182), Expect = 1.258e-14
Identity = 47/128 (36.72%), Postives = 63/128 (49.22%), Query Frame = 1
Query:  397 VDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCT--GIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCP 774
            V G +  W  W++C++TC       G   R R C SP P+ GG NCT  G   + D+C   PC     GNW  W  WS C+ +C          RSR+CN+P+P +GG  C G +  +  C   P CP
Sbjct:  237 VHGGYTEWGGWTQCAVTCGG-----GKRQRSRACTSPTPEFGGLNCTHLGPDVQEDDCNTRPCAP--DGNWGTWGTWSNCTASC----GRGFVKRSRVCNSPLPSNGGKPCAGFAHETAECVMTP-CP 352          
BLAST of Hemicentin-1 vs. Ensembl Nematostella
Match: EDO40760 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S664])

HSP 1 Score: 121.324 bits (303), Expect = 6.751e-29
Identity = 65/181 (35.91%), Postives = 93/181 (51.38%), Query Frame = 1
Query:  397 VDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDC 939
            V+G W  +++WS C+ TC       G  TR R C +P P  GGK C G   ET +C  + C V  +G WS++S WS+C+KTC        Q R+R C NP P  GG +C G++  +R C     C ++G W ++     C     K+C  G Q   R C  P+P+ +GK C G   +  +C
Sbjct:  228 VNGGWSDYSSWSSCTKTCGG-----GTQTRTRTCTNPKPAHGGKECVGDAKETRHCSEAACAV--NGGWSDYSSWSSCTKTC----GGGTQTRTRTCTNPKPAHGGKECVGDAKETRHCSE-AACAVNGGWSDFSKWTKC----SKTCGGGKQERTRTCTSPAPSHNGKKCAGDAREEREC 392          

HSP 2 Score: 119.013 bits (297), Expect = 3.076e-28
Identity = 65/181 (35.91%), Postives = 91/181 (50.28%), Query Frame = 1
Query:  397 VDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDC 939
            V+G W  +++WS C+ TC       G  TR R C +P P  GGK C G   ET +C  + C V  +G WS++S WS+C+KTC        Q R+R C NP P  GG +C G++  +R C     C ++G W ++     C     K+C  G+Q   R C  P P   GK C G  ++   C
Sbjct:  171 VNGGWSDYSSWSSCTKTCGG-----GTQTRTRTCTNPKPAHGGKECVGDAKETRHCSEAACAV--NGGWSDYSSWSSCTKTC----GGGTQTRTRTCTNPKPAHGGKECVGDAKETRHCSE-AACAVNGGWSDYSSWSSC----TKTCGGGTQTRTRTCTNPKPAHGGKECVGDAKETRHC 335          

HSP 3 Score: 92.0485 bits (227), Expect = 1.694e-19
Identity = 49/126 (38.89%), Postives = 68/126 (53.97%), Query Frame = 1
Query:  397 VDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCP 774
            V+G W  +++WS C+ TC       G  TR R C +P P  GGK C G   ET +C  + C V  +G WS++S+W+ CSKTC        Q R+R C +P P   G KC G++   R C+   +CP
Sbjct:  285 VNGGWSDYSSWSSCTKTCGG-----GTQTRTRTCTNPKPAHGGKECVGDAKETRHCSEAACAV--NGGWSDFSKWTKCSKTC----GGGKQERTRTCTSPAPSHNGKKCAGDAREERECN-TDKCP 398          

HSP 4 Score: 79.7221 bits (195), Expect = 1.204e-15
Identity = 44/130 (33.85%), Postives = 65/130 (50.00%), Query Frame = 1
Query:  550 ETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDC 939
            ET  C ++  P  ++G WS++S WS+C+KTC        Q R+R C NP P  GG +C G++  +R C     C ++G W ++     C     K+C  G+Q   R C  P P   GK C G  ++   C
Sbjct:  159 ETRKC-SAEKPCEVNGGWSDYSSWSSCTKTC----GGGTQTRTRTCTNPKPAHGGKECVGDAKETRHCSE-AACAVNGGWSDYSSWSSC----TKTCGGGTQTRTRTCTNPKPAHGGKECVGDAKETRHC 278          

HSP 5 Score: 52.7582 bits (125), Expect = 2.990e-7
Identity = 25/54 (46.30%), Postives = 32/54 (59.26%), Query Frame = 1
Query: 1297 AVDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            AV+G WS +S WS C+  C    G +TR R C NP P  GGK C G+++E   C
Sbjct:  227 AVNGGWSDYSSWSSCTKTCG--GGTQTRTRTCTNPKPAHGGKECVGDAKETRHC 278          

HSP 6 Score: 52.7582 bits (125), Expect = 2.990e-7
Identity = 25/54 (46.30%), Postives = 32/54 (59.26%), Query Frame = 1
Query: 1297 AVDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            AV+G WS +S WS C+  C    G +TR R C NP P  GGK C G+++E   C
Sbjct:  284 AVNGGWSDYSSWSSCTKTCG--GGTQTRTRTCTNPKPAHGGKECVGDAKETRHC 335          

HSP 7 Score: 51.2174 bits (121), Expect = 9.452e-7
Identity = 24/53 (45.28%), Postives = 31/53 (58.49%), Query Frame = 1
Query: 1300 VDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            V+G WS +S WS C+  C    G +TR R C NP P  GGK C G+++E   C
Sbjct:  171 VNGGWSDYSSWSSCTKTCG--GGTQTRTRTCTNPKPAHGGKECVGDAKETRHC 221          
BLAST of Hemicentin-1 vs. Ensembl Nematostella
Match: EDO33294 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSL1])

HSP 1 Score: 110.538 bits (275), Expect = 2.036e-27
Identity = 73/229 (31.88%), Postives = 104/229 (45.41%), Query Frame = 1
Query:  235 HTISIVNPSIM--PVDRIIRVSFLCICMICSVIGSIVACMTSHRVSPYIAIAPNEPVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEG 915
            H   + N S++   V R    S+ C   I S+  +I A +                V G W +W +W+ C+ +C +     GL  R+R C++P P  GG  C G   + + C   PCPVP  G WS W  W+ C+++C       L+ R R C+NP P  GG  C G + +   C   P CP+DG+W  W     C     +SC  G Q   R C  P P+  G+ C G
Sbjct:   46 HIRILANNSLLINGVKREDAGSYQCRATINSLSNAIQAVLIVR-------------VPGGWSAWQSWTPCTQSCGT-----GLRYRYRACDNPFPAHGGATCPGSNEDRERCSAQPCPVP--GGWSAWQSWTPCTQSC----GTGLRYRYRACDNPFPAHGGATCPGSNEDRERCSAQP-CPVDGKWSTWADWTVCS----RSCGGGVQYRTRTCTSPPPSDGGRECLG 245          

HSP 2 Score: 88.5817 bits (218), Expect = 9.323e-20
Identity = 45/121 (37.19%), Postives = 66/121 (54.55%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCD 756
            PV G W +W +W+ C+ +C +     GL  R+R C++P P  GG  C G   + + C   PCPV   G WS W++W+ CS++C       +Q R+R C +P P DGG +C G+   S  C 
Sbjct:  145 PVPGGWSAWQSWTPCTQSCGT-----GLRYRYRACDNPFPAHGGATCPGSNEDRERCSAQPCPV--DGKWSTWADWTVCSRSC----GGGVQYRTRTCTSPPPSDGGRECLGDETVSSVCQ 254          

