Peptidoglycan-recognition protein

Overview
NamePeptidoglycan-recognition protein
Smed IDSMED30031777
Length (bp)2671
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Peptidoglycan-recognition protein (SMED30031777) t-SNE clustered cells

Violin plots show distribution of expression levels for Peptidoglycan-recognition protein (SMED30031777) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Peptidoglycan-recognition protein (SMED30031777) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Peptidoglycan-recognition protein (SMED30031777) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031777

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30031777SMESG000020172.1 dd_Smed_v4_13624_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Peptidoglycan-recognition protein vs. Ensembl Human
Match: PGLYRP1 (peptidoglycan recognition protein 1 [Source:HGNC Symbol;Acc:HGNC:8904])

HSP 1 Score: 84.3445 bits (207), Expect = 6.740e-18
Identity = 45/166 (27.11%), Postives = 83/166 (50.00%), Query Frame = 1
Query: 1411 IISRKQWYAKKSKGIEDEFPNFPVPFVIITDTERPFCNCYTKEACDFQMRMIQDILTPFLH---IPYNFIVTGNGLVYQGKGWIYKNQANTDLYNDKSLSIAFCGRYKNKEPDVVSLNSVKMLINLAIENKKVARNYTIYLLKDISLLNFPSDGLSSVIELWPRYR 1899
            I+ R +W A  S+  +    + P+ +V+++ T    CN  T  +C  Q R +Q      L    + YNF++  +GLVY+G+GW +    +  L+N  S+ I+F G Y ++ P   ++ + + L+   +    +  NY +   +D+     P + L  +I+ WP YR
Sbjct:   33 IVPRNEWKALASECAQHL--SLPLRYVVVSHTAGSSCN--TPASCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHSGHLWNPMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQNWPHYR 194          
BLAST of Peptidoglycan-recognition protein vs. Ensembl Human
Match: PGLYRP3 (peptidoglycan recognition protein 3 [Source:HGNC Symbol;Acc:HGNC:30014])

HSP 1 Score: 76.6406 bits (187), Expect = 2.745e-14
Identity = 55/179 (30.73%), Postives = 84/179 (46.93%), Query Frame = 1
Query: 1384 NPDEPKKL--TIISRKQWYAKKSKGIEDEFP--NFPVPFVIITDTERPFCNCYTKEACDFQMRMIQDILTP---FLHIPYNFIVTGNGLVYQGKGWIYKNQANTDLYNDKSLSIAFCGRYKNKEPDVVSLNSVKMLINLAIENKKVARNYTIYLLKDISLLNFPSDGLSSVIELWPRYR 1899
            +P  P+K+   II R  W A+     E   P  N P  +VII  T    C   T   C   +R IQ        F  I Y+F+V  +G VY+G GW +   ++T  +ND +L IAF G +  K P+  +L + + LI  A+    +  NY +    D+  +  P   L ++I  WP ++
Sbjct:  170 HPVMPRKVCPNIIKRSAWEAR-----ETHCPKMNLPAKYVIIIHTAGTSCTVSTD--CQTVVRNIQSFHMDTRNFCDIGYHFLVGQDGGVYEGVGW-HIQGSHTYGFNDIALGIAFIGYFVEKPPNAAALEAAQDLIQCAVVEGYLTPNYLLMGHSDVVNILSPGQALYNIISTWPHFK 340          

HSP 2 Score: 56.6102 bits (135), Expect = 9.787e-8
Identity = 46/143 (32.17%), Postives = 70/143 (48.95%), Query Frame = 1
Query: 1408 TIISRKQWYAKKSKGIEDEFPNFPVPFVIITDTERPFCNCYTKEACDFQMRMIQD---ILTPFLHIPYNFIVTGNGLVYQGKGWIYKNQANTDLYNDKSLSIAFCGRYKNKEPDVVSLNSVKMLINLAIENKKVARNYTIYLL 1827
            TI+SRK+W A+            PV + IITD + P   C  +  C   +R +Q        +  + YNF+V  +G VY+G GW  +   +T  YN+ SL IAF G      P   +L++ + LI+ AI+   ++  Y   LL
Sbjct:   22 TIVSRKEWGARPLA--CRALLTLPVAY-IITD-QLPGMQCQQQSVCSQMLRGLQSHSVYTIGWCDVAYNFLVGDDGRVYEGVGWNIQG-LHTQGYNNISLGIAFFGNKIGSSPSPAALSAAEGLISYAIQKGHLSPRYIQPLL 159          
BLAST of Peptidoglycan-recognition protein vs. Ensembl Human
Match: PGLYRP4 (peptidoglycan recognition protein 4 [Source:HGNC Symbol;Acc:HGNC:30015])

