Ras-related protein Rab-5A

Overview
NameRas-related protein Rab-5A
Smed IDSMED30031780
Length (bp)854
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ras-related protein Rab-5A (SMED30031780) t-SNE clustered cells

Violin plots show distribution of expression levels for Ras-related protein Rab-5A (SMED30031780) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ras-related protein Rab-5A (SMED30031780) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ras-related protein Rab-5A (SMED30031780) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031780

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30031780SMESG000065500.1 Contig1027GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30031780SMESG000065500.1 Contig1027GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30031780SMESG000065500.1 Contig1027GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
posterior muscle cellSMED30031780SMESG000065500.1 dd_Smed_v4_2991_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30031780SMESG000065500.1 dd_Smed_v4_2991_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031780SMESG000065500.1 Contig54733newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031780SMESG000065500.1 Contig54733uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031780SMESG000065500.1 Contig1027GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
reproductive organSMED30031780SMESG000065500.1 Contig1027GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ras-related protein Rab-5A vs. Ensembl Human
Match: RAB5A (RAB5A, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9783])

HSP 1 Score: 224.942 bits (572), Expect = 4.075e-73
Identity = 109/182 (59.89%), Postives = 137/182 (75.27%), Query Frame = 2
Query:   38 PLMNSRLGSHKLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLPASIGENVGENA 583
            P   +++   KLVLLGE+ VGKSSLVLRFV+GQF+E  EST+GAAF+TQTV     T+KFEIWDTAGQERY SLAPMYYRGA+AAIV+YDITN +SF  AK+W++EL+ +A    VI L GNK DL + R V   E + +A DN L+FME S K S+NVNE+F+ IAK+LP +  +N G N+
Sbjct:   12 PNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANS 193          
BLAST of Ras-related protein Rab-5A vs. Ensembl Human
Match: RAB5C (RAB5C, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9785])

HSP 1 Score: 222.246 bits (565), Expect = 4.322e-72
Identity = 113/206 (54.85%), Postives = 144/206 (69.90%), Query Frame = 2
Query:   38 PLMNSRLGSHKLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLPASIGENVGENAETVDRNN--IPVQDLNAHERGCSC 649
            P   +++   KLVLLGE+ VGKSSLVLRFV+GQF+E  EST+GAAF+TQTV     T+KFEIWDTAGQERY SLAPMYYRGA+AAIV+YDITN+D+F  AK+W++EL+ +A    VI L GNK DL   R V   E + +A DN L+FME S K ++NVNE+F+ IAK+LP    +N  +NA      N  + +Q+ N   R   C
Sbjct:   13 PAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLP----KNEPQNATGAPGRNRGVDLQENNPASRSQCC 214          
BLAST of Ras-related protein Rab-5A vs. Ensembl Human
Match: RAB5C (RAB5C, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9785])

HSP 1 Score: 222.246 bits (565), Expect = 4.322e-72
Identity = 113/206 (54.85%), Postives = 144/206 (69.90%), Query Frame = 2
Query:   38 PLMNSRLGSHKLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLPASIGENVGENAETVDRNN--IPVQDLNAHERGCSC 649
            P   +++   KLVLLGE+ VGKSSLVLRFV+GQF+E  EST+GAAF+TQTV     T+KFEIWDTAGQERY SLAPMYYRGA+AAIV+YDITN+D+F  AK+W++EL+ +A    VI L GNK DL   R V   E + +A DN L+FME S K ++NVNE+F+ IAK+LP    +N  +NA      N  + +Q+ N   R   C
Sbjct:   13 PAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLP----KNEPQNATGAPGRNRGVDLQENNPASRSQCC 214          
BLAST of Ras-related protein Rab-5A vs. Ensembl Human
Match: RAB5B (RAB5B, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9784])

HSP 1 Score: 221.861 bits (564), Expect = 5.552e-72
Identity = 105/175 (60.00%), Postives = 135/175 (77.14%), Query Frame = 2
Query:   50 SRLGSHKLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLPASIGENVG 574
            S++   KLVLLGE+ VGKSSLVLRFV+GQF+E  EST+GAAF+TQ+V     T+KFEIWDTAGQERY SLAPMYYRGA+AAIV+YDITN ++F  AK+W++EL+ +A    VI L GNK DL + R V   E + +A DN L+FME S K ++NVN++F+ IAK+LP S  +N+G
Sbjct:   16 SKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQSVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQRQASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKKLPKSEPQNLG 190          
BLAST of Ras-related protein Rab-5A vs. Ensembl Human
Match: RAB5B (RAB5B, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9784])

HSP 1 Score: 221.861 bits (564), Expect = 5.552e-72
Identity = 105/175 (60.00%), Postives = 135/175 (77.14%), Query Frame = 2
Query:   50 SRLGSHKLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLPASIGENVG 574
            S++   KLVLLGE+ VGKSSLVLRFV+GQF+E  EST+GAAF+TQ+V     T+KFEIWDTAGQERY SLAPMYYRGA+AAIV+YDITN ++F  AK+W++EL+ +A    VI L GNK DL + R V   E + +A DN L+FME S K ++NVN++F+ IAK+LP S  +N+G
Sbjct:   16 SKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQSVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQRQASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKKLPKSEPQNLG 190          
BLAST of Ras-related protein Rab-5A vs. Ensembl Celegans
Match: rab-5 (RAB family [Source:UniProtKB/TrEMBL;Acc:P91857])

HSP 1 Score: 227.254 bits (578), Expect = 1.434e-74
Identity = 117/204 (57.35%), Postives = 145/204 (71.08%), Query Frame = 2
Query:   38 PLMNSRLGSHKLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLPASIGENVGENAETVDRNNIPVQDLNAHERGCSC 649
            P   +R    KLVLLGE+ VGKSSLVLRFV+GQF+E  EST+GAAF+TQTV     TIKFEIWDTAGQERY SLAPMYYRGA+AAIV+YDITN +SF+ AK+W++EL+ +A    V+ L GNK D+ + R V   E   +A+DN L+FME S K S+NVN++F+ IAK+LP  IG   GE   TVD N  P Q     ++G  C
Sbjct:   11 PGGPNRTCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDATIKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQESFQKAKNWVKELQRQASPNIVMALAGNKADVANKRTVEYEEANAYAEDNALLFMETSAKTSMNVNDIFMAIAKKLP--IGPAQGEPTGTVDMNQ-PQQ----QQKGSCC 207          
BLAST of Ras-related protein Rab-5A vs. Ensembl Celegans
Match: rab-6.2 (Ras-related protein Rab-6.2 [Source:UniProtKB/Swiss-Prot;Acc:Q22782])

HSP 1 Score: 166.777 bits (421), Expect = 5.758e-51
Identity = 82/198 (41.41%), Postives = 123/198 (62.12%), Query Frame = 2
Query:   56 LGSHKLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLPASIGENVGENAETVDRNNIPVQDLNAHERGCSC 649
            L   KLV LGE  VGK+SL+ RF+   F+   ++T+G  F+++T+    +T++ ++WDTAGQER+RSL P Y R +  A+V+YDITNS+SF     WI++++ +  S  +I+LVGNK DL D R+V+  EGE+ AK+  +MF+E S K   NV ++F  IA  LP  I ++  E    V  + I  + +   E  C C
Sbjct:    8 LKKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNSNSFHQTSKWIDDVRTERGSDVIIMLVGNKTDLSDKRQVTTDEGERKAKELNVMFIETSAKAGYNVKQLFRRIAGALPGIIKDDPVEPPNVVTMDPIRQRQIVTDEGSCWC 205          
BLAST of Ras-related protein Rab-5A vs. Ensembl Celegans
Match: rab-6.1 (Ras-related protein Rab-6.1 [Source:UniProtKB/Swiss-Prot;Acc:P34213])

HSP 1 Score: 166.777 bits (421), Expect = 6.415e-51
Identity = 83/204 (40.69%), Postives = 125/204 (61.27%), Query Frame = 2
Query:   41 LMNSRLGSHKLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLPASIGENVGENAETVDRNNIPVQDLNAHE-RGCSC 649
              N+ L   KLV LGE  VGK+S++ RF+   F+   ++T+G  F+++T+    +TI+ ++WDTAGQER+RSL P Y R +  A+V+YDITN++SF     W+++++ +     +IVLVGNK DL D R+VS  +GE+ A+D  +MF+E S K   NV ++F +IA  LP  + E   E    V  N  P +D    + R C C
Sbjct:    4 FTNNALKKFKLVFLGEQSVGKTSIITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTIRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDITNANSFHQTTKWVDDVRNERGCDVIIVLVGNKTDLADKRQVSTEDGEKKARDLNVMFIETSAKAGYNVKQLFRKIATALPGIVQEETPEQPNIVIMN--PPKDAEESQGRQCPC 205          
BLAST of Ras-related protein Rab-5A vs. Ensembl Celegans
Match: unc-108 (pep chromosome:WBcel235:I:3824947:3826514:1 gene:WBGene00006833.1 transcript:F53F10.4a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-108)

HSP 1 Score: 155.606 bits (392), Expect = 1.760e-46
Identity = 76/168 (45.24%), Postives = 111/168 (66.07%), Query Frame = 2
Query:   68 KLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLPASIGENV 571
            K +++G+T VGKS L+L+F   +F  + + T+G  F  + V   GK IK +IWDTAGQE +RS+   YYRGA  A+++YDIT  D+F +  SW+E+ +  + S  VI+L+GNK DL+  R+V   EGE  A+++GL+FME S K + NV E FI+ AK++   I E V
Sbjct:    8 KYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVTIDGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTSWLEDARQHSNSNMVIMLIGNKSDLEARREVKREEGEAFAREHGLVFMETSAKTAANVEEAFIDTAKEIYRKIQEGV 175          
BLAST of Ras-related protein Rab-5A vs. Ensembl Celegans
Match: unc-108 (pep chromosome:WBcel235:I:3822883:3826514:1 gene:WBGene00006833.1 transcript:F53F10.4b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-108)

HSP 1 Score: 155.221 bits (391), Expect = 3.086e-46
Identity = 76/168 (45.24%), Postives = 111/168 (66.07%), Query Frame = 2
Query:   68 KLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLPASIGENV 571
            K +++G+T VGKS L+L+F   +F  + + T+G  F  + V   GK IK +IWDTAGQE +RS+   YYRGA  A+++YDIT  D+F +  SW+E+ +  + S  VI+L+GNK DL+  R+V   EGE  A+++GL+FME S K + NV E FI+ AK++   I E V
Sbjct:   17 KYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVTIDGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTSWLEDARQHSNSNMVIMLIGNKSDLEARREVKREEGEAFAREHGLVFMETSAKTAANVEEAFIDTAKEIYRKIQEGV 184          
BLAST of Ras-related protein Rab-5A vs. Ensembl Fly
Match: Rab5 (gene:FBgn0014010 transcript:FBtr0330670)