HSP 3 Score: 74.7146 bits (182), Expect = 5.206e-15
Identity = 44/140 (31.43%), Postives = 58/140 (41.43%), Query Frame = 1
Query:  520 GGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDC 939
            G   C        N   +   V + G WS W  W+ C+++C       L+ R R C+NP P  GG  C G + +   C   P CP+ G W  W    PC     +SC  G +   R C+ P P   G  C G  E  E C
Sbjct:   66 GSYQCRATINSLSNAIQAVLIVRVPGGWSAWQSWTPCTQSC----GTGLRYRYRACDNPFPAHGGATCPGSNEDRERCSAQP-CPVPGGWSAWQSWTPCT----QSCGTGLRYRYRACDNPFPAHGGATCPGSNEDRERC 196          

HSP 4 Score: 48.9062 bits (115), Expect = 1.725e-6
Identity = 25/62 (40.32%), Postives = 31/62 (50.00%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPC 579
            PVDG W +W  W+ CS +C       G+  R R C SPPP  GG+ C G  T +  C    C
Sbjct:  202 PVDGKWSTWADWTVCSRSCGG-----GVQYRTRTCTSPPPSDGGRECLGDETVSSVCQTQKC 258          

HSP 5 Score: 48.1358 bits (113), Expect = 2.921e-6
Identity = 33/110 (30.00%), Postives = 53/110 (48.18%), Query Frame = 1
Query: 1141 NKKITSMNYWAIIDLRNLLSLNTFQTLAVRMSSIDFWKEES---SLSNPVRSK-VRAVDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
             K     N W    +R +L+ N+     V+      ++  +   SLSN +++  +  V G WS+W  W+ C+  C    G R R R C+NP P  GG  C G++E++  C
Sbjct:   33 QKNGQGFNPWWPPHIR-ILANNSLLINGVKREDAGSYQCRATINSLSNAIQAVLIVRVPGGWSAWQSWTPCTQSCG--TGLRYRYRACDNPFPAHGGATCPGSNEDRERC 139          

HSP 6 Score: 46.9802 bits (110), Expect = 7.168e-6
Identity = 24/53 (45.28%), Postives = 30/53 (56.60%), Query Frame = 1
Query: 1300 VDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            VDGKWS+W+ W+ CS  C     YRTR   C +P P DGG+ C G+      C
Sbjct:  203 VDGKWSTWADWTVCSRSCGGGVQYRTRT--CTSPPPSDGGRECLGDETVSSVC 253          
BLAST of Hemicentin-1 vs. Ensembl Medaka
Match: hmcn1 (hemicentin 1 [Source:NCBI gene;Acc:101172646])

HSP 1 Score: 138.272 bits (347), Expect = 7.063e-34
Identity = 72/186 (38.71%), Postives = 94/186 (50.54%), Query Frame = 1
Query:  403 GMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCP 960
            G WGSW  W  CS TC       G+ +R RLCN+PPPQ  G  C G  T++  C    CP   HG WS W  W  CS +C        + R+RLC +P P+ GG  C+G  ++  FC+  P CP+ G WG W   G C     K+C  G  R  R C+ P P   G+ C G  E+++ C   + CP
Sbjct: 4382 GNWGSWLPWGPCSETCGR-----GMQSRIRLCNNPPPQFDGSQCEGTDTQSKMCLERLCP---HGKWSSWMNWGPCSVSC----GGGTRQRTRLCASPAPQHGGRSCEGNGVHMDFCNTDP-CPVSGNWGTWSSWGSCS----KTCNGGQMRRYRTCDSPRPAFGGRACAGADEQMQRCS-IVSCP 4549          

HSP 2 Score: 126.716 bits (317), Expect = 4.346e-30
Identity = 70/179 (39.11%), Postives = 93/179 (51.96%), Query Frame = 1
Query:  403 GMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDC 939
            G +  W+ W  CS++C +     G+  R R CN+P P  GG +C G  TE  +C  +PCP    GNWSEWS W  CS+TC        + R R C+NP+P+ GG  C+G+++    C   P CP  G WG W   GPC     ++C  G Q   R CN P P  DG  CEG   + + C
Sbjct: 4270 GGYSEWSEWGSCSVSCGA-----GIQKRLRQCNNPLPANGGHHCAGSDTEKSSCQGNPCP---DGNWSEWSVWEECSQTCGQGN----RTRFRTCSNPLPQYGGKPCEGKAVEVIMCSVRP-CPA-GNWGSWLPWGPCS----ETCGRGMQSRIRLCNNPPPQFDGSQCEGTDTQSKMC 4430          

HSP 3 Score: 121.324 bits (303), Expect = 2.295e-28
Identity = 71/180 (39.44%), Postives = 89/180 (49.44%), Query Frame = 1
Query:  400 DGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDC 939
            DG W  W+ W +CS TC       G  TRFR C++P PQ GGK C G   E   C   PCP    GNW  W  W  CS+TC       +Q R RLCNNP P+  G +C+G    S+ C     CP  G+W  W   GPC      SC  G+++  R C  P+P   G+ CEG    ++ C
Sbjct: 4325 DGNWSEWSVWEECSQTCGQ-----GNRTRFRTCSNPLPQYGGKPCEGKAVEVIMCSVRPCPA---GNWGSWLPWGPCSETC----GRGMQSRIRLCNNPPPQFDGSQCEGTDTQSKMC-LERLCP-HGKWSSWMNWGPCSV----SCGGGTRQRTRLCASPAPQHGGRSCEGNGVHMDFC 4486          

HSP 4 Score: 117.857 bits (294), Expect = 2.959e-27
Identity = 71/179 (39.66%), Postives = 84/179 (46.93%), Query Frame = 1
Query:  403 GMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDC 939
            G W SW  W  CS++C       G   R RLC SP PQ GG++C G     D C   PCPV   GNW  WS W +CSKTC   Q      R R C++P P  GG  C G     + C  +  CP DG WG W   G C      SC  G +   R CN P+P+  G+ C G    L  C
Sbjct: 4438 GKWSSWMNWGPCSVSCGG-----GTRQRTRLCASPAPQHGGRSCEGNGVHMDFCNTDPCPV--SGNWGTWSSWGSCSKTCNGGQMR----RYRTCDSPRPAFGGRACAGADEQMQRCSIV-SCP-DGNWGSWQPWGQCSV----SCGGGERTRLRLCNNPAPSYGGRQCPGDSSLLSRC 4599          

HSP 5 Score: 92.0485 bits (227), Expect = 5.439e-19
Identity = 47/114 (41.23%), Postives = 59/114 (51.75%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGES 735
            PV G WG+W++W  CS TC+      G M R+R C+SP P  GG+ C G   +   C    CP    GNW  W  W  CS +C        + R RLCNNP P  GG +C G+S
Sbjct: 4492 PVSGNWGTWSSWGSCSKTCNG-----GQMRRYRTCDSPRPAFGGRACAGADEQMQRCSIVSCP---DGNWGSWQPWGQCSVSC----GGGERTRLRLCNNPAPSYGGRQCPGDS 4593          