HSP 1 Score: 69.707 bits (169), Expect = 6.342e-12
Identity = 46/168 (27.38%), Postives = 75/168 (44.64%), Query Frame = 1
Query: 1411 IISRKQWYAKKSKGIEDEFP--NFPVPFVIITDTERPFCNCYTKEACDFQMRMIQDILTPFLH---IPYNFIVTGNGLVYQGKGWIYKNQANTDLYNDKSLSIAFCGRYKNKEPDVVSLNSVKMLINLAIENKKVARNYTIYLLKDISLLNFPSDGLSSVIELWPRYR 1899
            ++ R  W A+     E   P    P  + II  T    CN    + C   +R IQ      L    I YNF+V  +G +Y+G GW  +  ++T  Y+D +L I F G +    P+  +L + + LI  A+    +  NY +    D++    P   L ++I  WP ++
Sbjct:  209 VVPRSVWGAR-----ETHCPRMTLPAKYGIIIHTAGRTCN--ISDECRLLVRDIQSFYIDRLKSCDIGYNFLVGQDGAIYEGVGWNVQG-SSTPGYDDIALGITFMGTFTGIPPNAAALEAAQDLIQCAMVKGYLTPNYLLVGHSDVARTLSPGQALYNIISTWPHFK 368          

HSP 2 Score: 63.5438 bits (153), Expect = 6.109e-10
Identity = 53/194 (27.32%), Postives = 89/194 (45.88%), Query Frame = 1
Query: 1270 LNWTRVFTGYEIFWLGNVTENNFPISNTSECD--IYDSNMNPDEPKKLTIISRKQWYAKKSKGIEDEFPNFPVPFVIITDTERPFCNCYTKEACDFQMRMIQDILTPFLH------IPYNFIVTGNGLVYQGKGWIYKNQANTDLYNDKSLSIAFCGRYKNKEPDVVSLNSVKMLINLAIENKKVARNYTIYLL 1827
            L W  VF+   I   G+ + N       SE    ++++     E    T +SRK W A+ + G   +    PV  ++I     P   C+ +  C  ++R +Q      +H      + YNF+V  +G VY+G GW  +   +T  YN+ SL  AF G  K   P   +L++++ LI  A++   ++ +Y   LL
Sbjct:    2 LPWLLVFSALGIQAWGDSSWNKTQAKQVSEGLQYLFENISQLTEKDVSTTVSRKAWGAE-AVGCSIQL-TTPVNVLVIHHV--PGLECHDQTVCSQRLRELQ---AHHVHNNSGCDVAYNFLVGDDGRVYEGVGWNIQG-VHTQGYNNISLGFAFFGTKKGHSPSPAALSAMENLITYAVQKGHLSSSYVQPLL 187          
BLAST of Peptidoglycan-recognition protein vs. Ensembl Human
Match: PGLYRP4 (peptidoglycan recognition protein 4 [Source:HGNC Symbol;Acc:HGNC:30015])

HSP 1 Score: 69.707 bits (169), Expect = 7.383e-12
Identity = 46/168 (27.38%), Postives = 76/168 (45.24%), Query Frame = 1
Query: 1411 IISRKQWYAKKSKGIEDEFPNFPVP--FVIITDTERPFCNCYTKEACDFQMRMIQDILTPFLH---IPYNFIVTGNGLVYQGKGWIYKNQANTDLYNDKSLSIAFCGRYKNKEPDVVSLNSVKMLINLAIENKKVARNYTIYLLKDISLLNFPSDGLSSVIELWPRYR 1899
            ++ R  W A+     E   P   +P  + II  T    CN    + C   +R IQ      L    I YNF+V  +G +Y+G GW  +  ++T  Y+D +L I F G +    P+  +L + + LI  A+    +  NY +    D++    P   L ++I  WP ++
Sbjct:  213 VVPRSVWGAR-----ETHCPRMTLPAKYGIIIHTAGRTCN--ISDECRLLVRDIQSFYIDRLKSCDIGYNFLVGQDGAIYEGVGWNVQG-SSTPGYDDIALGITFMGTFTGIPPNAAALEAAQDLIQCAMVKGYLTPNYLLVGHSDVARTLSPGQALYNIISTWPHFK 372          