HSP 1 Score: 218.009 bits (554), Expect = 1.171e-70
Identity = 104/167 (62.28%), Postives = 130/167 (77.84%), Query Frame = 2
Query:   68 KLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLPASIGEN 568
            KLVLLGE+ VGKSSLVLRFV+GQF+E  EST+GAAF+TQT+      +KFEIWDTAGQERY SLAPMYYRGA+AAIV+YDI N DSF+ AK+W++EL  +A    VI L GNK DL + R V   E +Q+A++NGL+FME S K  +NVN++F+ IAK+LP + G N
Sbjct:   31 KLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSNIRVVEFDEAKQYAEENGLLFMETSAKTGMNVNDIFLAIAKKLPKNDGAN 197          
BLAST of Ras-related protein Rab-5A vs. Ensembl Fly
Match: Rab5 (gene:FBgn0014010 transcript:FBtr0077796)

HSP 1 Score: 218.009 bits (554), Expect = 1.171e-70
Identity = 104/167 (62.28%), Postives = 130/167 (77.84%), Query Frame = 2
Query:   68 KLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLPASIGEN 568
            KLVLLGE+ VGKSSLVLRFV+GQF+E  EST+GAAF+TQT+      +KFEIWDTAGQERY SLAPMYYRGA+AAIV+YDI N DSF+ AK+W++EL  +A    VI L GNK DL + R V   E +Q+A++NGL+FME S K  +NVN++F+ IAK+LP + G N
Sbjct:   31 KLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSNIRVVEFDEAKQYAEENGLLFMETSAKTGMNVNDIFLAIAKKLPKNDGAN 197          
BLAST of Ras-related protein Rab-5A vs. Ensembl Fly
Match: Rab5 (gene:FBgn0014010 transcript:FBtr0077793)

HSP 1 Score: 218.009 bits (554), Expect = 1.171e-70
Identity = 104/167 (62.28%), Postives = 130/167 (77.84%), Query Frame = 2
Query:   68 KLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLPASIGEN 568
            KLVLLGE+ VGKSSLVLRFV+GQF+E  EST+GAAF+TQT+      +KFEIWDTAGQERY SLAPMYYRGA+AAIV+YDI N DSF+ AK+W++EL  +A    VI L GNK DL + R V   E +Q+A++NGL+FME S K  +NVN++F+ IAK+LP + G N
Sbjct:   31 KLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSNIRVVEFDEAKQYAEENGLLFMETSAKTGMNVNDIFLAIAKKLPKNDGAN 197          
BLAST of Ras-related protein Rab-5A vs. Ensembl Fly
Match: Rab5 (gene:FBgn0014010 transcript:FBtr0077797)

HSP 1 Score: 218.009 bits (554), Expect = 1.171e-70
Identity = 104/167 (62.28%), Postives = 130/167 (77.84%), Query Frame = 2
Query:   68 KLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLPASIGEN 568
            KLVLLGE+ VGKSSLVLRFV+GQF+E  EST+GAAF+TQT+      +KFEIWDTAGQERY SLAPMYYRGA+AAIV+YDI N DSF+ AK+W++EL  +A    VI L GNK DL + R V   E +Q+A++NGL+FME S K  +NVN++F+ IAK+LP + G N
Sbjct:   31 KLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSNIRVVEFDEAKQYAEENGLLFMETSAKTGMNVNDIFLAIAKKLPKNDGAN 197          
BLAST of Ras-related protein Rab-5A vs. Ensembl Fly
Match: Rab5 (gene:FBgn0014010 transcript:FBtr0077795)

HSP 1 Score: 218.009 bits (554), Expect = 1.171e-70
Identity = 104/167 (62.28%), Postives = 130/167 (77.84%), Query Frame = 2
Query:   68 KLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLPASIGEN 568
            KLVLLGE+ VGKSSLVLRFV+GQF+E  EST+GAAF+TQT+      +KFEIWDTAGQERY SLAPMYYRGA+AAIV+YDI N DSF+ AK+W++EL  +A    VI L GNK DL + R V   E +Q+A++NGL+FME S K  +NVN++F+ IAK+LP + G N
Sbjct:   31 KLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSNIRVVEFDEAKQYAEENGLLFMETSAKTGMNVNDIFLAIAKKLPKNDGAN 197          
BLAST of Ras-related protein Rab-5A vs. Ensembl Zebrafish
Match: rab5aa (RAB5A, member RAS oncogene family, a [Source:ZFIN;Acc:ZDB-GENE-030131-139])

HSP 1 Score: 220.705 bits (561), Expect = 1.156e-71
Identity = 106/178 (59.55%), Postives = 135/178 (75.84%), Query Frame = 2
Query:   50 SRLGSHKLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLPASIGENVGENA 583
            +++   KLVLLGE+ VGKSSLVLRFV+GQF+E  EST+GAAF+TQT+     T+KFEIWDTAGQERY SLAPMYYRGA+AAIV+YDITN +SF  AK+W++EL+ +A    VI L GNK DL + R V   + + +A DN L+FME S K S+NVNE+F+ IAK+LP S  +  G N+
Sbjct:   17 NKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTLCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQDAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKSEPQAAGANS 194          
BLAST of Ras-related protein Rab-5A vs. Ensembl Zebrafish
Match: rab5aa (RAB5A, member RAS oncogene family, a [Source:ZFIN;Acc:ZDB-GENE-030131-139])

HSP 1 Score: 220.705 bits (561), Expect = 1.156e-71
Identity = 106/178 (59.55%), Postives = 135/178 (75.84%), Query Frame = 2
Query:   50 SRLGSHKLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLPASIGENVGENA 583
            +++   KLVLLGE+ VGKSSLVLRFV+GQF+E  EST+GAAF+TQT+     T+KFEIWDTAGQERY SLAPMYYRGA+AAIV+YDITN +SF  AK+W++EL+ +A    VI L GNK DL + R V   + + +A DN L+FME S K S+NVNE+F+ IAK+LP S  +  G N+
Sbjct:   17 NKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTLCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQDAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKSEPQAAGANS 194          
BLAST of Ras-related protein Rab-5A vs. Ensembl Zebrafish
Match: rab5c (RAB5C, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-031118-30])

HSP 1 Score: 218.009 bits (554), Expect = 1.694e-70
Identity = 106/173 (61.27%), Postives = 134/173 (77.46%), Query Frame = 2
Query:   38 PLMNSRLGSHKLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLPAS 556
            P+ N ++   KLVLLGE+ VGKSSLVLRFV+GQF+E  EST+GAAF+TQT+     T+KFEIWDTAGQERY SLAPMYYRGA+AAIV+YDITN+D+F  AK+W++EL+ +A    VI L GNK DL + R V   E + +A DN L+FME S K ++NVNE+F+ IAK+LP S
Sbjct:   15 PVGN-KICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTLCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFTRAKNWVKELQRQASPNIVIALAGNKADLANKRAVDFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKS 186          
BLAST of Ras-related protein Rab-5A vs. Ensembl Zebrafish
Match: rab5c (RAB5C, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-031118-30])

HSP 1 Score: 218.009 bits (554), Expect = 1.694e-70
Identity = 106/173 (61.27%), Postives = 134/173 (77.46%), Query Frame = 2
Query:   38 PLMNSRLGSHKLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLPAS 556
            P+ N ++   KLVLLGE+ VGKSSLVLRFV+GQF+E  EST+GAAF+TQT+     T+KFEIWDTAGQERY SLAPMYYRGA+AAIV+YDITN+D+F  AK+W++EL+ +A    VI L GNK DL + R V   E + +A DN L+FME S K ++NVNE+F+ IAK+LP S
Sbjct:   15 PVGN-KICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTLCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFTRAKNWVKELQRQASPNIVIALAGNKADLANKRAVDFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKS 186          
BLAST of Ras-related protein Rab-5A vs. Ensembl Zebrafish
Match: rab5ab (RAB5A, member RAS oncogene family, b [Source:ZFIN;Acc:ZDB-GENE-040122-3])

HSP 1 Score: 217.238 bits (552), Expect = 2.652e-70
Identity = 104/181 (57.46%), Postives = 135/181 (74.59%), Query Frame = 2
Query:   38 PLMNSRLGSHKLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLPASIGENVGEN 580
            P   +++   KLVLLGE+ VGKSSLVLRFV+GQF+E  EST+GAAF+TQT+     T+KFEIWDTAGQERY SLAPMYYRGA+AAIV+YDITN +SF  AK+W++EL+ +A    VI L GNK DL + R +   + + +A DN L+FME S K S+NV+E+F+ IAK+LP +  +  G N
Sbjct:   13 PNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTLCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALAGNKADLANKRALDFQDAQSYADDNSLLFMETSAKTSMNVSEIFMAIAKKLPKNEPQPAGAN 193          
BLAST of Ras-related protein Rab-5A vs. Ensembl Xenopus
Match: rab5a (RAB5A, member RAS oncogene family [Source:NCBI gene;Acc:493430])

HSP 1 Score: 222.246 bits (565), Expect = 4.464e-72
Identity = 109/181 (60.22%), Postives = 134/181 (74.03%), Query Frame = 2
Query:   38 PLMNSRLGSHKLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLPASIGENVGEN 580
            P   +++   KLVLLGE+ VGKSSLVLRFV+GQF+E  EST+GAAF+TQTV     T+KFEIWDTAGQERY SLAPMYYRGA+AAIV+YDITN +SF  AK+W++EL+ +A    VI L GNK DL   R V   E + +A DN L+FME S K SVNVNE+F+ IAK+LP +  +  G N
Sbjct:   13 PNAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLASKRAVDFQEAQAYADDNSLLFMETSAKTSVNVNEIFMAIAKKLPKTEPQAGGSN 193          
BLAST of Ras-related protein Rab-5A vs. Ensembl Xenopus
Match: rab5b (RAB5B, member RAS oncogene family [Source:NCBI gene;Acc:448258])