HSP 6 Score: 83.9593 bits (206), Expect = 1.952e-16
Identity = 46/108 (42.59%), Postives = 58/108 (53.70%), Query Frame = 1
Query:  592 HGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEG 915
            HG +SEWSEW +CS +C     A +Q R R CNNP+P +GG  C G       C   P CP DG W EW +   C     ++C  G++   R C+ P P   GKPCEG
Sbjct: 4269 HGGYSEWSEWGSCSVSC----GAGIQKRLRQCNNPLPANGGHHCAGSDTEKSSCQGNP-CP-DGNWSEWSVWEECS----QTCGQGNRTRFRTCSNPLPQYGGKPCEG 4366          

HSP 7 Score: 60.4622 bits (145), Expect = 3.821e-9
Identity = 27/52 (51.92%), Postives = 33/52 (63.46%), Query Frame = 1
Query: 1303 DGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            DG WS WS W +CS  C +  G RTR R C+NP P+ GGKPC G + E + C
Sbjct: 4325 DGNWSEWSVWEECSQTCGQ--GNRTRFRTCSNPLPQYGGKPCEGKAVEVIMC 4374          

HSP 8 Score: 58.151 bits (139), Expect = 2.407e-8
Identity = 27/63 (42.86%), Postives = 33/63 (52.38%), Query Frame = 1
Query:  400 DGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVP 588
            DG WGSW  W +CS++C       G  TR RLCN+P P  GG+ C G  +    C    CP P
Sbjct: 4550 DGNWGSWQPWGQCSVSCGG-----GERTRLRLCNNPAPSYGGRQCPGDSSLLSRCNTQACPGP 4607          

HSP 9 Score: 54.299 bits (129), Expect = 3.778e-7
Identity = 27/62 (43.55%), Postives = 32/62 (51.61%), Query Frame = 1
Query: 1279 VRSKVRAVDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSCYG 1464
            VR  +    G +S WS W  CS  C    G + R R CNNP P +GG  C G+  EK SC G
Sbjct: 4261 VRVTLTVRHGGYSEWSEWGSCSVSCGA--GIQKRLRQCNNPLPANGGHHCAGSDTEKSSCQG 4320          

HSP 10 Score: 51.2174 bits (121), Expect = 3.088e-6
Identity = 24/46 (52.17%), Postives = 27/46 (58.70%), Query Frame = 1
Query: 1303 DGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNS 1440
            DG W SW  W  CS  C    G RTR R CNNP+P  GG+ C G+S
Sbjct: 4550 DGNWGSWQPWGQCSVSCG--GGERTRLRLCNNPAPSYGGRQCPGDS 4593          
BLAST of Hemicentin-1 vs. Ensembl Medaka
Match: ENSORLT00000007327.2 (complement factor properdin [Source:NCBI gene;Acc:101154979])

HSP 1 Score: 123.25 bits (308), Expect = 1.481e-29
Identity = 111/373 (29.76%), Postives = 158/373 (42.36%), Query Frame = 1
Query:  391 EPVDG------MWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCF-NSPCPVPIHGNWSEWSEWSACSKTC----RLPQSAPLQVRSRLCNNPVP-KD---GGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPVTLQPPLNLHLTGNGSGLFNVSWSSVPYGKLASTYRIYKTI---------EDESNREIKTNYEDHNALPNKKITSMNYWAIIDLRNLLSLNTFQTLAVRMSSIDFWK-------EESSLSNPVRSKVRA-VDGKWSSWSYWSDC-------SAKCHKENGYRTRNRDC 1392
            EP +G       W SW  WS CS+TC  V    G+  R R C SPP  +  + C+G   ET++C  N+ CPV  HG WS WS W  CS TC    R     P +VR R C+NP P KD    G  C G++  S++C  LP CP++G WGEW   GPC      +C  G Q   R+C+ PSP   G+ C+G   +   C          Q P  +H   +G   +    SS  +    +T    ++            ++  +  +  E  N LP   +              ++       ++R       K        E  ++    +KV   V G+W+ WS WS C          C +  G +TRNR+C
Sbjct:  113 EPCNGTCCDVKAWDSWLPWSPCSVTCGGV----GVRKRQRTCGSPPECV--EVCSGPSQETESCASNNACPV--HGGWSSWSAWGQCSGTCIDDQRSDAVIPSRVRQRTCSNPAPSKDTIPKGDDCPGDAHQSQYCSELPNCPVNGNWGEWAQPGPCSV----TCGEGLQLSVRKCDNPSPKYGGEYCKGTSSRTSVC----------QSPCPVHGIWSGWSNWGDCSSSCHFESKPATKTRQRSCSNPSPSSNPPGQNCPDQNSQTERCNDLPFCPVDGSWGSWSSFSPCPVTCGVGLQESIRRCDNPAPKYGGRACSGERRITKTCFTKVHCPVHGEWTEWSEWSKCKYPFGDKDINCKRIGGKQTRNREC 463          

HSP 2 Score: 106.686 bits (265), Expect = 4.854e-24
Identity = 74/209 (35.41%), Postives = 100/209 (47.85%), Query Frame = 1
Query:  343 CMTSHRVSPYIAIAPNEPVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLC--NNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPV 963
            C      S Y +  PN PV+G WG W     CS+TC       GL    R C++P P+ GG+ C G  + T  C  SPCPV  HG WS WS W  CS +C        + R R C   +P     G  C  ++  +  C+ LP CP+DG WG W    PC      +C +G Q   R+C+ P+P   G+ C G +   + C+  + CPV
Sbjct:  230 CPGDAHQSQYCSELPNCPVNGNWGEWAQPGPCSVTCGE-----GLQLSVRKCDNPSPKYGGEYCKGTSSRTSVC-QSPCPV--HGIWSGWSNWGDCSSSCHFESKPATKTRQRSCSNPSPSSNPPGQNCPDQNSQTERCNDLPFCPVDGSWGSWSSFSPCPV----TCGVGLQESIRRCDNPAPKYGGRACSGERRITKTCFTKVHCPV 426          
BLAST of Hemicentin-1 vs. Ensembl Medaka
Match: thbs1 (thrombospondin 1 [Source:NCBI gene;Acc:100302441])

HSP 1 Score: 115.931 bits (289), Expect = 1.063e-26
Identity = 60/128 (46.88%), Postives = 76/128 (59.38%), Query Frame = 1
Query:  400 DGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDG 783
            DG W  W+ WS CS+TC       G+MT+ RLCNSP PQ+GG +C G   +T  C  S C  PI+G W  WS W  CS TC       +Q R RLCN+PVPK GG +C G++   + C+   +CPIDG
Sbjct:  437 DGGWSHWSPWSSCSVTCGE-----GVMTQIRLCNSPTPQMGGTDCQGKGRQTKTCKKSAC--PINGGWGPWSPWDTCSVTC----GGGIQTRKRLCNDPVPKYGGKECIGDAAMPQICNK-QECPIDG 552          

HSP 2 Score: 59.3066 bits (142), Expect = 9.247e-9
Identity = 27/64 (42.19%), Postives = 34/64 (53.12%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPV 585
            P++G WG W+ W  CS+TC       G+ TR RLCN P P+ GGK C G       C    CP+
Sbjct:  492 PINGGWGPWSPWDTCSVTCGG-----GIQTRKRLCNDPVPKYGGKECIGDAAMPQICNKQECPI 550          