HSP 2 Score: 62.7734 bits (151), Expect = 1.291e-9
Identity = 56/198 (28.28%), Postives = 90/198 (45.45%), Query Frame = 1
Query: 1270 LNWTRVFTGYEIFWLGNVTENNFPISNTSECDIYD-SNMNPDEPKKL-----TIISRKQWYAKKSKGIEDEFPNFPVPFVIITDTERPFCNCYTKEACDFQMRMIQDILTPFLH------IPYNFIVTGNGLVYQGKGWIYKNQANTDLYNDKSLSIAFCGRYKNKEPDVVSLNSVKMLINLAIENKKVARNYTIYLL 1827
            L W  VF+   I   G+ + N       SE   Y   N++    K L     T +SRK W A+ + G   +    PV  ++I     P   C+ +  C  ++R +Q      +H      + YNF+V  +G VY+G GW  +   +T  YN+ SL  AF G  K   P   +L++++ LI  A++   ++ +Y   LL
Sbjct:    2 LPWLLVFSALGIQAWGDSSWNKTQAKQVSEGLQYLFENISQLTEKGLPTDVSTTVSRKAWGAE-AVGCSIQL-TTPVNVLVIHHV--PGLECHDQTVCSQRLRELQ---AHHVHNNSGCDVAYNFLVGDDGRVYEGVGWNIQG-VHTQGYNNISLGFAFFGTKKGHSPSPAALSAMENLITYAVQKGHLSSSYVQPLL 191          
BLAST of Peptidoglycan-recognition protein vs. Ensembl Human
Match: PGLYRP2 (peptidoglycan recognition protein 2 [Source:HGNC Symbol;Acc:HGNC:30013])

HSP 1 Score: 58.151 bits (139), Expect = 5.636e-8
Identity = 41/167 (24.55%), Postives = 73/167 (43.71%), Query Frame = 1
Query: 1408 TIISRKQWYAKKSKGIEDEFPNFPVPFVIITDTERPFCNCYTKEACDFQMRMIQ---DILTPFLHIPYNFIVTGNGLVYQGKGWIYKNQANTDLYNDKSLSIAFCGRYKNKEPDVVSLNSVK-MLINLAIENKKVARNYTIYLLKDISLLNFPSDGLSSVIELWPRY 1896
             I  R +W A   +G   +    P+ F+ +  T  P   C     C   MR +Q        +  I Y+F+V  +G VY+G+GW +   A+T  +N +   +A  G Y    P   +L +V+  L + A+    +  +Y +   + +   + P D L  ++  WP +
Sbjct:  381 AIHPRCRWGAAPYRG-RPKLLQLPLGFLYVHHTYVPAPPCTDFTRCAANMRSMQRYHQDTQGWGDIGYSFVVGSDGYVYEGRGWHWVG-AHTLGHNSRGFGVAIVGNYTAALPTEAALRTVRDTLPSCAVRAGLLRPDYALLGHRQLVRTDCPGDALFDLLRTWPHF 545          
BLAST of Peptidoglycan-recognition protein vs. Ensembl Fly
Match: PGRP-LC (gene:FBgn0035976 transcript:FBtr0300291)