HSP 1 Score: 216.468 bits (550), Expect = 7.834e-70
Identity = 103/174 (59.20%), Postives = 132/174 (75.86%), Query Frame = 2
Query:   50 SRLGSHKLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLPASIGENV 571
            S++   KLVLLGE+ VGKSSLVLRFV+GQF+E  EST+GAAF+TQ+V     T+KFEIWDTAGQERY SLAPMYYRGA+AAIV+YDITN ++F  AK+W++EL+ +A    VI L GNK DL   R V   E + +A DN L+FME S K ++NVN++F+ IAK+LP +  +N 
Sbjct:   16 SKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQSVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQRQASPNIVIALSGNKADLTSKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKKLPKTEPQNT 189          
BLAST of Ras-related protein Rab-5A vs. Ensembl Xenopus
Match: rab5d (RAB5D, member RAS oncogene family [Source:NCBI gene;Acc:594964])

HSP 1 Score: 209.534 bits (532), Expect = 3.034e-67
Identity = 105/201 (52.24%), Postives = 140/201 (69.65%), Query Frame = 2
Query:   50 SRLGSHKLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLPASIGENVGENAETVDRNN-IPVQDLNAHERGCSC 649
            +++   KLVLLG+  VGKSSLVLRFV+GQF+E  E+T+GAAF+ Q+V     T+KFEIWDTAGQERY SLAPMYYRGA+AAIV++DIT  ++F+ AK+W++EL+ +A    VI L GNK DL + R V   E + +A+D GL+FME S K ++NVNE+F+ IAK++P S  +N    A    RN  + VQ      R   C
Sbjct:   15 TKICQFKLVLLGDMAVGKSSLVLRFVKGQFDEFQETTIGAAFLAQSVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVFDITKPETFDRAKAWVKELQRQASPNIVIALAGNKSDLAEKRMVEYEEAQAYAEDTGLLFMETSAKTAMNVNELFLAIAKKMPKSDAQNPTHAA----RNRGVNVQGSEQQPRSGCC 211          
BLAST of Ras-related protein Rab-5A vs. Ensembl Xenopus
Match: ncapd2 (non-SMC condensin I complex subunit D2 [Source:Xenbase;Acc:XB-GENE-5854776])

HSP 1 Score: 169.474 bits (428), Expect = 9.585e-52
Identity = 79/172 (45.93%), Postives = 117/172 (68.02%), Query Frame = 2
Query:   68 KLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLPASIGENVGENA 583
            K+ LLG+T VGKSS+V RFV+  F+  +  T+GA+FMT+TV +  +  KF IWDTAGQER+ SLAPMYYRG+ AA+++YDIT  D+F   K W++ELK   P   V+ + GNK DL D+R+V+  +  ++A+  G + +E S K+++NV E+F  I++++P       G N 
Sbjct:    7 KVCLLGDTGVGKSSIVSRFVQDHFDHNISPTIGASFMTKTVPSGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKQDTFHTLKKWVKELKEHGPENIVMAIAGNKCDLSDTREVTMKDAREYAESIGAIVVETSAKNAINVEELFQGISRRIPPLDPHENGSNG 178          
BLAST of Ras-related protein Rab-5A vs. Ensembl Xenopus
Match: rab41 (RAB41, member RAS oncogene family [Source:NCBI gene;Acc:100124772])

HSP 1 Score: 166.392 bits (420), Expect = 2.222e-50
Identity = 83/200 (41.50%), Postives = 124/200 (62.00%), Query Frame = 2
Query:   56 LGSHKLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLPA--SIGENVGENAETVDRNNIPVQDLNAHERGCSC 649
            L   KLV LGE  VGK+SL+ RF+   F+   ++T+G  F+++T+    +T++ ++WDTAGQER+RSL P Y R +  A+V+YDITN +SF+    WI++++ +  S  +I+LVGNK DL D R+++  EGEQ AK+  +MF+E S K   NV ++F  +A  LP   S  E   E+   +     P Q +   E GCSC
Sbjct:   13 LRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSTIAVVVYDITNLNSFQQTSKWIDDVRTERGSDVIIMLVGNKTDLADKRQITTEEGEQRAKELSVMFIETSAKTGYNVKQLFRRVAAALPGMDSTPEKSKEDMIDIKLEKPPEQPVT--ESGCSC 210          
BLAST of Ras-related protein Rab-5A vs. Ensembl Mouse
Match: Rab5a (RAB5A, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:105926])

HSP 1 Score: 224.942 bits (572), Expect = 2.859e-73
Identity = 109/182 (59.89%), Postives = 137/182 (75.27%), Query Frame = 2
Query:   38 PLMNSRLGSHKLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLPASIGENVGENA 583
            P   +++   KLVLLGE+ VGKSSLVLRFV+GQF+E  EST+GAAF+TQTV     T+KFEIWDTAGQERY SLAPMYYRGA+AAIV+YDITN +SF  AK+W++EL+ +A    VI L GNK DL + R V   E + +A DN L+FME S K S+NVNE+F+ IAK+LP +  +N G N+
Sbjct:   12 PNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANS 193          
BLAST of Ras-related protein Rab-5A vs. Ensembl Mouse
Match: Rab5b (RAB5B, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:105938])

HSP 1 Score: 221.861 bits (564), Expect = 3.812e-72
Identity = 105/175 (60.00%), Postives = 135/175 (77.14%), Query Frame = 2
Query:   50 SRLGSHKLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLPASIGENVG 574
            S++   KLVLLGE+ VGKSSLVLRFV+GQF+E  EST+GAAF+TQ+V     T+KFEIWDTAGQERY SLAPMYYRGA+AAIV+YDITN ++F  AK+W++EL+ +A    VI L GNK DL + R V   E + +A DN L+FME S K ++NVN++F+ IAK+LP S  +N+G
Sbjct:   16 SKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQSVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQRQASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKKLPKSEPQNLG 190          
BLAST of Ras-related protein Rab-5A vs. Ensembl Mouse
Match: Rab5c (RAB5C, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:105306])

HSP 1 Score: 221.861 bits (564), Expect = 3.980e-72
Identity = 112/205 (54.63%), Postives = 143/205 (69.76%), Query Frame = 2
Query:   38 PLMNSRLGSHKLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLPASIGEN-VGENAETVDRNNIPVQDLNAHERGCSC 649
            P   +++   KLVLLGE+ VGKSSLVLRFV+GQF+E  EST+GAAF+TQTV     T+KFEIWDTAGQERY SLAPMYYRGA+AAIV+YDITN+D+F  AK+W++EL+ +A    VI L GNK DL   R V   E + +A DN L+FME S K ++NVNE+F+ IAK+LP +  +N  G    T     + +Q+ N   R   C
Sbjct:   13 PAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNAAGAPGRT---RGVDLQESNPASRSQCC 214          
BLAST of Ras-related protein Rab-5A vs. Ensembl Mouse
Match: Rab5c (RAB5C, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:105306])

HSP 1 Score: 213.386 bits (542), Expect = 1.630e-68
Identity = 114/223 (51.12%), Postives = 145/223 (65.02%), Query Frame = 2
Query:   38 PLMNSRLGSHKLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKV---------SPV---------EGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLPASIGEN-VGENAETVDRNNIPVQDLNAHERGCSC 649
            P   +++   KLVLLGE+ VGKSSLVLRFV+GQF+E  EST+GAAF+TQTV     T+KFEIWDTAGQERY SLAPMYYRGA+AAIV+YDITN+D+F  AK+W++EL+ +A    VI L GNK DL   R V         SP          E + +A DN L+FME S K ++NVNE+F+ IAK+LP +  +N  G    T     + +Q+ N   R   C
Sbjct:   13 PAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQPCHLPCSPPTLFLTCLSQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNAAGAPGRT---RGVDLQESNPASRSQCC 232          
BLAST of Ras-related protein Rab-5A vs. Ensembl Mouse
Match: Rab22a (RAB22A, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:105072])

HSP 1 Score: 172.94 bits (437), Expect = 3.473e-53
Identity = 78/163 (47.85%), Postives = 116/163 (71.17%), Query Frame = 2
Query:   68 KLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLPAS 556
            K+ LLG+T VGKSS+V RFV   F+  +  T+GA+FMT+TV    +  KF IWDTAGQER+R+LAPMYYRG+ AAI++YDIT  ++F   K+W+ EL+   P   V+ + GNK DL D R+V   + + +A     +F+E S K+++N+NE+FIEI++++P++
Sbjct:    7 KVCLLGDTGVGKSSIVWRFVEDSFDPNINPTIGASFMTKTVQYQNELHKFLIWDTAGQERFRALAPMYYRGSAAAIIVYDITKEETFSTLKNWVRELRQHGPPSIVVAIAGNKCDLTDVREVMERDAKDYADSIHAIFVETSAKNAININELFIEISRRIPST 169          
BLAST of Ras-related protein Rab-5A vs. UniProt/SwissProt
Match: sp|Q0IIG7|RAB5A_BOVIN (Ras-related protein Rab-5A OS=Bos taurus OX=9913 GN=RAB5A PE=1 SV=1)

HSP 1 Score: 224.942 bits (572), Expect = 1.853e-72
Identity = 109/182 (59.89%), Postives = 137/182 (75.27%), Query Frame = 2
Query:   38 PLMNSRLGSHKLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLPASIGENVGENA 583
            P   +++   KLVLLGE+ VGKSSLVLRFV+GQF+E  EST+GAAF+TQTV     T+KFEIWDTAGQERY SLAPMYYRGA+AAIV+YDITN +SF  AK+W++EL+ +A    VI L GNK DL + R V   E + +A DN L+FME S K S+NVNE+F+ IAK+LP +  +N G N+
Sbjct:   12 PNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANS 193          
BLAST of Ras-related protein Rab-5A vs. UniProt/SwissProt
Match: sp|P61271|RAB5A_MACFA (Ras-related protein Rab-5A OS=Macaca fascicularis OX=9541 GN=RAB5A PE=2 SV=1)

HSP 1 Score: 224.942 bits (572), Expect = 1.957e-72
Identity = 109/182 (59.89%), Postives = 137/182 (75.27%), Query Frame = 2
Query:   38 PLMNSRLGSHKLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLPASIGENVGENA 583
            P   +++   KLVLLGE+ VGKSSLVLRFV+GQF+E  EST+GAAF+TQTV     T+KFEIWDTAGQERY SLAPMYYRGA+AAIV+YDITN +SF  AK+W++EL+ +A    VI L GNK DL + R V   E + +A DN L+FME S K S+NVNE+F+ IAK+LP +  +N G N+
Sbjct:   12 PNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANS 193          
BLAST of Ras-related protein Rab-5A vs. UniProt/SwissProt
Match: sp|P20339|RAB5A_HUMAN (Ras-related protein Rab-5A OS=Homo sapiens OX=9606 GN=RAB5A PE=1 SV=2)