HSP 3 Score: 54.6842 bits (130), Expect = 2.169e-7
Identity = 39/117 (33.33%), Postives = 51/117 (43.59%), Query Frame = 1
Query:  601 WSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQC----PIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDC 939
            WS WSEW+ CS TC       +Q R R C+         KC+G S+ +R C YL +C      DG W  W     C      +C  G     R CN P+P   G  C+G   + + C
Sbjct:  384 WSPWSEWTHCSTTC----GRGIQQRGRSCDRI-----NSKCEGTSVQTRDC-YLQECDKRFKQDGGWSHWSPWSSCSV----TCGEGVMTQIRLCNSPTPQMGGTDCQGKGRQTKTC 486          
BLAST of Hemicentin-1 vs. Ensembl Medaka
Match: thbs2a (thrombospondin 2 [Source:NCBI gene;Acc:101175102])

HSP 1 Score: 112.079 bits (279), Expect = 1.786e-25
Identity = 60/128 (46.88%), Postives = 76/128 (59.38%), Query Frame = 1
Query:  400 DGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDG 783
            DG W  W+ WS CS+TC       G +TR R CN+P PQLGG +C G   ET NC  +PC  PI G W  WS W++CS TC       ++ R+R CN+P P+ GG KC GE+ +S  C+    CPIDG
Sbjct:  439 DGGWSLWSPWSSCSVTCGE-----GQITRIRHCNAPVPQLGGTDCEGSGRETQNCTATPC--PIDGGWGPWSPWASCSATC----GGGIKSRTRECNSPQPQHGGKKCLGEASDSDSCNK-KDCPIDG 554          

HSP 2 Score: 93.9745 bits (232), Expect = 1.036e-19
Identity = 70/222 (31.53%), Postives = 93/222 (41.89%), Query Frame = 1
Query:  301 CICMICSVIGSIVACMTSHRVSPYIAIA-------PNEPVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCP--VPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDC 939
            C C    ++   + C      SP            P +  DG W  W+ W++C++TC       G   R R C++         C+G   +T  C    C   V   G WS WS WS+CS TC   Q      R R CN PVP+ GG  C+G    ++ C   P CPIDG WG W     C +    +C  G +   R+CN P P   GK C G     + C
Sbjct:  344 CTCQESKIVCHQITCPPVACASPSFVDGECCPVCMPKDSEDG-WSPWSEWTECTVTCG-----IGTQQRGRSCDAT-----SNPCSGPSIQTRKCSLGKCDSRVRQDGGWSLWSPWSSCSVTCGEGQI----TRIRHCNAPVPQLGGTDCEGSGRETQNCTATP-CPIDGGWGPWSPWASCSA----TCGGGIKSRTRECNSPQPQHGGKKCLGEASDSDSC 545          

HSP 3 Score: 65.0846 bits (157), Expect = 1.366e-10
Identity = 29/64 (45.31%), Postives = 39/64 (60.94%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPV 585
            P+DG WG W+ W+ CS TC       G+ +R R CNSP PQ GGK C G  +++D+C    CP+
Sbjct:  494 PIDGGWGPWSPWASCSATCGG-----GIKSRTRECNSPQPQHGGKKCLGEASDSDSCNKKDCPI 552          

HSP 4 Score: 52.7582 bits (125), Expect = 8.252e-7
Identity = 24/53 (45.28%), Postives = 33/53 (62.26%), Query Frame = 1
Query: 1300 VDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            +DG W  WS W+ CSA C    G ++R R+CN+P P+ GGK C G + +  SC
Sbjct:  495 IDGGWGPWSPWASCSATCG--GGIKSRTRECNSPQPQHGGKKCLGEASDSDSC 545          
BLAST of Hemicentin-1 vs. Ensembl Medaka
Match: thbs2a (thrombospondin 2 [Source:NCBI gene;Acc:101175102])

HSP 1 Score: 112.079 bits (279), Expect = 1.836e-25
Identity = 60/128 (46.88%), Postives = 76/128 (59.38%), Query Frame = 1
Query:  400 DGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDG 783
            DG W  W+ WS CS+TC       G +TR R CN+P PQLGG +C G   ET NC  +PC  PI G W  WS W++CS TC       ++ R+R CN+P P+ GG KC GE+ +S  C+    CPIDG
Sbjct:  424 DGGWSLWSPWSSCSVTCGE-----GQITRIRHCNAPVPQLGGTDCEGSGRETQNCTATPC--PIDGGWGPWSPWASCSATC----GGGIKSRTRECNSPQPQHGGKKCLGEASDSDSCNK-KDCPIDG 539          

HSP 2 Score: 93.9745 bits (232), Expect = 1.124e-19
Identity = 70/222 (31.53%), Postives = 93/222 (41.89%), Query Frame = 1
Query:  301 CICMICSVIGSIVACMTSHRVSPYIAIA-------PNEPVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCP--VPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDC 939
            C C    ++   + C      SP            P +  DG W  W+ W++C++TC       G   R R C++         C+G   +T  C    C   V   G WS WS WS+CS TC   Q      R R CN PVP+ GG  C+G    ++ C   P CPIDG WG W     C +    +C  G +   R+CN P P   GK C G     + C
Sbjct:  329 CTCQESKIVCHQITCPPVACASPSFVDGECCPVCMPKDSEDG-WSPWSEWTECTVTCG-----IGTQQRGRSCDATS-----NPCSGPSIQTRKCSLGKCDSRVRQDGGWSLWSPWSSCSVTCGEGQI----TRIRHCNAPVPQLGGTDCEGSGRETQNCTATP-CPIDGGWGPWSPWASCSA----TCGGGIKSRTRECNSPQPQHGGKKCLGEASDSDSC 530          

HSP 3 Score: 65.0846 bits (157), Expect = 1.425e-10
Identity = 29/64 (45.31%), Postives = 39/64 (60.94%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPV 585
            P+DG WG W+ W+ CS TC       G+ +R R CNSP PQ GGK C G  +++D+C    CP+
Sbjct:  479 PIDGGWGPWSPWASCSATCGG-----GIKSRTRECNSPQPQHGGKKCLGEASDSDSCNKKDCPI 537          

HSP 4 Score: 52.7582 bits (125), Expect = 8.263e-7
Identity = 24/53 (45.28%), Postives = 33/53 (62.26%), Query Frame = 1
Query: 1300 VDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            +DG W  WS W+ CSA C    G ++R R+CN+P P+ GGK C G + +  SC
Sbjct:  480 IDGGWGPWSPWASCSATCG--GGIKSRTRECNSPQPQHGGKKCLGEASDSDSC 530          
BLAST of Hemicentin-1 vs. Planmine SMEST
Match: SMESG000024603.1 (SMESG000024603.1)