HSP 1 Score: 93.5893 bits (231), Expect = 2.729e-20
Identity = 52/186 (27.96%), Postives = 96/186 (51.61%), Query Frame = 1
Query: 1348 NTSECDIYDSNMNPDEPKKLTIISRKQWYAKKSKGIEDEFPNFPVPFVIITDTERPFCNCYTKEACDFQMRMIQDILT---PFLHIPYNFIVTGNGLVYQGKGWIYKNQANTDLYNDKSLSIAFCGRYKNKEPDVVSLNSVKMLINLAIENKKVARNYTIYLLKDISLLNFPSDGLSSVIELWPRY 1896
            N ++ D+ D++        L I+   +W  + +K + D     P+  V+I+ T      C ++E C  ++ ++Q        + HI YNF+V G+G VY+G+GW Y   A+T  YN  S+ I+F G +  ++P+   L + ++L+   +  KK+  NY +Y  + +S    P + L  +I+ WP +
Sbjct:  151 NQTDLDVIDNST-------LVILKVAEWGGRPAKRMLD-AQQLPINRVVISHTAAE--GCESREVCSARVNVVQSFHMDSWGWDHIGYNFLVGGDGRVYEGRGWDYVG-AHTKGYNRGSIGISFIGTFTTRKPNERQLEACQLLLQEGVRLKKLTTNYRLYGHRQLSATESPGEELYKIIKKWPHW 325          
BLAST of Peptidoglycan-recognition protein vs. Ensembl Fly
Match: PGRP-LC (gene:FBgn0035976 transcript:FBtr0300290)

HSP 1 Score: 89.7373 bits (221), Expect = 3.067e-18
Identity = 52/186 (27.96%), Postives = 96/186 (51.61%), Query Frame = 1
Query: 1348 NTSECDIYDSNMNPDEPKKLTIISRKQWYAKKSKGIEDEFPNFPVPFVIITDTERPFCNCYTKEACDFQMRMIQDILT---PFLHIPYNFIVTGNGLVYQGKGWIYKNQANTDLYNDKSLSIAFCGRYKNKEPDVVSLNSVKMLINLAIENKKVARNYTIYLLKDISLLNFPSDGLSSVIELWPRY 1896
            N ++ D+ D++        L I+   +W  + +K + D     P+  V+I+ T      C ++E C  ++ ++Q        + HI YNF+V G+G VY+G+GW Y   A+T  YN  S+ I+F G +  ++P+   L + ++L+   +  KK+  NY +Y  + +S    P + L  +I+ WP +
Sbjct:  322 NQTDLDVIDNST-------LVILKVAEWGGRPAKRMLDAQ-QLPINRVVISHTA--AEGCESREVCSARVNVVQSFHMDSWGWDHIGYNFLVGGDGRVYEGRGWDYVG-AHTKGYNRGSIGISFIGTFTTRKPNERQLEACQLLLQEGVRLKKLTTNYRLYGHRQLSATESPGEELYKIIKKWPHW 496          
BLAST of Peptidoglycan-recognition protein vs. Ensembl Fly
Match: PGRP-LC (gene:FBgn0035976 transcript:FBtr0089490)

HSP 1 Score: 89.7373 bits (221), Expect = 3.067e-18
Identity = 52/186 (27.96%), Postives = 96/186 (51.61%), Query Frame = 1
Query: 1348 NTSECDIYDSNMNPDEPKKLTIISRKQWYAKKSKGIEDEFPNFPVPFVIITDTERPFCNCYTKEACDFQMRMIQDILT---PFLHIPYNFIVTGNGLVYQGKGWIYKNQANTDLYNDKSLSIAFCGRYKNKEPDVVSLNSVKMLINLAIENKKVARNYTIYLLKDISLLNFPSDGLSSVIELWPRY 1896
            N ++ D+ D++        L I+   +W  + +K + D     P+  V+I+ T      C ++E C  ++ ++Q        + HI YNF+V G+G VY+G+GW Y   A+T  YN  S+ I+F G +  ++P+   L + ++L+   +  KK+  NY +Y  + +S    P + L  +I+ WP +
Sbjct:  322 NQTDLDVIDNST-------LVILKVAEWGGRPAKRMLDAQ-QLPINRVVISHTA--AEGCESREVCSARVNVVQSFHMDSWGWDHIGYNFLVGGDGRVYEGRGWDYVG-AHTKGYNRGSIGISFIGTFTTRKPNERQLEACQLLLQEGVRLKKLTTNYRLYGHRQLSATESPGEELYKIIKKWPHW 496          
BLAST of Peptidoglycan-recognition protein vs. Ensembl Fly
Match: PGRP-LC (gene:FBgn0035976 transcript:FBtr0472540)