HSP 1 Score: 224.942 bits (572), Expect = 1.957e-72
Identity = 109/182 (59.89%), Postives = 137/182 (75.27%), Query Frame = 2
Query:   38 PLMNSRLGSHKLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLPASIGENVGENA 583
            P   +++   KLVLLGE+ VGKSSLVLRFV+GQF+E  EST+GAAF+TQTV     T+KFEIWDTAGQERY SLAPMYYRGA+AAIV+YDITN +SF  AK+W++EL+ +A    VI L GNK DL + R V   E + +A DN L+FME S K S+NVNE+F+ IAK+LP +  +N G N+
Sbjct:   12 PNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANS 193          
BLAST of Ras-related protein Rab-5A vs. UniProt/SwissProt
Match: sp|P18066|RAB5A_CANLF (Ras-related protein Rab-5A OS=Canis lupus familiaris OX=9615 GN=RAB5A PE=1 SV=1)

HSP 1 Score: 224.942 bits (572), Expect = 1.957e-72
Identity = 109/182 (59.89%), Postives = 137/182 (75.27%), Query Frame = 2
Query:   38 PLMNSRLGSHKLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLPASIGENVGENA 583
            P   +++   KLVLLGE+ VGKSSLVLRFV+GQF+E  EST+GAAF+TQTV     T+KFEIWDTAGQERY SLAPMYYRGA+AAIV+YDITN +SF  AK+W++EL+ +A    VI L GNK DL + R V   E + +A DN L+FME S K S+NVNE+F+ IAK+LP +  +N G N+
Sbjct:   12 PNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANS 193          
BLAST of Ras-related protein Rab-5A vs. UniProt/SwissProt
Match: sp|Q9CQD1|RAB5A_MOUSE (Ras-related protein Rab-5A OS=Mus musculus OX=10090 GN=Rab5a PE=1 SV=1)

HSP 1 Score: 224.942 bits (572), Expect = 2.000e-72
Identity = 109/182 (59.89%), Postives = 137/182 (75.27%), Query Frame = 2
Query:   38 PLMNSRLGSHKLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLPASIGENVGENA 583
            P   +++   KLVLLGE+ VGKSSLVLRFV+GQF+E  EST+GAAF+TQTV     T+KFEIWDTAGQERY SLAPMYYRGA+AAIV+YDITN +SF  AK+W++EL+ +A    VI L GNK DL + R V   E + +A DN L+FME S K S+NVNE+F+ IAK+LP +  +N G N+
Sbjct:   12 PNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANS 193          
BLAST of Ras-related protein Rab-5A vs. TrEMBL
Match: A0A0D8XNN7 (Ras family protein OS=Dictyocaulus viviparus OX=29172 GN=DICVIV_07771 PE=4 SV=1)

HSP 1 Score: 228.409 bits (581), Expect = 1.799e-71
Identity = 115/193 (59.59%), Postives = 142/193 (73.58%), Query Frame = 2
Query:   68 KLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLPASIGENVGENAETVDRNNIPVQDLNAHERGCS 646
            KLVLLGE+ VGKSSLVLRFV+GQF+E  EST+GAAF+TQTV     T+KFEIWDTAGQERY SLAPMYYRGA+AAIV+YDITN +SF+ AK+W++EL+ +A    VI L GNK D+ + R V   E + +A+DN L+F+E S K S+NVNEVF+ IAK+LP  IG   GE + TVD N    Q   A +  C 
Sbjct:   21 KLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDEATVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQESFQKAKTWVKELQKQASPNIVIALAGNKADMANRRTVEHDEAKAYAEDNALLFVETSAKTSMNVNEVFLSIAKKLP--IGPPTGEPSGTVDMN----QPQQAQKGNCC 207          
BLAST of Ras-related protein Rab-5A vs. TrEMBL
Match: A0A1W7REC2 (Ras-related protein Rab-5A-like protein OS=Agkistrodon contortrix contortrix OX=8713 PE=4 SV=1)

HSP 1 Score: 228.409 bits (581), Expect = 2.495e-71
Identity = 111/182 (60.99%), Postives = 137/182 (75.27%), Query Frame = 2
Query:   38 PLMNSRLGSHKLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLPASIGENVGENA 583
            P   +++   KLVLLGE+ VGKSSLVLRFV+GQF+E  EST+GAAF+TQTV     TIKFEIWDTAGQERY SLAPMYYRGA+AAIV+YDITN +SF  AK+W++EL+ +A    VI L GNK DL + R V   E + +A DN L+FME S K SVNVNE+F+ IAK+LP +  +N G N+
Sbjct:   12 PNAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTIKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALAGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSVNVNEIFMAIAKKLPKNEPQNTGANS 193          
BLAST of Ras-related protein Rab-5A vs. TrEMBL
Match: T1DJD0 (Ras-related protein Rab-5A-like protein OS=Crotalus horridus OX=35024 PE=2 SV=1)

HSP 1 Score: 228.409 bits (581), Expect = 2.495e-71
Identity = 111/182 (60.99%), Postives = 137/182 (75.27%), Query Frame = 2
Query:   38 PLMNSRLGSHKLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLPASIGENVGENA 583
            P   +++   KLVLLGE+ VGKSSLVLRFV+GQF+E  EST+GAAF+TQTV     TIKFEIWDTAGQERY SLAPMYYRGA+AAIV+YDITN +SF  AK+W++EL+ +A    VI L GNK DL + R V   E + +A DN L+FME S K SVNVNE+F+ IAK+LP +  +N G N+
Sbjct:   12 PNAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTIKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALAGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSVNVNEIFMAIAKKLPKNEPQNTGANS 193          
BLAST of Ras-related protein Rab-5A vs. TrEMBL
Match: J3S9C8 (Ras-related protein Rab-5A-like OS=Crotalus adamanteus OX=8729 PE=2 SV=1)

HSP 1 Score: 228.409 bits (581), Expect = 2.495e-71
Identity = 111/182 (60.99%), Postives = 137/182 (75.27%), Query Frame = 2
Query:   38 PLMNSRLGSHKLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLPASIGENVGENA 583
            P   +++   KLVLLGE+ VGKSSLVLRFV+GQF+E  EST+GAAF+TQTV     TIKFEIWDTAGQERY SLAPMYYRGA+AAIV+YDITN +SF  AK+W++EL+ +A    VI L GNK DL + R V   E + +A DN L+FME S K SVNVNE+F+ IAK+LP +  +N G N+
Sbjct:   12 PNAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTIKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALAGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSVNVNEIFMAIAKKLPKNEPQNTGANS 193          
BLAST of Ras-related protein Rab-5A vs. TrEMBL
Match: V9KPS0 (Ras-related protein Rab-5C OS=Callorhinchus milii OX=7868 GN=rab5c PE=2 SV=1)

HSP 1 Score: 228.024 bits (580), Expect = 2.782e-71
Identity = 113/204 (55.39%), Postives = 144/204 (70.59%), Query Frame = 2
Query:   38 PLMNSRLGSHKLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLPASIGENVGENAETVDRNNIPVQDLNAHERGCSC 649
            P   S++   KLVLLGE+ VGKSSLVLRFV+GQF+E  EST+GAAF+TQTV     T+KFEIWDTAGQERY SLAPMYYRGA+AAIV+YDITN+++F  AK+W++EL+ +A    VI L GNK DL + R V   E + +A DN L+FME S K ++NVNE+F+ IAK+LP +   N G  A       + +Q+ N H R   C
Sbjct:   13 PAAGSKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTETFTRAKNWVKELQRQASPNIVIALAGNKADLANKRAVEFQEAQSYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPLNAGGTAGR--SRGVDLQETNQHSRSQCC 214          
BLAST of Ras-related protein Rab-5A vs. Ensembl Cavefish
Match: rab5aa (ras-related protein Rab-5A [Source:NCBI gene;Acc:103027170])

HSP 1 Score: 222.631 bits (566), Expect = 1.609e-72
Identity = 108/182 (59.34%), Postives = 136/182 (74.73%), Query Frame = 2
Query:   38 PLMNSRLGSHKLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLPASIGENVGENA 583
            P   +++   KLVLLGE+ VGKSSLVLRFV+GQF+E  EST+GAAF+TQTV     T+KFEIWDTAGQERY SLAPMYYRGA+AAIV+YDITN +SF  AK+W++EL+ +A    VI L GNK DL + R V   + + +A DN L+FME S K S+NVNE+F+ IAK+LP S  +  G N+
Sbjct:   13 PNAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQDAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKRLPKSEPQAAGTNS 194          
BLAST of Ras-related protein Rab-5A vs. Ensembl Cavefish
Match: ENSAMXT00000046211.1 (ras-related protein Rab-5C [Source:NCBI gene;Acc:103035226])

HSP 1 Score: 221.09 bits (562), Expect = 6.417e-72
Identity = 104/171 (60.82%), Postives = 132/171 (77.19%), Query Frame = 2
Query:   38 PLMNSRLGSHKLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLP 550
            P   +++   KLVLLGE+ VGKSSLVLRFV+GQF+E  EST+GAAF+TQTV     T+KFEIWDTAGQERY SLAPMYYRGA+AAI++YDITN+D+F  AK+W++EL+ +A    VI L GNK DL + R V   E + +A DN L+FME S K ++NVNE+F+ IAK+LP
Sbjct:    8 PAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIIVYDITNTDTFTRAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLP 178          
BLAST of Ras-related protein Rab-5A vs. Ensembl Cavefish
Match: rab5ab (ras-related protein Rab-5A [Source:NCBI gene;Acc:103038585])

HSP 1 Score: 219.935 bits (559), Expect = 2.239e-71
Identity = 112/198 (56.57%), Postives = 141/198 (71.21%), Query Frame = 2
Query:   47 NSRLGSHKLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLP--------ASIGENVGEN-AETVDRNNIPV 613
            ++++   KLVLLGE+ VGKSSLVLRFV+GQF+E  EST+GAAF+TQTV     T+KFEIWDTAGQERY SLAPMYYRGA+AAIV+YDITN +SF  AK+W++EL+ +A    VI L GNK DL + R +   + + +A DN L+FME S K S+NVNE+F+ IAK+LP        AS G N G + AET      P 
Sbjct:   17 SNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALAGNKADLANKRALDFQDAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKSEPQPAGASTGRNRGVDLAETAQPAKGPC 214          
BLAST of Ras-related protein Rab-5A vs. Ensembl Cavefish
Match: rab5c (RAB5C, member RAS oncogene family [Source:NCBI gene;Acc:103045387])