HSP 1 Score: 879.396 bits (2271), Expect = 0.000e+0
Identity = 428/430 (99.53%), Postives = 428/430 (99.53%), Query Frame = 1
Query:  187 PSLKINNKSPIFCKVRHTISIVNPSIMPVDRIIRVSFLCICMICSVIGSIVACMTSHRVSPYIAIAPNEPVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPVTLQPPLNLHLTGNGSGLFNVSWSSVPYGKLASTYRIYKTIEDESNREIKTNYEDHNALPNKKITSMNYWAIIDLRNLLSLNTFQTLAVRMSSIDFWKEESSLSNPVRSKVRAVDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSCYGMGDC 1476
            PSLKINNKSPIFCKVRHTISIVNPSIMPVDRIIRVSFLCICMICSVIGSIVACMTSHRVSPYIAIAPNEPVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCT IFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPVTLQPPLNLHLTGNGSGLFNVSWSSVPYGKLASTYRIYKTIEDESNREIKTNYEDHNALPNKKITSMNYWAIIDLRNLLSLNTFQTLAVRMSSIDFWKEESSLSNPVRSKVRAVDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGN EEKVSCYGMGDC
Sbjct:   46 PSLKINNKSPIFCKVRHTISIVNPSIMPVDRIIRVSFLCICMICSVIGSIVACMTSHRVSPYIAIAPNEPVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTVIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPVTLQPPLNLHLTGNGSGLFNVSWSSVPYGKLASTYRIYKTIEDESNREIKTNYEDHNALPNKKITSMNYWAIIDLRNLLSLNTFQTLAVRMSSIDFWKEESSLSNPVRSKVRAVDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNPEEKVSCYGMGDC 475          
BLAST of Hemicentin-1 vs. Planmine SMEST
Match: SMESG000050805.1 (SMESG000050805.1)

HSP 1 Score: 227.254 bits (578), Expect = 2.009e-68
Identity = 144/430 (33.49%), Postives = 206/430 (47.91%), Query Frame = 1
Query:  190 SLKINNKSPIFCKVRHTISIVNPSIMPVDRIIRVSFLCICMICSVIGSIVACMTSHRVSPYIAIAPNEPVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPI-HGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGL-KCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPVTLQPPLNLHLTGNGSGLFNVSWSSVPYGKLASTYRIYKTIEDESNREIKTNYEDHNALPNKKITSMNYWAIIDLRNLLSLNTFQTLAVRMSSIDFWKEESSLSNPVRSKVRAVDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSCYGMGD 1473
            SLK +N + +   +  T  I     + +   I V  L IC      G I   +    VS +      + V   W +W++W++ + T        G+  R R C    P++    C G+  E  NC +      +  G WS WS+WS+C+  C+     P   R+R+C         L  C GE++  +FC +L  CP D  W EW I  PC  R +  C  G Q   R+C++P+       C G   K+ DCW ++GCP  +Q P N+ L   G+G F VSWS VPYG++A    IY T+   S +EI+T     +   N  I   NY   +     L++  F TL+VR+ S++    +S L+ P+ S  RAVDG+W  W  +  CS KC  E G R R R C NPSP   GK C G SE  VSC G+ +
Sbjct:   42 SLK-DNSTLLHLNLHRTNQIFQRFAITILIFIFVGILVIC------GGIFYQIYERNVSCFA-----KQVKSSWTNWSSWTQHNETS-------GVFARRRNC-LIIPKIMSNECKGLDEEFFNCKDKDSKQTLPTGIWSMWSQWSSCTNQCKTHNKIPTSTRNRICIGSEDNKKELTSCFGENVEHQFCQWLSSCP-DSHWSEWTIFEPCTLRGKTPCGPGHQASIRKCSQPN-------CIGSDTKMTDCWSYVGCPTDIQSPTNVELISYGNGTFKVSWSVVPYGEIAQNVCIYSTMMSYSGKEIRTKIHQTSVYYNN-IAIQNYAFHVHYSEYLAVEYFHTLSVRLQSVNINDSKSVLTEPISSFSRAVDGEWQEWGNFGSCSTKCLGEKGVRIRTRKCTNPSPSLDGKICPGISESTVSCVGLEE 442          
BLAST of Hemicentin-1 vs. Planmine SMEST
Match: SMESG000050805.1 (SMESG000050805.1)

HSP 1 Score: 214.542 bits (545), Expect = 4.454e-65
Identity = 119/316 (37.66%), Postives = 163/316 (51.58%), Query Frame = 1
Query:  532 CTGIFTETDNCFNSPCPVPI-HGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGL-KCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPVTLQPPLNLHLTGNGSGLFNVSWSSVPYGKLASTYRIYKTIEDESNREIKTNYEDHNALPNKKITSMNYWAIIDLRNLLSLNTFQTLAVRMSSIDFWKEESSLSNPVRSKVRAVDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSCYGMGD 1473
            C G+  E  NC +      +  G WS WS+WS+C+  C+     P   R+R+C         L  C GE++  +FC +L  CP D  W EW I  PC  R +  C  G Q   R+C++P+       C G   K+ DCW ++GCP  +Q P N+ L   G+G F VSWS VPYG++A    IY T+   S +EI+T     +   N  I   NY   +     L++  F TL+VR+ S++    +S L+ P+ S  RAVDG+W  W  +  CS KC  E G R R R C NPSP   GK C G SE  VSC G+ +
Sbjct:    5 CKGLDEEFFNCKDKDSKQTLPTGIWSMWSQWSSCTNQCKTHNKIPTSTRNRICIGSEDNKKELTSCFGENVEHQFCQWLSSCP-DSHWSEWTIFEPCTLRGKTPCGPGHQASIRKCSQPN-------CIGSDTKMTDCWSYVGCPTDIQSPTNVELISYGNGTFKVSWSVVPYGEIAQNVCIYSTMMSYSGKEIRTKIHQTSVYYNN-IAIQNYAFHVHYSEYLAVEYFHTLSVRLQSVNINDSKSVLTEPISSFSRAVDGEWQEWGNFGSCSTKCLGEKGVRIRTRKCTNPSPSLDGKICPGISESTVSCVGLEE 311          
BLAST of Hemicentin-1 vs. Planmine SMEST
Match: SMESG000021248.1 (SMESG000021248.1)

HSP 1 Score: 129.413 bits (324), Expect = 3.588e-31
Identity = 72/182 (39.56%), Postives = 95/182 (52.20%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDC 939
            P++G W  W  W+ CSITC       G   R R CNSP P+  GK C G   E   C   PCP  I G WS WS+WS CSK+C     + ++ ++R C+NP PK GG  C G ++    C+ LP CP+ GQW  W     C +     C  G Q   R C +PSPN  G+ C G  ++++ C
Sbjct: 3181 PINGAWSEWKPWTVCSITCGF----GGSQRRDRSCNSPEPKNNGKFCDGKELEVRACSKGPCP--IDGRWSSWSKWSYCSKSC----GSGIKQKARRCDNPTPKFGGANCVGTNIKKEKCNELP-CPVHGQWSNWGSWSECSTE----CGSGLQERDRTCTEPSPNFGGQWCRGPSKEVQKC 3347          

HSP 2 Score: 125.946 bits (315), Expect = 5.110e-30
Identity = 82/194 (42.27%), Postives = 97/194 (50.00%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNC-FNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPVTLQ 972
            P DG W  W  WS CS  C S     G+  R R C++PPP   GK C G   E   C  N PC  PI+G WSEW  W+ CS TC    S   Q R R CN+P PK+ G  CDG+ L  R C   P CPIDG+W  W     C     KSC  G ++  R+C+ P+P   G  C G   K E C   + CPV  Q
Sbjct: 3123 PTDGEWSPWQEWSICSTKCGS-----GIRQRTRRCDNPPPSNLGKPCIGEAIEDILCEGNLPC--PINGAWSEWKPWTVCSITCGFGGS---QRRDRSCNSPEPKNNGKFCDGKELEVRACSKGP-CPIDGRWSSWSKWSYC----SKSCGSGIKQKARRCDNPTPKFGGANCVGTNIKKEKC-NELPCPVHGQ 3300          