HSP 1 Score: 85.8853 bits (211), Expect = 1.117e-17
Identity = 51/166 (30.72%), Postives = 86/166 (51.81%), Query Frame = 1
Query: 1402 KLTIISRKQWYAKKSKGIEDEFPNFPVPFVIITDTERPFCNCYTKEACDFQMRMIQ----DILTPFLHIPYNFIVTGNGLVYQGKGWIYKNQANTDLYNDKSLSIAFCGRYKNKEPDVVSLNSVKMLINLAIENKKVARNYTIYLLKDISLLNFPSDGLSSVIELW 1887
            KL ++S K W    ++G    F   PV  VII++T  P   C T+++C +  R+ Q    D    +  + YNF+V G+G +Y+G+GW Y      D  N+ S+ I F G ++ +EP   SL + ++LI   +  KK+  +Y +   + I+    P + L  +I+ W
Sbjct:  163 KLVVVSIKGWGGMPTRGNLKPF-KLPVSKVIISET--PPEICTTQDSCSYWTRVTQSRHMDTFN-WSQVGYNFLVGGDGRIYEGRGWNYMGDHTRD-NNNNSIGITFLGTFRRQEPTPKSLEACQLLIAQGVRLKKLKPDYQLLGHRQITGTLMPGEELYRIIQTW 323          
BLAST of Peptidoglycan-recognition protein vs. Ensembl Fly
Match: PGRP-SB1 (gene:FBgn0043578 transcript:FBtr0075348)

HSP 1 Score: 82.4185 bits (202), Expect = 1.302e-17
Identity = 55/171 (32.16%), Postives = 85/171 (49.71%), Query Frame = 1
Query: 1405 LTIISRKQWYAKKSKGIEDEFPNFPVPFVIITDTERPFCNCYTKEACDFQMRMIQDILTP------FLHIPYNFIVTGNGLVYQGKGWIYKNQANTDLYNDKSLSIAFCGRYKNKEPDVVSLNSVKMLINLAIENKKVARNYTIYLLKDISLLNFPSDGLSSVIELWPRYR 1899
            L I  R  W A  ++       +  V +VII  ++ P   C T E C    RMI++I +       F  I YNFIV G+G VY+G+G+  +  +++  YN KS+ I F G ++   P    L + K LI LA +   +  NYT++  +     + P D L + I+ WP +R
Sbjct:   25 LQIEPRSSWGAVSAR--SPSRISGAVDYVIIHHSDNP-NGCSTSEQCK---RMIKNIQSDHKGRRNFSDIGYNFIVAGDGKVYEGRGFGLQG-SHSPNYNRKSIGIVFIGNFERSAPSAQMLQNAKDLIELAKQRGYLKDNYTLFGHRQTKATSCPGDALYNEIKTWPHWR 188          
BLAST of Peptidoglycan-recognition protein vs. Ensembl Zebrafish
Match: pglyrp6 (peptidoglycan recognition protein 6 [Source:ZFIN;Acc:ZDB-GENE-071227-2])

HSP 1 Score: 73.559 bits (179), Expect = 5.271e-13
Identity = 54/200 (27.00%), Postives = 90/200 (45.00%), Query Frame = 1
Query: 1378 NMNPDEPKKL-------------------TIISRKQWYAKKSKGIEDEFPNFPVPFVIITDTERPFCNCYTKEACDFQMRMIQ---DILTPFLHIPYNFIVTGNGLVYQGKGWIYKNQANTDLYNDKSLSIAFCGRYKNKEPDVVSLNSVKMLINL-AIENKKVARNYTIYLLKDISLLNFPSDGLSSVIELWPRYRGHL 1908
            N+N DE KKL                    II+R QW A    G    + + PV ++ I  T +P   C T E C  +MR +Q        +  I Y+F+   +G +Y+G+GW +   A+T  YN     + F G Y +  P   ++N V+      A    +++++Y++Y  +  +    P + L   I+ W RY+ +L
Sbjct:  300 NLNQDERKKLDDVVNEGFEEFVHVYAVCPNIITRSQWGAASYIG-SPSYLSLPVRYLFIHHTYQPSKPCTTFEQCAAEMRSMQRYHQQSNGWSDIGYSFVAGSDGNLYEGRGWNWVG-AHTYGYNSIGYGVCFIGDYTSTLPASSAMNMVRYDFTYCATNGGRLSKSYSLYGHRQAAATECPGNTLYRQIQTWERYQSYL 497          
BLAST of Peptidoglycan-recognition protein vs. Ensembl Zebrafish
Match: pglyrp2 (peptidoglycan recognition protein 2 [Source:ZFIN;Acc:ZDB-GENE-071227-1])