HSP 1 Score: 218.394 bits (555), Expect = 8.245e-71
Identity = 104/167 (62.28%), Postives = 131/167 (78.44%), Query Frame = 2
Query:   50 SRLGSHKLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLP 550
            +++   KLVLLGE+ VGKSSLVLRFV+GQF+E  EST+GAAF+TQTV     T+KFEIWDTAGQERY SLAPMYYRGA+AAIV+YDITN+D+F  AK+W++EL+ +A    VI L GNK DL + R V   E + +A DN L+FME S K ++NVNE+F+ IAK+LP
Sbjct:   18 NKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFTRAKNWVKELQRQASPNIVIALAGNKADLANKRAVDFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLP 184          
BLAST of Ras-related protein Rab-5A vs. Ensembl Cavefish
Match: rab5b (ras-related protein Rab-5B-like [Source:NCBI gene;Acc:103034209])

HSP 1 Score: 214.927 bits (546), Expect = 1.429e-69
Identity = 105/203 (51.72%), Postives = 141/203 (69.46%), Query Frame = 2
Query:   41 LMNSRLGSHKLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLPASIGENVGENAETVDRNNIPVQDLNAHERGCSC 649
            L  +++   KLVLLG+  VGKSSLVLRFV+GQF+E  E+T+GAAF+ Q+V     T+KFEIWDTAGQERY SLAPMYYRGA+AAIV++DIT  ++FE AK+W++EL+ +A    VI L GNK DL D R V   E + +A+D GL+FME S K ++NVNE+F+ IAK++P +  +N    A       + +QD +A      C
Sbjct:   13 LPQTKICQFKLVLLGDMAVGKSSLVLRFVKGQFDEFQETTIGAAFLAQSVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVFDITKPETFERAKAWVKELQRQASPNIVIALAGNKADLADKRLVEYEEAQTYAEDTGLLFMETSAKTAMNVNELFLAIAKKMPKTDTQNATHAAR---YRGVNLQDPDAQSNRSCC 212          
BLAST of Ras-related protein Rab-5A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000009.1 (pep scaffold:Pmarinus_7.0:GL476426:408368:444599:1 gene:ENSPMAG00000000008.1 transcript:ENSPMAT00000000009.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 223.402 bits (568), Expect = 1.626e-73
Identity = 113/202 (55.94%), Postives = 141/202 (69.80%), Query Frame = 2
Query:   47 NSRLGSHKLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLPASIGENVGENAE-TVDRNNIPVQDLNAHERGCSC 649
             S++   KLVLLGE+ VGKSSLVLRFV+GQF+E  EST+GAAF+TQTV     T+KFEIWDTAGQERY SLAPMYYRGA+AAIV+YDITN D+F  AK+W++EL+ +A    VI L GNK DL   R V   E + +A DNGL+FME S K ++NVN++F+ IAK+LP S     G  A   V     P    ++H+R   C
Sbjct:   21 TSKILQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQDTFSRAKTWVKELQRQASPNIVIALAGNKADLASKRIVEFEEAQSYADDNGLLFMETSAKTAMNVNDIFLAIAKKLPRSEPPGTGTKAHGMVSLGPGP----DSHQRRTCC 218          
BLAST of Ras-related protein Rab-5A vs. Ensembl Sea Lamprey
Match: rab5c (RAB5C, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-031118-30])

HSP 1 Score: 223.016 bits (567), Expect = 1.835e-73
Identity = 111/199 (55.78%), Postives = 142/199 (71.36%), Query Frame = 2
Query:   50 SRLGSHKLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLPASIGENVGENAETVDRNNIPVQDLNAHERGCS 646
            +++   KLVLLGE+ VGKSSLVLRFV+GQF+E  EST+GAAF+TQTV     T+KFEIWDTAGQERY SLAPMYYRGA+AAIV+YDITN DSF  AK+W++EL+ +A    VI L GNK DL   R V   E + +A++NGL+FME S K ++NVNEVF+ IAK+LP +  +N G  +     N +P+   +     C 
Sbjct:   17 NKMCQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVSLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNLDSFARAKTWVKELQRQANPTIVIALSGNKADLASQRMVEFEEAQGYAEENGLLFMETSAKTAMNVNEVFLAIAKKLPKNEQQNPGGKS-----NVVPIDPTSQTSSSCC 210          
BLAST of Ras-related protein Rab-5A vs. Ensembl Sea Lamprey
Match: rab5c (RAB5C, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-031118-30])

HSP 1 Score: 221.09 bits (562), Expect = 9.291e-73
Identity = 105/167 (62.87%), Postives = 132/167 (79.04%), Query Frame = 2
Query:   50 SRLGSHKLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLP 550
            +++   KLVLLGE+ VGKSSLVLRFV+GQF+E  EST+GAAF+TQTV     T+KFEIWDTAGQERY SLAPMYYRGA+AAIV+YDITN DSF  AK+W++EL+ +A    VI L GNK DL + R V   E + +++DNGL+FME S K ++NVN+VF+ IAK+LP
Sbjct:   17 NKMCQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQDSFARAKNWVKELQRQANPNIVIALAGNKTDLANQRTVDFEEAQGYSEDNGLLFMETSAKTAMNVNDVFLAIAKKLP 183          
BLAST of Ras-related protein Rab-5A vs. Ensembl Sea Lamprey
Match: RAB31 (RAB31, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9771])

HSP 1 Score: 166.392 bits (420), Expect = 1.606e-51
Identity = 75/161 (46.58%), Postives = 112/161 (69.57%), Query Frame = 2
Query:   68 KLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLP 550
            K+ LLG+T VGKSS+V RFV+  F+  +  T+GA+FMT+T+    +  K+ IWDTAGQER+RSLAPMYYRG+ AA+++YDIT  +SF+  KSW+ EL+   P   ++ + GNK DL D R+VS  +   +A     +F+E S K ++N+ E+F  I++++P
Sbjct:    7 KVCLLGDTGVGKSSIVCRFVQDNFDPNINPTIGASFMTKTMPQGNEVHKYLIWDTAGQERFRSLAPMYYRGSAAAVIVYDITKEESFQMLKSWVRELRQHGPQDIIVAIAGNKCDLDDMREVSVQDARDYADSIDAIFIETSAKSAINICEIFARISERVP 167          
BLAST of Ras-related protein Rab-5A vs. Ensembl Sea Lamprey
Match: rab11ba (RAB11B, member RAS oncogene family, a [Source:ZFIN;Acc:ZDB-GENE-040426-2860])

HSP 1 Score: 154.451 bits (389), Expect = 1.193e-46
Identity = 75/166 (45.18%), Postives = 113/166 (68.07%), Query Frame = 2
Query:   71 LVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLPASIGEN 568
            +VL+G++ VGKS+L+ RF R +FN   +ST+G  F T+++   GKTIK +IWDTAGQERYR++   YYRGA  A+++YDI    ++EN + W++EL+  A S  VI+LVGNK DL+  R V+  E +  A+++GL F+E S  DS NV   FI I  ++  ++ ++
Sbjct:    1 VVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAYGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVTTDEAKAFAENHGLSFIETSALDSTNVESAFITILTEIYRTVSQH 166          
BLAST of Ras-related protein Rab-5A vs. Ensembl Yeast
Match: VPS21 (Endosomal Rab family GTPase; required for endocytic transport and sorting of vacuolar hydrolases; required for endosomal localization of the CORVET complex; required with YPT52 for MVB biogenesis and sorting; involved in autophagy and ionic stress tolerance; geranylgeranylation required for membrane association; protein abundance increases in response to DNA replication stress; mammalian Rab5 homolog; VPS21 has a paralog, YPT53, that arose from the whole genome duplication [Source:SGD;Acc:S000005615])

HSP 1 Score: 193.356 bits (490), Expect = 4.686e-62
Identity = 108/211 (51.18%), Postives = 137/211 (64.93%), Query Frame = 2
Query:   44 MNSRLGSHKLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKID-LQDS--RKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLPASIGENVGENAETVDRNNIPVQDLNAHERG------CSC 649
            MN+ + S KLVLLGE  VGKSS+VLRFV   F E  E T+GAAF+TQ V     T+KFEIWDTAGQER+ SLAPMYYR A+AA+V+YD+T   SF  A+ W++EL  +A    +I LVGNKID LQ+   RKV+  EGE+ A++ GL+F E S K   NVN+VF+ I +++P    E     +   + NN  V DLNA   G      CSC
Sbjct:    1 MNTSVTSIKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVTINEHTVKFEIWDTAGQERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELHEQASKDIIIALVGNKIDMLQEGGERKVAREEGEKLAEEKGLLFFETSAKTGENVNDVFLGIGEKIPLKTAEEQNSASNERESNNQRV-DLNAANDGTSANSACSC 210          
BLAST of Ras-related protein Rab-5A vs. Ensembl Yeast
Match: YPT52 (Endosomal Rab family GTPase; required for vacuolar protein sorting, endocytosis and multivesicular body (MVB) biogenesis and sorting; required for localization of the CORVET complex to endosomes; involved in autophagy and ionic stress tolerance; similar to Vps21p and Ypt53p; mammalian Rab5 homolog; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000001722])

HSP 1 Score: 167.548 bits (423), Expect = 1.211e-51
Identity = 89/189 (47.09%), Postives = 122/189 (64.55%), Query Frame = 2
Query:   68 KLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVM--------TMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVE-VIVLVGNKIDL--------------------QDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQL 547
            KLVLLG++ VGKSS+V RFV+  F+E+ EST+GAAF++Q++         T    IKFEIWDTAGQERY+SLAPMYYR A AA+V+YDIT  DS + A++W++ELK K    + VI L+GNK+DL                    Q  R +S  E +Q+A++ GL+F E+S K    V E+F +I ++L
Sbjct:    5 KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIYLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGEGVKEIFQDIGEKL 193          
BLAST of Ras-related protein Rab-5A vs. Ensembl Yeast
Match: YPT6 (Rab family GTPase; required for endosome-to-Golgii, intra-Golgi retrograde, and retrograde Golgi-to-ER transport; temporarily at the Golgi, dissociating into the cytosol on arrival of the late Golgi GTPase Ypt32p; Golgi-localized form is GTP bound, while cytosolic form is GDP-bound; required for delivery of Atg9p to the phagophore assembly site during autophagy under heat stress, with Ypt6p for starvation induced autophagy and for the CVT pathway; homolog of mammalian Rab6 [Source:SGD;Acc:S000004252])