HSP 3 Score: 122.094 bits (305), Expect = 9.297e-29
Identity = 69/182 (37.91%), Postives = 93/182 (51.10%), Query Frame = 1
Query:  397 VDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCAL-GSQRYQRQCNKPSPNADGKPCEGIKEKLEDC 939
            + G W +W  WSKCS++C       G ++R RLCN+PPP   G  C G   E  +C    CP    G WS W EWS CS  C     + ++ R+R C+NP P + G  C GE++    C+    CPI+G W EW     C      +C   GSQR  R CN P P  +GK C+G + ++  C
Sbjct: 3067 IPGGWSAWQEWSKCSLSCGK-----GFISRKRLCNNPPPSEFGMTCIGEDFEKRDCLLRFCPT--DGEWSPWQEWSICSTKC----GSGIRQRTRRCDNPPPSNLGKPCIGEAIEDILCEGNLPCPINGAWSEWKPWTVCSI----TCGFGGSQRRDRSCNSPEPKNNGKFCDGKELEVRAC 3233          

HSP 4 Score: 83.5741 bits (205), Expect = 1.853e-16
Identity = 51/129 (39.53%), Postives = 65/129 (50.39%), Query Frame = 1
Query:  583 VPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCEGIKEKLED--CWFFIGCPV 963
            V I G WS W EWS CS +C          R RLCNNP P + G+ C GE    R C  L  CP DG+W  W     C ++    C  G ++  R+C+ P P+  GKPC G  E +ED  C   + CP+
Sbjct: 3065 VQIPGGWSAWQEWSKCSLSC----GKGFISRKRLCNNPPPSEFGMTCIGEDFEKRDC-LLRFCPTDGEWSPWQEWSICSTK----CGSGIRQRTRRCDNPPPSNLGKPCIG--EAIEDILCEGNLPCPI 3182          

HSP 5 Score: 65.4698 bits (158), Expect = 9.648e-11
Identity = 38/96 (39.58%), Postives = 46/96 (47.92%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSR 681
            PV G W +W +WS+CS  C S     GL  R R C  P P  GG+ C G   E   C  + C +      S WSEWS+CS  C L  S     R+R
Sbjct: 3296 PVHGQWSNWGSWSECSTECGS-----GLQERDRTCTEPSPNFGGQWCRGPSKEVQKCNENKCTINKVNIVSPWSEWSSCSLPC-LKNSVDTSERTR 3385          

HSP 6 Score: 56.9954 bits (136), Expect = 3.308e-8
Identity = 27/54 (50.00%), Postives = 33/54 (61.11%), Query Frame = 1
Query: 1303 DGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSCYG 1464
            DG+WS W  WS CS KC   +G R R R C+NP P + GKPC G + E + C G
Sbjct: 3125 DGEWSPWQEWSICSTKCG--SGIRQRTRRCDNPPPSNLGKPCIGEAIEDILCEG 3176          

HSP 7 Score: 52.7582 bits (125), Expect = 7.003e-7
Identity = 24/53 (45.28%), Postives = 34/53 (64.15%), Query Frame = 1
Query: 1300 VDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            +DG+WSSWS WS CS  C   +G + + R C+NP+P+ GG  C G + +K  C
Sbjct: 3240 IDGRWSSWSKWSYCSKSCG--SGIKQKARRCDNPTPKFGGANCVGTNIKKEKC 3290          

HSP 8 Score: 50.447 bits (119), Expect = 3.342e-6
Identity = 24/53 (45.28%), Postives = 33/53 (62.26%), Query Frame = 1
Query: 1300 VDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            V G+WS+W  WS+CS +C   +G + R+R C  PSP  GG+ C G S+E   C
Sbjct: 3297 VHGQWSNWGSWSECSTECG--SGLQERDRTCTEPSPNFGGQWCRGPSKEVQKC 3347          

HSP 9 Score: 50.0618 bits (118), Expect = 4.866e-6
Identity = 27/63 (42.86%), Postives = 34/63 (53.97%), Query Frame = 1
Query: 1270 SNPVRSKVRAVDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSC 1458
            S P+   V+ + G WS+W  WS CS  C K  G+ +R R CNNP P + G  C G   EK  C
Sbjct: 3058 SQPIYLTVQ-IPGGWSAWQEWSKCSLSCGK--GFISRKRLCNNPPPSEFGMTCIGEDFEKRDC 3117          
BLAST of Hemicentin-1 vs. Planmine SMEST
Match: SMESG000014733.1 (SMESG000014733.1)

HSP 1 Score: 115.161 bits (287), Expect = 1.175e-27
Identity = 64/173 (36.99%), Postives = 82/173 (47.40%), Query Frame = 1
Query:  394 PVDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQRQCNKPSPNADGKPCE 912
            PV G W  W+ W  CS TC +     G M R R+C +P P  GG  C     ET +CFN+ CP+ ++G W+EWS W +CS TC     +    R R+C NP+P +GG  C+        C   P C I+G W +W   G C       C  G     R C  P P   G PC 
Sbjct:  139 PVTGGWSDWSLWGACSATCGN-----GTMNRQRICTNPVPANGGALCKDSNNETQSCFNNTCPMVVNGGWTEWSNWGSCSVTCGNGNLS----RQRMCTNPIPTNGGTICNESGTQWMACSVNP-CAINGGWSDWSQWGNCSVF----CGNGVMSRTRNCTNPIPANGGSPCN 297          

HSP 2 Score: 74.7146 bits (182), Expect = 3.506e-14
Identity = 43/123 (34.96%), Postives = 65/123 (52.85%), Query Frame = 1
Query:  397 VDGMWGSWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNCFNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGGLKCDGESLNSRFCDYLP 765
            V+G W  W+ W  CS+TC +     G ++R R+C +P P  GG  C    T+   C  +PC   I+G WS+WS+W  CS  C       +  R+R C NP+P +GG  C     N+ + +++P
Sbjct:  199 VNGGWTEWSNWGSCSVTCGN-----GNLSRQRMCTNPIPTNGGTICNESGTQWMACSVNPCA--INGGWSDWSQWGNCSVFC----GNGVMSRTRNCTNPIPANGGSPC-----NNSYIEWMP 305          

HSP 3 Score: 55.4546 bits (132), Expect = 5.806e-8
Identity = 26/56 (46.43%), Postives = 34/56 (60.71%), Query Frame = 1
Query: 1297 AVDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSCYG 1464
            A++G WS WS W +CS  C   NG  +R R+C NP P +GG PCN +  E + C G
Sbjct:  255 AINGGWSDWSQWGNCSVFCG--NGVMSRTRNCTNPIPANGGSPCNNSYIEWMPCQG 308          