HSP 1 Score: 62.7734 bits (151), Expect = 1.083e-9
Identity = 44/169 (26.04%), Postives = 77/169 (45.56%), Query Frame = 1
Query: 1408 TIISRKQWYAKKSKGIEDEFPNFPVPFVIITDTERPFCNCYTKEACDFQMRMIQDILT---PFLHIPYNFIVTGNGLVYQGKGWIYKNQANTDLYNDKSLSIAFCGRYKNKEPDVVSLNSVK-MLINLAIENKKVARNYTIYLLKDISLLNF-PSDGLSSVIELWPRYR 1899
            +II R  W A   + +  E  + P+ F+ I  T  P   C   + C   MR +Q        +  I Y+F+V  +G +Y+G+GW+ +  A+T   N+    +AF G Y  + P    +  V+  L+   + N  +  ++TI   + + +    P + L S I  W  Y+
Sbjct:  296 SIIPRCIWGAAPPQ-VPLELLSPPMSFLYIHHTAIPSKPCLNLQTCSQNMRAMQRFHQKDWGWYDIGYSFVVGSDGYIYEGRGWMSQG-AHTKGRNNVGYGVAFIGDYSGRLPSTHDMELVRHHLVKCGVNNGFLQEDFTILGHRQVVVTTSCPGNALYSEITTWMHYK 462          
BLAST of Peptidoglycan-recognition protein vs. Ensembl Zebrafish
Match: pglyrp5 (peptidoglycan recognition protein 5 [Source:ZFIN;Acc:ZDB-GENE-050419-71])

HSP 1 Score: 54.6842 bits (130), Expect = 1.180e-7
Identity = 48/168 (28.57%), Postives = 84/168 (50.00%), Query Frame = 1
Query: 1414 ISRKQWYAKKSKGIEDEFPNFPVPFVIITDTERPFCNCYTKEACDFQMRMIQDILT---PFLHIPYNFIVTGNGLVYQGKGWIYKNQANTDLYNDKSLSIAFCGRYKNKEPDVVSLNSVKMLINLAIENKKVARNYTIYLLKDISLLNFPSDGLSSVIELWPRYRGHL 1908
            +SR+ W A + +  E      P   VI+  T   FC  + +E+   ++  IQ +      F  I YNF+++G+G VY+G+GW     A+   +N  S+ IAF G +    P   SL+++  L+++ + +  V  N+ +   KD++    P + L SV+   P+ R  L
Sbjct:   71 VSRRGWDAVQPR--EMTQMESPAHTVIVHHTALRFC-AHPRESVT-ELAHIQRMHMQERGFDDIGYNFLISGDGTVYEGRGWGIVG-AHAKEHNFYSVGIAFMGNFNADLPSSASLSALLRLLHIGVLHGHVRPNFVLLGHKDVAKTACPGENLYSVL---PKLRDRL 230          
BLAST of Peptidoglycan-recognition protein vs. Ensembl Zebrafish
Match: pglyrp5 (peptidoglycan recognition protein 5 [Source:ZFIN;Acc:ZDB-GENE-050419-71])