HSP 1 Score: 156.762 bits (395), Expect = 1.181e-47
Identity = 88/208 (42.31%), Postives = 125/208 (60.10%), Query Frame = 2
Query:   56 LGSHKLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIV-LVGNKIDLQDSRKVSPVEGEQHAKDNGL-MFMEISVKDSVNVNEVFIEIAKQLPASIGENV----GENAETVDRNNIPVQDLNAHER----GCSC 649
            L  +K+V LGE  VGK+SL+ RF+   F++  ++T+G  F+++T+    KTI+ ++WDTAGQER+RSL P Y R +R AI++YDIT   SFE    WIE++K +     VI+ +VGNK DL D R++S  EGE+ AK  G  +FME S K   NV  +F +IAK LP            ENA + ++N   V D++  E      C C
Sbjct:    8 LTKYKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDDKTIRLQLWDTAGQERFRSLIPSYIRDSRVAIIVYDITKRKSFEYIDKWIEDVKNERGDENVILCIVGNKSDLSDERQISTEEGEKKAKLLGAKIFMETSTKAGYNVKALFKKIAKSLPEFQNSESTPLDSENANSANQNKPGVIDISTAEEQEQSACQC 215          
BLAST of Ras-related protein Rab-5A vs. Ensembl Yeast
Match: YPT53 (Stress-induced Rab family GTPase; required for vacuolar protein sorting and endocytosis; involved in ionic stress tolerance; similar to Vps21p and Ypt52p; functional homolog of Vps21p; mammalian Rab5 homolog; YPT53 has a paralog, VPS21, that arose from the whole genome duplication [Source:SGD;Acc:S000005037])

HSP 1 Score: 156.377 bits (394), Expect = 2.193e-47
Identity = 79/168 (47.02%), Postives = 110/168 (65.48%), Query Frame = 2
Query:   68 KLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDL------QDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLPA 553
            K+VLLGE+ VGKSS+VLRFV   F E  E T+GAAF+T+ +   GK IKFEIWDTAGQER+  LAPMYYR A+AA+V++D+TN  SF  A++W+EEL  K     VI LVGNK+DL       ++R +     +   +   L++ E S K   N+ ++F  + +++P 
Sbjct:   14 KVVLLGESAVGKSSIVLRFVSDDFKESKEPTIGAAFLTKRITRDGKVIKFEIWDTAGQERFAPLAPMYYRNAQAALVVFDVTNEGSFYKAQNWVEELHEKVGHDIVIALVGNKMDLLNNDDENENRAMKAPAVQNLCERENLLYFEASAKTGENIYQIFQTLGEKVPC 181          
BLAST of Ras-related protein Rab-5A vs. Ensembl Yeast
Match: YPT1 (Rab family GTPase; involved in the ER-to-Golgi step of the secretory pathway; complex formation with the Rab escort protein Mrs6p is required for prenylation of Ypt1p by type II protein geranylgeranyltransferase (Bet2p-Bet4p); binds to unspliced HAC1 mRNA; regulates the unfolded protein response (UPR) by promoting the decay of HAC1 RNA; localizes to the early Golgi, the transitional Golgi and ER membranes, pre-autophagosomal structures, and cytoplasmic vesicles [Source:SGD;Acc:S000001856])

HSP 1 Score: 148.288 bits (373), Expect = 1.641e-44
Identity = 76/196 (38.78%), Postives = 118/196 (60.20%), Query Frame = 2
Query:   68 KLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLPASIG-ENVGENAETV-DRNNIPVQDLNAHERGCSC 649
            KL+L+G + VGKS L+LRF    +     ST+G  F  +TV   GKT+K +IWDTAGQER+R++   YYRG+   I++YD+T+ +SF   K W++E+   A S  + +LVGNK DL+D R V     ++ A  N + F+E S  DS NV + F+ +A+Q+  S+  +N+ E  +   D+ N+ ++  +    G  C
Sbjct:   10 KLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMSQQNLNETTQKKEDKGNVNLKGQSLTNTGGGC 205          
BLAST of Ras-related protein Rab-5A vs. Ensembl Nematostella
Match: EDO49482 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG79])

HSP 1 Score: 220.32 bits (560), Expect = 4.958e-72
Identity = 109/200 (54.50%), Postives = 144/200 (72.00%), Query Frame = 2
Query:   53 RLGSHKLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLPASIGENVGENAETVDRNN-IPVQDLNAHERGCSC 649
            ++   KLVLLGE+ VGKSSLVLRFV+GQF+E  EST+GAAF+TQTV     T+KFEIWDTAGQERY SLAPMYYRGA+AAIV+YDITN D+F  AK+W++EL+ +A    VI L GNK DL   R V   + + +A+DNGL+FME S K ++NVN++F+ IAK+LP S  +N     ++  RN  + +++ +    G  C
Sbjct:   18 KICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQDTFARAKTWVKELQRQASPNIVIALSGNKADLASKRMVEYEDAQSYAEDNGLLFMETSAKTAMNVNDIFLAIAKKLPKS--DNTPGGQQSSQRNQGVNLRETSPQHSGGCC 215          
BLAST of Ras-related protein Rab-5A vs. Ensembl Nematostella
Match: EDO29880 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2D5])

HSP 1 Score: 157.918 bits (398), Expect = 8.621e-48
Identity = 82/203 (40.39%), Postives = 128/203 (63.05%), Query Frame = 2
Query:   56 LGSHKLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLPASIGENV----GENAE---TVDRNNIPVQDLNAHERGC 643
            L   KLV LGE  VGK+SL+ RF+   F+   ++T+G  F+++T+    +T++ ++WDTAGQER+RSL P Y R +  A+V+YDITN +SF+    WI++++ +  +  +I+LVGNK DL D R+V+  EGE+ AK+  +MF+E S K   NV +++  +A +LPA  G+++    GE  +    V   + P Q  NA   GC
Sbjct:    9 LRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDITNYNSFQQTSKWIDDVRTERGNDVIIMLVGNKTDLSDKRQVTAEEGERKAKELNVMFIETSAKAGYNVKQMYRNLALELPA--GKDMMTEWGEYEDDLIKVTLQHTPQQLDNAGSCGC 209          
BLAST of Ras-related protein Rab-5A vs. Ensembl Nematostella
Match: EDO33171 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST02])

HSP 1 Score: 155.606 bits (392), Expect = 1.111e-46
Identity = 85/206 (41.26%), Postives = 123/206 (59.71%), Query Frame = 2
Query:   68 KLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQL------------PASIGENVGENAETVDRNNIPVQDLNAHERGCSC 649
            K+VL+G++ VGKS+L+ RF R +FN   +ST+G  F T+++   GKTIK +IWDTAGQERYR++   YYRGA  A+++YDI    ++EN + W++EL+  A S  VI+LVGNK DL+  R V   E +  A+ NGL F+E S  DS NV   F  I  ++            P+S G +   N +T+  +  P  D +  +R   C
Sbjct:   13 KVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEAKAFAEKNGLSFIETSALDSTNVEVAFHNILTEIYHIVSQKQIHDSPSSDGSHPSNNVQTI--HVAPTTDDDRKKRVQCC 216          
BLAST of Ras-related protein Rab-5A vs. Ensembl Nematostella
Match: EDO36687 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHU3])

HSP 1 Score: 153.68 bits (387), Expect = 4.397e-46
Identity = 74/168 (44.05%), Postives = 109/168 (64.88%), Query Frame = 2
Query:   68 KLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLPASIGENV 571
            K +++G+T VGKS L+L+F   +F  + + T+G  F  + +   GK IK +IWDTAGQE +RS+   YYRGA  A+++YDIT  D+F +  +W+E+ +  + S  VI+L+GNK DL+  R V   EGE  A+++GL+FME S K + NV E FI  AK++   I E V
Sbjct:    8 KYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSSSNMVIMLIGNKSDLEARRDVKKEEGEAFAREHGLIFMETSAKTAANVEEAFINTAKEIYQKIQEGV 175          
BLAST of Ras-related protein Rab-5A vs. Ensembl Nematostella
Match: EDO33074 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST94])

HSP 1 Score: 151.754 bits (382), Expect = 3.688e-45
Identity = 77/206 (37.38%), Postives = 129/206 (62.62%), Query Frame = 2
Query:   65 HKLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVF---------IEIAKQLPASIGENV--GENAETVDRNNIPVQDLNAHERGCSC 649
            +K+VL+G++ VGKSSL+ RF R +F+   +ST+G  F T+++   GK IK ++WDTAGQERYR++   YYRGA  A+++YD+T   +F++ + W+ E++  A    V++LVGNK DL+  R V+  + +++  ++GL F+E S  D+ NV E F         +++AK      G++   G+ A +  +N++   DLN   +G +C
Sbjct:   13 YKIVLIGDSGVGKSSLLSRFTRNEFDIESKSTIGVEFATRSIQVEGKIIKAQVWDTAGQERYRAITSAYYRGAVGAVLVYDLTKQKTFQDVERWLLEVREHADPTIVVMLVGNKCDLKHLRAVASDDAKKYGDEHGLAFIEASALDATNVEEAFQQTITKLHHVQLAKMKKELDGKDTREGQTAASKQQNSV---DLNKPSQGKNC 215          
BLAST of Ras-related protein Rab-5A vs. Ensembl Medaka
Match: rab5aa (ras-related protein Rab-5A [Source:NCBI gene;Acc:101159835])

HSP 1 Score: 220.705 bits (561), Expect = 9.022e-72
Identity = 106/173 (61.27%), Postives = 132/173 (76.30%), Query Frame = 2
Query:   38 PLMNSRLGSHKLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLPAS 556
            P   +++   KLVLLGE+ VGKSSLVLRFV+GQF+E  EST+GAAF+TQTV     T+KFEIWDTAGQERY SLAPMYYRGA+AAIV+YDITN +SF  AK+W++EL+ +A    VI L GNK DL + R V   + + +A DN L+FME S K S+NVNE+F+ IAK+LP S
Sbjct:   13 PNAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALAGNKADLANKRAVEFQDAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKRLPKS 185          
BLAST of Ras-related protein Rab-5A vs. Ensembl Medaka
Match: rab5ab (ras-related protein Rab-5A-like [Source:NCBI gene;Acc:101157247])

HSP 1 Score: 218.009 bits (554), Expect = 1.189e-70
Identity = 104/171 (60.82%), Postives = 131/171 (76.61%), Query Frame = 2
Query:   38 PLMNSRLGSHKLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLP 550
            P   +++   KLVLLGE+ VGKSSLVLRFV+GQF+E  EST+GAAF+TQTV     T+KFEIWDTAGQERY SLAPMYYRGA+AAIV+YDITN +SF  AK+W++EL+ +A    VI L GNK DL + R +   + + +A DN L+FME S K S+NVNE+F+ IAK+LP
Sbjct:   13 PNAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFVRAKNWVKELQRQASPNIVIALAGNKADLANKRALDFQDAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLP 183          
BLAST of Ras-related protein Rab-5A vs. Ensembl Medaka
Match: rab5c (RAB5C, member RAS oncogene family [Source:NCBI gene;Acc:101162840])