HSP 4 Score: 53.1434 bits (126), Expect = 2.902e-7
Identity = 35/117 (29.91%), Postives = 49/117 (41.88%), Query Frame = 1
Query: 1132 ALPNKKITSMNYWAIIDLRNLLSLNTFQTLAVRMSSIDFWKEESS-------LSNPVRSKVRAVDGKWSSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSCY 1461
             +PNK  +   Y +++ + N     T Q L +     + W   S         +      +  V G WS WS W  CSA C   NG   R R C NP P +GG  C  ++ E  SC+
Sbjct:   77 VIPNKFPSDYGYISVVSIGNTNDNLTMQALNIFDVFRNLWSNMSFNFPFGGIQAGSSIDILYPVTGGWSDWSLWGACSATCG--NGTMNRQRICTNPVPANGGALCKDSNNETQSCF 191          
The following BLAST results are available for this feature:
BLAST of Hemicentin-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HMCN19.104e-3238.95hemicentin 1 [Source:HGNC Symbol;Acc:HGNC:19194][more]
CFP4.461e-2737.50complement factor properdin [Source:HGNC Symbol;Ac... [more]
CFP4.867e-2737.50complement factor properdin [Source:HGNC Symbol;Ac... [more]
CFP4.867e-2737.50complement factor properdin [Source:HGNC Symbol;Ac... [more]
CFP5.003e-2738.73complement factor properdin [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Hemicentin-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adt-13.658e-2334.90A disintegrin and metalloproteinase with thrombosp... [more]
C36B7.55.051e-1325.76pep chromosome:WBcel235:X:7089228:7096449:-1 gene:... [more]
C36B7.57.516e-1325.76pep chromosome:WBcel235:X:7089228:7096449:-1 gene:... [more]
adt-28.529e-1230.39A disintegrin and metalloproteinase with thrombosp... [more]
adt-28.529e-1230.39A disintegrin and metalloproteinase with thrombosp... [more]
back to top
BLAST of Hemicentin-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sema5c3.297e-2835.79gene:FBgn0284221 transcript:FBtr0300339[more]
Sema5c3.331e-2835.79gene:FBgn0284221 transcript:FBtr0076052[more]
AdamTS-B1.928e-732.26gene:FBgn0029791 transcript:FBtr0301084[more]
AdamTS-B3.121e-739.06gene:FBgn0029791 transcript:FBtr0301083[more]
gogo2.255e-642.11gene:FBgn0052227 transcript:FBtr0074848[more]
back to top
BLAST of Hemicentin-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hmcn14.089e-3440.76hemicentin 1 [Source:ZFIN;Acc:ZDB-GENE-041014-322][more]
hmcn14.320e-3440.76hemicentin 1 [Source:ZFIN;Acc:ZDB-GENE-041014-322][more]
thbs2b3.866e-2748.44thrombospondin 2b [Source:ZFIN;Acc:ZDB-GENE-100623... [more]
thbs2b4.291e-2748.44thrombospondin 2b [Source:ZFIN;Acc:ZDB-GENE-100623... [more]
sema5ba1.392e-2526.80sema domain, seven thrombospondin repeats (type 1 ... [more]
back to top
BLAST of Hemicentin-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eftud26.926e-3240.53elongation factor Tu GTP binding domain containing... [more]
eftud27.183e-3240.53elongation factor Tu GTP binding domain containing... [more]
eftud27.797e-3240.53elongation factor Tu GTP binding domain containing... [more]
SEMA5B8.938e-3027.82semaphorin 5B [Source:NCBI gene;Acc:100493363][more]
THBS29.828e-2952.34thrombospondin 2 [Source:NCBI gene;Acc:100494997][more]
back to top
BLAST of Hemicentin-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hmcn14.801e-3238.95hemicentin 1 [Source:MGI Symbol;Acc:MGI:2685047][more]
Hmcn15.595e-3238.95hemicentin 1 [Source:MGI Symbol;Acc:MGI:2685047][more]
Sema5a1.333e-2730.00sema domain, seven thrombospondin repeats (type 1 ... [more]
Cfp2.812e-2626.92complement factor properdin [Source:MGI Symbol;Acc... [more]
Sema5b3.018e-2627.25sema domain, seven thrombospondin repeats (type 1 ... [more]
back to top
BLAST of Hemicentin-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|D3YXG0|HMCN1_MOUSE3.358e-3138.95Hemicentin-1 OS=Mus musculus OX=10090 GN=Hmcn1 PE=... [more]
sp|Q96RW7|HMCN1_HUMAN4.372e-3138.95Hemicentin-1 OS=Homo sapiens OX=9606 GN=HMCN1 PE=1... [more]
sp|D3ZTD8|SEM5A_RAT8.295e-2730.00Semaphorin-5A OS=Rattus norvegicus OX=10116 GN=Sem... [more]
sp|B3EWZ3|CADN_ACRMI1.423e-2637.22Coadhesin (Fragment) OS=Acropora millepora OX=4526... [more]
sp|P27918|PROP_HUMAN2.337e-2637.50Properdin OS=Homo sapiens OX=9606 GN=CFP PE=1 SV=2[more]
back to top
BLAST of Hemicentin-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2B4SK264.322e-4636.24Hemicentin-1 OS=Stylophora pistillata OX=50429 GN=... [more]
R7V9A72.277e-3933.06Methyltransf_FA domain-containing protein OS=Capit... [more]
A0A3M6URB44.536e-3945.26Uncharacterized protein OS=Pocillopora damicornis ... [more]
A0A3P9HHB87.783e-3933.52Ig-like domain-containing protein OS=Oryzias latip... [more]
A0A210Q4U01.497e-3831.00Hemicentin-1 OS=Mizuhopecten yessoensis OX=6573 GN... [more]
back to top
BLAST of Hemicentin-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000044661.15.206e-2939.66pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
thbs1a6.749e-2949.22thrombospondin 1a [Source:ZFIN;Acc:ZDB-GENE-120402... [more]
thbs1a6.829e-2949.22thrombospondin 1a [Source:ZFIN;Acc:ZDB-GENE-120402... [more]
thbs1b1.379e-2748.44thrombospondin-1-like [Source:NCBI gene;Acc:103031... [more]
thbs2b1.826e-2647.66thrombospondin 2 [Source:NCBI gene;Acc:103028711][more]
back to top
BLAST of Hemicentin-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000072.14.171e-2539.56pep scaffold:Pmarinus_7.0:GL479818:18487:29074:1 g... [more]
thbs1a2.393e-2445.31thrombospondin 1a [Source:ZFIN;Acc:ZDB-GENE-120402... [more]
THBS27.295e-2343.75thrombospondin 2 [Source:HGNC Symbol;Acc:HGNC:1178... [more]
cfp3.030e-2237.65complement factor properdin [Source:ZFIN;Acc:ZDB-G... [more]
cfp3.098e-2237.65complement factor properdin [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Hemicentin-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Hemicentin-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO373411.016e-3531.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO310441.632e-3430.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO395764.288e-3028.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO407606.751e-2935.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO332942.036e-2731.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Hemicentin-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hmcn17.063e-3438.71hemicentin 1 [Source:NCBI gene;Acc:101172646][more]
ENSORLT00000007327.21.481e-2929.76complement factor properdin [Source:NCBI gene;Acc:... [more]
thbs11.063e-2646.88thrombospondin 1 [Source:NCBI gene;Acc:100302441][more]
thbs2a1.786e-2546.88thrombospondin 2 [Source:NCBI gene;Acc:101175102][more]
thbs2a1.836e-2546.88thrombospondin 2 [Source:NCBI gene;Acc:101175102][more]
back to top
BLAST of Hemicentin-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000024603.10.000e+099.53SMESG000024603.1[more]
SMESG000050805.12.009e-6833.49SMESG000050805.1[more]
SMESG000050805.14.454e-6537.66SMESG000050805.1[more]
SMESG000021248.13.588e-3139.56SMESG000021248.1[more]
SMESG000014733.11.175e-2736.99SMESG000014733.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031784 ID=SMED30031784|Name=Hemicentin-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1587bp
ATTATTATTATTATTATTATTATCCATTCTCAATATCGATCTGTATGCGC
GCGCGTGTGTGTCTGTCTATGTGTGTATATCTGTGTGCAGCTCTGAGAAT
CATTATCGAAAGCGCAATCCTATGCAATATCGAATAATAATAATAATAAT
GATAATGATAATAATATTATTACTGCCAATAATGATCCAAGTCTAAAAAT
CAATAATAAATCTCCAATATTCTGCAAAGTGAGGCACACAATATCAATTG
TGAATCCATCAATTATGCCCGTTGATCGGATCATTCGCGTGTCATTCTTG
TGCATCTGCATGATCTGTTCGGTTATTGGAAGTATCGTGGCTTGTATGAC
CAGCCATCGTGTCAGTCCTTATATAGCAATCGCTCCTAATGAGCCAGTCG
ACGGGATGTGGGGCAGTTGGACGACTTGGTCGAAATGTTCTATAACATGT
TCAAGTGTCGACGTACAATATGGTTTGATGACTCGTTTTCGATTATGCAA
TTCTCCACCCCCTCAACTGGGAGGTAAAAACTGCACTGGAATATTTACAG
AAACTGATAACTGTTTTAATTCACCATGTCCTGTACCAATACATGGGAAT
TGGAGTGAATGGTCAGAATGGTCAGCATGCAGTAAAACCTGTAGACTTCC
GCAAAGTGCACCTTTACAAGTTAGAAGCAGATTATGTAATAATCCAGTTC
CAAAAGACGGGGGTCTAAAATGTGATGGCGAAAGCCTCAATTCAAGATTT
TGTGATTATTTACCGCAATGCCCAATTGACGGTCAGTGGGGAGAGTGGTA
CATTGCTGGTCCTTGTGAATCCAGAGACCAGAAGTCTTGCGCTCTTGGGA
GTCAGAGATATCAAAGACAATGCAATAAACCATCTCCAAATGCTGATGGA
AAACCATGTGAAGGAATAAAAGAAAAACTAGAAGACTGTTGGTTTTTTAT
CGGTTGTCCAGTTACCCTGCAACCACCATTAAATCTCCATTTGACTGGAA
ATGGATCTGGACTATTTAATGTATCTTGGTCAAGCGTACCATATGGGAAA
CTGGCATCTACATATAGAATATACAAAACAATCGAAGATGAATCCAACAG
AGAAATCAAAACAAATTATGAAGATCACAATGCCTTACCGAACAAAAAGA
TTACCAGCATGAATTATTGGGCAATAATTGACCTGAGGAATCTTTTATCC
TTAAACACCTTTCAAACATTAGCTGTTAGGATGTCGTCAATTGATTTTTG
GAAGGAGGAATCCAGCCTTTCAAATCCAGTTCGTTCAAAGGTCCGAGCAG
TTGACGGAAAATGGAGTTCCTGGAGCTATTGGTCTGATTGTTCGGCCAAA
TGTCACAAGGAGAATGGGTACCGAACCCGAAATCGAGATTGCAATAATCC
GTCTCCACGCGATGGTGGTAAACCATGCAATGGCAATTCAGAGGAGAAAG
TCTCGTGTTATGGAATGGGAGATTGTTGAGGGAAATTTAAGATGTCTTTG
TAAATTTGCAGATAAAAATAATAAAATTGTTTTTATATTTATGTTTGATT
CTAAGAATATCACTTTATGTGTGTTATTTTATTTAAT
back to top