HSP 1 Score: 54.6842 bits (130), Expect = 1.180e-7
Identity = 48/168 (28.57%), Postives = 84/168 (50.00%), Query Frame = 1
Query: 1414 ISRKQWYAKKSKGIEDEFPNFPVPFVIITDTERPFCNCYTKEACDFQMRMIQDILT---PFLHIPYNFIVTGNGLVYQGKGWIYKNQANTDLYNDKSLSIAFCGRYKNKEPDVVSLNSVKMLINLAIENKKVARNYTIYLLKDISLLNFPSDGLSSVIELWPRYRGHL 1908
            +SR+ W A + +  E      P   VI+  T   FC  + +E+   ++  IQ +      F  I YNF+++G+G VY+G+GW     A+   +N  S+ IAF G +    P   SL+++  L+++ + +  V  N+ +   KD++    P + L SV+   P+ R  L
Sbjct:   71 VSRRGWDAVQPR--EMTQMESPAHTVIVHHTALRFC-AHPRESVT-ELAHIQRMHMQERGFDDIGYNFLISGDGTVYEGRGWGIVG-AHAKEHNFYSVGIAFMGNFNADLPSSASLSALLRLLHIGVLHGHVRPNFVLLGHKDVAKTACPGENLYSVL---PKLRDRL 230          
BLAST of Peptidoglycan-recognition protein vs. Ensembl Zebrafish
Match: pglyrp2 (peptidoglycan recognition protein 2 [Source:ZFIN;Acc:ZDB-GENE-071227-1])

HSP 1 Score: 54.299 bits (129), Expect = 5.259e-7
Identity = 34/134 (25.37%), Postives = 61/134 (45.52%), Query Frame = 1
Query: 1513 PFCNCYTKEACDFQMRMIQDILT---PFLHIPYNFIVTGNGLVYQGKGWIYKNQANTDLYNDKSLSIAFCGRYKNKEPDVVSLNSVK-MLINLAIENKKVARNYTIYLLKDISLLNF-PSDGLSSVIELWPRYR 1899
            P   C   + C   MR +Q        +  I Y+F+V  +G +Y+G+GW+ +  A+T   N+    +AF G Y  + P    +  V+  L+   + N  +  ++TI   + + +    P + L S I  W  Y+
Sbjct:  295 PSKPCLNLQTCSQNMRAMQRFHQKDWGWYDIGYSFVVGSDGYIYEGRGWMSQG-AHTKGRNNVGYGVAFIGDYSGRLPSTHDMELVRHHLVKCGVNNGFLQEDFTILGHRQVVVTTSCPGNALYSEITTWMHYK 427          
BLAST of Peptidoglycan-recognition protein vs. Ensembl Xenopus
Match: pglyrp1-like.1 (pglyrp1 protein [Source:NCBI gene;Acc:595014])

HSP 1 Score: 78.5666 bits (192), Expect = 4.202e-16
Identity = 52/167 (31.14%), Postives = 84/167 (50.30%), Query Frame = 1
Query: 1411 IISRKQWYAKKSKGIEDEFPNFPVPFVIITDTERPFCNCYTKEACDFQMRMIQDILTP---FLHIPYNFIVTGNGLVYQGKGWIYKNQANTDLYNDKSLSIAFCGRYKNKEPDVVSLNSVKMLINLAIENKKVARNYTIYLLKDISLLNFPSDGLSSVIELWPRYRG 1902
            IISR  W    SK  + + P   V +VII  T    CN  ++ AC  Q R IQ+       +    YNF++  +G VY+G+GW     A+   YN  S+ I+F G + N+ P+  +  + K LI+  +  K +  +YT+   +D+S    P   L ++I+ WP ++ 
Sbjct:   21 IISRSSWGGVPSK-CQAKLPR-SVKYVIIHHTAGASCN--SESACKAQARNIQNFHMKSNGWCDTGYNFLIGEDGQVYEGRGW-ETVGAHAKNYNFNSIGISFMGTFTNRAPNTAAQKAAKDLISCGVAKKVINSDYTLKGHRDVSATECPGTNLYNLIKNWPNFKA 182          
BLAST of Peptidoglycan-recognition protein vs. Ensembl Xenopus
Match: cnn2 (calponin 2 [Source:Xenbase;Acc:XB-GENE-1005289])