HSP 1 Score: 217.238 bits (552), Expect = 2.002e-70
Identity = 103/168 (61.31%), Postives = 132/168 (78.57%), Query Frame = 2
Query:   47 NSRLGSHKLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLP 550
            ++++   KLVLLGE+ VGKSSLVLRFV+GQF+E  EST+GAAF+TQTV     T+KFEIWDTAGQERY SLAPMYYRGA+AAIV++DITN+D+F  AK+W++EL+ +A    VI L GNK DL + R V   E + +A DN L+FME S K ++NVNE+F+ IAK+LP
Sbjct:   16 SNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVFDITNTDTFTRAKNWVKELQRQASPNIVIALAGNKADLTNKRNVDFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLP 183          
BLAST of Ras-related protein Rab-5A vs. Ensembl Medaka
Match: rab22a (RAB22A, member RAS oncogene family [Source:NCBI gene;Acc:101174498])

HSP 1 Score: 179.104 bits (453), Expect = 9.620e-56
Identity = 80/161 (49.69%), Postives = 118/161 (73.29%), Query Frame = 2
Query:   68 KLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLP 550
            K+ LLG+T VGK+S+V RFV   F+  +  T+GA+FMT+TV    +  KF IWDTAGQER+R+LAPMYYRG+ AA+++YDIT  DSF+  K+W++EL+   P   V+ + GNK DL D+R+VS  + + +A+    +F+E S K+++N+NEVF EI+K++P
Sbjct:    7 KVCLLGDTGVGKTSIVWRFVEDSFDPNINPTIGASFMTKTVQYQNELHKFLIWDTAGQERFRALAPMYYRGSAAAVIVYDITKEDSFQTLKNWVKELRQHGPPNIVVAIAGNKCDLSDAREVSEKDAKDYAESIHAIFVETSAKNAININEVFTEISKRIP 167          
BLAST of Ras-related protein Rab-5A vs. Ensembl Medaka
Match: RAB31 (RAB31, member RAS oncogene family [Source:NCBI gene;Acc:101173252])

HSP 1 Score: 169.474 bits (428), Expect = 4.756e-52
Identity = 80/161 (49.69%), Postives = 114/161 (70.81%), Query Frame = 2
Query:   68 KLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLP 550
            K+ LLG+T VGKSS+V RFV+  F+  +  T+GA+F+T+TV    +  KF IWDTAGQER+ SLAPMYYRG+ AA+++YDIT  DSF+  K W++ELK   P   V+ + GNK DL D R+V   E ++ A+    +F+E S +++VNV E+F +I+KQ+P
Sbjct:    8 KVCLLGDTGVGKSSIVCRFVQDHFDHNISPTIGASFLTKTVPCGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKLDSFQTLKKWVKELKEHGPEDIVVAIAGNKNDLGDIREVPMKEAKEFAESIAAIFIETSARNAVNVEELFQKISKQIP 168          
BLAST of Ras-related protein Rab-5A vs. Planmine SMEST
Match: SMESG000065500.1 (SMESG000065500.1)

HSP 1 Score: 416.001 bits (1068), Expect = 3.675e-149
Identity = 201/202 (99.50%), Postives = 201/202 (99.50%), Query Frame = 2
Query:   44 MNSRLGSHKLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLPASIGENVGENAETVDRNNIPVQDLNAHERGCSC 649
            MNSRLGSHKLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVS VEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLPASIGENVGENAETVDRNNIPVQDLNAHERGCSC
Sbjct:    1 MNSRLGSHKLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSSVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLPASIGENVGENAETVDRNNIPVQDLNAHERGCSC 202          
BLAST of Ras-related protein Rab-5A vs. Planmine SMEST
Match: SMESG000064914.1 (SMESG000064914.1)

HSP 1 Score: 227.639 bits (579), Expect = 3.993e-75
Identity = 111/177 (62.71%), Postives = 136/177 (76.84%), Query Frame = 2
Query:   44 MNSRLGSHKLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLPASIGENVG 574
            M +R    KLVLLGE+ VGKSSLV+RFV+GQF+E  ESTVGAAF+TQTV+    T+KFEIWDTAGQERY SLAPMYYRGA+AAIV+YDIT+ DSF  AK+WI+EL  KA SV+VI L GNK DL   R+VS  +G  +A++NGL+FME S K S NVNE+F+EI + L  ++  N  
Sbjct:    1 MQNRQVQFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIGEILMNNLANNCA 177          
BLAST of Ras-related protein Rab-5A vs. Planmine SMEST
Match: SMESG000057525.1 (SMESG000057525.1)

HSP 1 Score: 197.978 bits (502), Expect = 3.170e-63
Identity = 97/160 (60.62%), Postives = 122/160 (76.25%), Query Frame = 2
Query:   68 KLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQL 547
            K+VLLGET VGKSSL LRFV+  FNE+ E T+GAAF+++ V+     IK EIWDTAGQERYRSLAPMYYRGA  A+VMYDITN +SF  AK WI+ELK +A +V VI LVGNKIDL   R+V+  E + +A++  L+FME S K ++NV EVF E++ +L
Sbjct:    7 KVVLLGETSVGKSSLSLRFVKDYFNEVQEITIGAAFLSKIVIIEDVKIKLEIWDTAGQERYRSLAPMYYRGAHGALVMYDITNLESFHRAKLWIQELKERAATVAVIALVGNKIDLSHGREVNETEAKLYAEEQNLIFMETSSKTNLNVQEVFTELSCEL 166          
BLAST of Ras-related protein Rab-5A vs. Planmine SMEST
Match: SMESG000057525.1 (SMESG000057525.1)

HSP 1 Score: 197.978 bits (502), Expect = 3.238e-63
Identity = 97/160 (60.62%), Postives = 122/160 (76.25%), Query Frame = 2
Query:   68 KLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQL 547
            K+VLLGET VGKSSL LRFV+  FNE+ E T+GAAF+++ V+     IK EIWDTAGQERYRSLAPMYYRGA  A+VMYDITN +SF  AK WI+ELK +A +V VI LVGNKIDL   R+V+  E + +A++  L+FME S K ++NV EVF E++ +L
Sbjct:    8 KVVLLGETSVGKSSLSLRFVKDYFNEVQEITIGAAFLSKIVIIEDVKIKLEIWDTAGQERYRSLAPMYYRGAHGALVMYDITNLESFHRAKLWIQELKERAATVAVIALVGNKIDLSHGREVNETEAKLYAEEQNLIFMETSSKTNLNVQEVFTELSCEL 167          
BLAST of Ras-related protein Rab-5A vs. Planmine SMEST
Match: SMESG000078456.1 (SMESG000078456.1)