protein sequence of SMED30031784-orf-1

>SMED30031784-orf-1 ID=SMED30031784-orf-1|Name=SMED30031784-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=405bp
MPVDRIIRVSFLCICMICSVIGSIVACMTSHRVSPYIAIAPNEPVDGMWG
SWTTWSKCSITCSSVDVQYGLMTRFRLCNSPPPQLGGKNCTGIFTETDNC
FNSPCPVPIHGNWSEWSEWSACSKTCRLPQSAPLQVRSRLCNNPVPKDGG
LKCDGESLNSRFCDYLPQCPIDGQWGEWYIAGPCESRDQKSCALGSQRYQ
RQCNKPSPNADGKPCEGIKEKLEDCWFFIGCPVTLQPPLNLHLTGNGSGL
FNVSWSSVPYGKLASTYRIYKTIEDESNREIKTNYEDHNALPNKKITSMN
YWAIIDLRNLLSLNTFQTLAVRMSSIDFWKEESSLSNPVRSKVRAVDGKW
SSWSYWSDCSAKCHKENGYRTRNRDCNNPSPRDGGKPCNGNSEEKVSCYG
MGDC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036383TSP1_rpt_sf
IPR000884TSP1_rpt
Vocabulary: biological process
TermDefinition
GO:0002376immune system process
GO:0006957complement activation, alternative pathway
GO:0045087innate immune response
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0031012extracellular matrix
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR01705TSP1REPEATcoord: 111..124
score: 54.15
coord: 368..379
score: 46.58
coord: 387..398
score: 34.0
NoneNo IPR availablePANTHERPTHR22906PROPERDINcoord: 44..163
NoneNo IPR availablePANTHERPTHR22906:SF30COMPLEMENT FACTOR PROPERDINcoord: 110..395
NoneNo IPR availablePANTHERPTHR22906:SF30COMPLEMENT FACTOR PROPERDINcoord: 44..163
NoneNo IPR availablePANTHERPTHR22906PROPERDINcoord: 110..395
NoneNo IPR availablePROSITEPS51257PROKAR_LIPOPROTEINcoord: 1..27
score: 5.0
NoneNo IPR availableSIGNALP_EUKSignalP-TMSignalP-TMcoord: 1..22
score: 0.527
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
IPR000884Thrombospondin type-1 (TSP1) repeatSMARTSM00209TSP1_2coord: 172..232
e-value: 7.7
score: 1.4
coord: 113..170
e-value: 1.3E-7
score: 41.3
coord: 350..403
e-value: 1.5E-5
score: 34.4
coord: 49..106
e-value: 3.4E-9
score: 46.5
IPR000884Thrombospondin type-1 (TSP1) repeatPFAMPF00090TSP_1coord: 174..225
e-value: 0.051
score: 13.8
coord: 351..404
e-value: 2.2E-7
score: 31.0
coord: 114..169
e-value: 3.3E-8
score: 33.6
coord: 51..105
e-value: 3.1E-7
score: 30.5
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 347..402
score: 11.68
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 110..170
score: 11.764
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 46..106
score: 11.437
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilyGENE3DG3DSA:2.20.100.10coord: 346..402
e-value: 4.8E-16
score: 60.7
coord: 110..168
e-value: 2.8E-15
score: 58.3
coord: 172..226
e-value: 3.9E-8
score: 35.4
coord: 45..105
e-value: 1.5E-15
score: 59.1
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILYSSF82895TSP-1 type 1 repeatcoord: 106..165
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILYSSF82895TSP-1 type 1 repeatcoord: 45..101
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILYSSF82895TSP-1 type 1 repeatcoord: 346..398
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILYSSF82895TSP-1 type 1 repeatcoord: 169..226