HSP 1 Score: 179.489 bits (454), Expect = 5.943e-56
Identity = 83/163 (50.92%), Postives = 114/163 (69.94%), Query Frame = 2
Query:   68 KLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLPAS 556
            K+VLLG++ VGK+S+ L  V+ QFNE  E+TVGA ++ +TV       KF+IWDTAGQERY+SL PMYYRGA AAI++YDITN  SF  A +WI EL     +V+ I+LVGNK DL + R +     ++ A +N L+F+E S K S+N+ E+FI +A++ P S
Sbjct:    9 KVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPKS 171          
The following BLAST results are available for this feature:
BLAST of Ras-related protein Rab-5A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RAB5A4.075e-7359.89RAB5A, member RAS oncogene family [Source:HGNC Sym... [more]
RAB5C4.322e-7254.85RAB5C, member RAS oncogene family [Source:HGNC Sym... [more]
RAB5C4.322e-7254.85RAB5C, member RAS oncogene family [Source:HGNC Sym... [more]
RAB5B5.552e-7260.00RAB5B, member RAS oncogene family [Source:HGNC Sym... [more]
RAB5B5.552e-7260.00RAB5B, member RAS oncogene family [Source:HGNC Sym... [more]
back to top
BLAST of Ras-related protein Rab-5A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab-51.434e-7457.35RAB family [Source:UniProtKB/TrEMBL;Acc:P91857][more]
rab-6.25.758e-5141.41Ras-related protein Rab-6.2 [Source:UniProtKB/Swi... [more]
rab-6.16.415e-5140.69Ras-related protein Rab-6.1 [Source:UniProtKB/Swi... [more]
unc-1081.760e-4645.24pep chromosome:WBcel235:I:3824947:3826514:1 gene:W... [more]
unc-1083.086e-4645.24pep chromosome:WBcel235:I:3822883:3826514:1 gene:W... [more]
back to top
BLAST of Ras-related protein Rab-5A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rab51.171e-7062.28gene:FBgn0014010 transcript:FBtr0330670[more]
Rab51.171e-7062.28gene:FBgn0014010 transcript:FBtr0077796[more]
Rab51.171e-7062.28gene:FBgn0014010 transcript:FBtr0077793[more]
Rab51.171e-7062.28gene:FBgn0014010 transcript:FBtr0077797[more]
Rab51.171e-7062.28gene:FBgn0014010 transcript:FBtr0077795[more]
back to top
BLAST of Ras-related protein Rab-5A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab5aa1.156e-7159.55RAB5A, member RAS oncogene family, a [Source:ZFIN;... [more]
rab5aa1.156e-7159.55RAB5A, member RAS oncogene family, a [Source:ZFIN;... [more]
rab5c1.694e-7061.27RAB5C, member RAS oncogene family [Source:ZFIN;Acc... [more]
rab5c1.694e-7061.27RAB5C, member RAS oncogene family [Source:ZFIN;Acc... [more]
rab5ab2.652e-7057.46RAB5A, member RAS oncogene family, b [Source:ZFIN;... [more]
back to top
BLAST of Ras-related protein Rab-5A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab5a4.464e-7260.22RAB5A, member RAS oncogene family [Source:NCBI gen... [more]
rab5b7.834e-7059.20RAB5B, member RAS oncogene family [Source:NCBI gen... [more]
rab5d3.034e-6752.24RAB5D, member RAS oncogene family [Source:NCBI gen... [more]
ncapd29.585e-5245.93non-SMC condensin I complex subunit D2 [Source:Xen... [more]
rab412.222e-5041.50RAB41, member RAS oncogene family [Source:NCBI gen... [more]
back to top
BLAST of Ras-related protein Rab-5A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rab5a2.859e-7359.89RAB5A, member RAS oncogene family [Source:MGI Symb... [more]
Rab5b3.812e-7260.00RAB5B, member RAS oncogene family [Source:MGI Symb... [more]
Rab5c3.980e-7254.63RAB5C, member RAS oncogene family [Source:MGI Symb... [more]
Rab5c1.630e-6851.12RAB5C, member RAS oncogene family [Source:MGI Symb... [more]
Rab22a3.473e-5347.85RAB22A, member RAS oncogene family [Source:MGI Sym... [more]
back to top
BLAST of Ras-related protein Rab-5A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q0IIG7|RAB5A_BOVIN1.853e-7259.89Ras-related protein Rab-5A OS=Bos taurus OX=9913 G... [more]
sp|P61271|RAB5A_MACFA1.957e-7259.89Ras-related protein Rab-5A OS=Macaca fascicularis ... [more]
sp|P20339|RAB5A_HUMAN1.957e-7259.89Ras-related protein Rab-5A OS=Homo sapiens OX=9606... [more]
sp|P18066|RAB5A_CANLF1.957e-7259.89Ras-related protein Rab-5A OS=Canis lupus familiar... [more]
sp|Q9CQD1|RAB5A_MOUSE2.000e-7259.89Ras-related protein Rab-5A OS=Mus musculus OX=1009... [more]
back to top
BLAST of Ras-related protein Rab-5A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0D8XNN71.799e-7159.59Ras family protein OS=Dictyocaulus viviparus OX=29... [more]
A0A1W7REC22.495e-7160.99Ras-related protein Rab-5A-like protein OS=Agkistr... [more]
T1DJD02.495e-7160.99Ras-related protein Rab-5A-like protein OS=Crotalu... [more]
J3S9C82.495e-7160.99Ras-related protein Rab-5A-like OS=Crotalus adaman... [more]
V9KPS02.782e-7155.39Ras-related protein Rab-5C OS=Callorhinchus milii ... [more]
back to top
BLAST of Ras-related protein Rab-5A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab5aa1.609e-7259.34ras-related protein Rab-5A [Source:NCBI gene;Acc:1... [more]
ENSAMXT00000046211.16.417e-7260.82ras-related protein Rab-5C [Source:NCBI gene;Acc:1... [more]
rab5ab2.239e-7156.57ras-related protein Rab-5A [Source:NCBI gene;Acc:1... [more]
rab5c8.245e-7162.28RAB5C, member RAS oncogene family [Source:NCBI gen... [more]
rab5b1.429e-6951.72ras-related protein Rab-5B-like [Source:NCBI gene;... [more]
back to top
BLAST of Ras-related protein Rab-5A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000009.11.626e-7355.94pep scaffold:Pmarinus_7.0:GL476426:408368:444599:1... [more]
rab5c1.835e-7355.78RAB5C, member RAS oncogene family [Source:ZFIN;Acc... [more]
rab5c9.291e-7362.87RAB5C, member RAS oncogene family [Source:ZFIN;Acc... [more]
RAB311.606e-5146.58RAB31, member RAS oncogene family [Source:HGNC Sym... [more]
rab11ba1.193e-4645.18RAB11B, member RAS oncogene family, a [Source:ZFIN... [more]
back to top
BLAST of Ras-related protein Rab-5A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
VPS214.686e-6251.18Endosomal Rab family GTPase; required for endocyti... [more]
YPT521.211e-5147.09Endosomal Rab family GTPase; required for vacuolar... [more]
YPT61.181e-4742.31Rab family GTPase; required for endosome-to-Golgii... [more]
YPT532.193e-4747.02Stress-induced Rab family GTPase; required for vac... [more]
YPT11.641e-4438.78Rab family GTPase; involved in the ER-to-Golgi ste... [more]
back to top
BLAST of Ras-related protein Rab-5A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO494824.958e-7254.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO298808.621e-4840.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO331711.111e-4641.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO366874.397e-4644.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO330743.688e-4537.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ras-related protein Rab-5A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab5aa9.022e-7261.27ras-related protein Rab-5A [Source:NCBI gene;Acc:1... [more]
rab5ab1.189e-7060.82ras-related protein Rab-5A-like [Source:NCBI gene;... [more]
rab5c2.002e-7061.31RAB5C, member RAS oncogene family [Source:NCBI gen... [more]
rab22a9.620e-5649.69RAB22A, member RAS oncogene family [Source:NCBI ge... [more]
RAB314.756e-5249.69RAB31, member RAS oncogene family [Source:NCBI gen... [more]
back to top
BLAST of Ras-related protein Rab-5A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000065500.13.675e-14999.50SMESG000065500.1[more]
SMESG000064914.13.993e-7562.71SMESG000064914.1[more]
SMESG000057525.13.170e-6360.63SMESG000057525.1[more]
SMESG000057525.13.238e-6360.63SMESG000057525.1[more]
SMESG000078456.15.943e-5650.92SMESG000078456.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031780 ID=SMED30031780|Name=Ras-related protein Rab-5A|organism=Schmidtea mediterranea sexual|type=transcript|length=854bp
AATCTATATAAATCTTATATGTTACTAAATTTGTACCCCGTTAATGAATT
CAAGATTAGGAAGTCATAAATTAGTATTACTTGGTGAAACGTTTGTTGGA
AAATCCAGTCTAGTATTAAGGTTTGTTCGAGGTCAGTTTAATGAGATTTT
GGAAAGTACTGTTGGAGCTGCTTTCATGACTCAAACCGTTATGACAATGG
GTAAAACAATTAAATTTGAAATCTGGGATACTGCCGGCCAGGAAAGATAT
AGAAGCTTAGCCCCAATGTATTATAGAGGTGCTCGTGCTGCAATAGTTAT
GTATGATATCACAAATAGTGATTCGTTTGAAAATGCCAAATCATGGATCG
AAGAATTGAAAATAAAAGCACCCTCAGTGGAAGTAATTGTTTTAGTAGGG
AATAAAATCGATCTTCAAGATTCCCGAAAGGTTTCGCCTGTGGAAGGAGA
ACAACACGCCAAAGATAACGGTTTAATGTTCATGGAAATCTCCGTAAAAG
ATTCTGTCAACGTGAATGAGGTTTTTATCGAAATCGCTAAACAATTGCCA
GCGAGTATTGGAGAGAATGTGGGAGAAAATGCAGAAACTGTTGATAGAAA
TAACATTCCAGTCCAAGATCTAAACGCTCACGAAAGAGGATGTTCATGTT
GAGGATCATTTCGGTGGTCGCATATTATTATTATATATTATTTTACACTT
TGATTCATTATTTTTTACGTTTTTTCAATTTTCGATTTTTCATTTATAAA
TATATTAAGGTGCTTTTCATGATTGCAACTGATTTTTTATTGATATTTTG
GTAGATTTTATCTGTTTTAATATGAAAGATTCAATATGACTTATGATTTA
ATCG
back to top

protein sequence of SMED30031780-orf-1

>SMED30031780-orf-1 ID=SMED30031780-orf-1|Name=SMED30031780-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=203bp
MNSRLGSHKLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVM
TMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKS
WIEELKIKAPSVEVIVLVGNKIDLQDSRKVSPVEGEQHAKDNGLMFMEIS
VKDSVNVNEVFIEIAKQLPASIGENVGENAETVDRNNIPVQDLNAHERGC
SC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR005225Small_GTP-bd_dom
IPR001806Small_GTPase
IPR027417P-loop_NTPase
Vocabulary: molecular function
TermDefinition
GO:0005525GTP binding
GO:0019003GDP binding
GO:0000166nucleotide binding
GO:0003924GTPase activity
GO:0019001guanyl nucleotide binding
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0007264small GTPase mediated signal transduction
GO:0030100regulation of endocytosis
GO:0036465synaptic vesicle recycling
GO:0039694viral RNA genome replication
GO:0045022early endosome to late endosome transport
GO:0045921positive regulation of exocytosis
GO:0051036regulation of endosome size
GO:0051489regulation of filopodium assembly
GO:2000286receptor internalization involved in canonical Wnt signaling pathway
GO:2000300regulation of synaptic vesicle exocytosis
GO:0006810transport
GO:0006897endocytosis
GO:0006909phagocytosis
GO:0015031protein transport
Vocabulary: cellular component
TermDefinition
GO:0030139endocytic vesicle
GO:0030424axon
GO:0030425dendrite
GO:0030670phagocytic vesicle membrane
GO:0031410cytoplasmic vesicle
GO:0031901early endosome membrane
GO:0036477somatodendritic compartment
GO:0042470melanosome
GO:0042995cell projection
GO:0043025neuronal cell body
GO:0043195terminal bouton
GO:0043679axon terminus
GO:0045121membrane raft
GO:0045335phagocytic vesicle
GO:0070062extracellular exosome
GO:0098559cytoplasmic side of early endosome membrane
GO:0001726ruffle
GO:0005768endosome
GO:0005769early endosome
GO:0005829cytosol
GO:0005886plasma membrane
GO:0008021synaptic vesicle
GO:0010008endosome membrane
GO:0015629actin cytoskeleton
GO:0016020membrane
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00449RASTRNSFRMNGcoord: 49..71
score: 50.77
coord: 146..168
score: 35.0
coord: 31..47
score: 27.76
coord: 8..29
score: 45.37
coord: 111..124
score: 50.71
NoneNo IPR availableSMARTSM00174rho_sub_3coord: 10..171
e-value: 1.9E-12
score: 39.4
NoneNo IPR availableSMARTSM00176ran_sub_2coord: 13..196
e-value: 2.6E-8
score: 43.6
NoneNo IPR availableSMARTSM00175rab_sub_5coord: 8..171
e-value: 2.7E-75
score: 266.1
NoneNo IPR availableSMARTSM00173ras_sub_4coord: 5..171
e-value: 2.2E-27
score: 107.0
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 6..202
e-value: 3.6E-60
score: 204.7
NoneNo IPR availablePANTHERPTHR24073FAMILY NOT NAMEDcoord: 7..183
NoneNo IPR availablePANTHERPTHR24073:SF366RAS-RELATED PROTEIN RAB-5Ccoord: 7..183
NoneNo IPR availablePROSITEPS51419RABcoord: 1..202
score: 31.861
NoneNo IPR availableCDDcd01860Rab5_relatedcoord: 9..169
e-value: 6.70274E-100
score: 284.059
IPR005225Small GTP-binding protein domainTIGRFAMTIGR00231TIGR00231coord: 9..162
e-value: 2.3E-30
score: 103.5
IPR001806Small GTPasePFAMPF00071Rascoord: 9..168
e-value: 6.1E-59
score: 198.2
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 8..172