HSP 1 Score: 76.2554 bits (186), Expect = 4.979e-15
Identity = 44/167 (26.35%), Postives = 82/167 (49.10%), Query Frame = 1
Query: 1408 TIISRKQWYAKKSKGIEDEFPNFPVPFVIITDTERPFCNCYTKEACDFQMRMIQDI---LTPFLHIPYNFIVTGNGLVYQGKGWIYKNQANTDLYNDKSLSIAFCGRYKNKEPDVVSLNSVKMLINLAIENKKVARNYTIYLLKDISLLNFPSDGLSSVIELWPRYR 1899
            TI+++ QW  + +          PVP+VII  T    C+  ++ +C  Q + IQ+       +  + Y+F+V  +G VY+G+GW     A+   YN  S+ I+  G Y N  P+  + N+VK LI+  +    +   Y +   +++     P +   + ++ WPR++
Sbjct:   52 TILTKAQWGGRAAT--CRTAMTTPVPYVIIHHTAGAHCS--SQTSCISQAKSIQNYHMNSNAWCDVGYSFLVGEDGNVYEGRGW-NSVGAHAPNYNSNSIGISVMGTYTNINPNTAAQNAVKNLISCGVTKGYIKSTYILKGHRNVGSTECPGNTFYNTVKTWPRFQ 213          
BLAST of Peptidoglycan-recognition protein vs. Ensembl Xenopus
Match: cnn2 (calponin 2 [Source:Xenbase;Acc:XB-GENE-1005289])

HSP 1 Score: 69.707 bits (169), Expect = 4.301e-13
Identity = 45/168 (26.79%), Postives = 81/168 (48.21%), Query Frame = 1
Query: 1408 TIISRKQWYAKKSKGIEDEFPNFPVPFVIITDTERPFCNCYTKEACDFQMRMIQDI---LTPFLHIPYNFIVTGNGLVYQGKGWIYKNQANTDLYNDKSLSIAFCGRYKNKEPDVVSLNSVKMLINLAIENKKVARNYTIYLLKDISLLNFPSDGLSSVIELWPRYRG 1902
            TI+++ QW  + +          PVP+VII  T    C+  T  +C  Q + IQ+       +  + Y+F+V  +G VY+G+GW     A+   YN  S+ I+  G Y N  P+  + N+VK LI+  +    +   Y +   +++     P +   + ++ WPR++ 
Sbjct:    7 TILTKAQWGGRAATC--RTAMTTPVPYVIIHHTAGAHCSSQT--SCISQAKSIQNYHMNSNAWCDVGYSFLVGEDGNVYEGRGW-NSVGAHAPNYNSNSIGISVMGTYTNINPNTAAQNAVKNLISCGVTKGYIKSTYILKGHRNVGSTECPGNTFYNTVKTWPRFQA 169          
BLAST of Peptidoglycan-recognition protein vs. Ensembl Xenopus
Match: pglyrp2 (peptidoglycan recognition protein 2 [Source:NCBI gene;Acc:100127677])

HSP 1 Score: 64.3142 bits (155), Expect = 4.892e-10
Identity = 48/168 (28.57%), Postives = 74/168 (44.05%), Query Frame = 1
Query: 1408 TIISRKQWYAKKSKGIEDEFPNFPVPFVIITDTERPFCNCYTKEACDFQMRMIQDILT---PFLHIPYNFIVTGNGLVYQGKGWIYKNQANTDLYNDKSLSIAFCGRYKNKEPDVVSLNSVK-MLINLAIENKKVARNYTIYLLKDISLLNFPSDGLSSVIELWPRYR 1899
             +I R  W AK+ KG +  F   P+  V I  T  P   C +   C   MR +Q        +  I Y+F+V  NG +Y+G+GW  +  A+T  YN     ++F G Y +  P    L  VK   +  A+    +  NY I   + +   + P D L   I+ W  ++
Sbjct:  330 AVIPRCMWGAKRYKG-KPIFLGLPLSRVFIHHTYEPSQPCTSFSQCAANMRSMQRFHQQDRGWDDIGYSFVVGSNGYLYEGRGW-NRAGAHTRGYNSVGYGVSFIGDYTSIVPKDSILALVKDRFLRCAVRLGYITPNYIIQGHRQVVSTSCPGDALYKEIQSWDHFK 495          
BLAST of Peptidoglycan-recognition protein vs. Ensembl Xenopus
Match: pglyrp2 (peptidoglycan recognition protein 2 [Source:NCBI gene;Acc:100127677])

HSP 1 Score: 64.3142 bits (155), Expect = 4.892e-10
Identity = 48/168 (28.57%), Postives = 74/168 (44.05%), Query Frame = 1
Query: 1408 TIISRKQWYAKKSKGIEDEFPNFPVPFVIITDTERPFCNCYTKEACDFQMRMIQDILT---PFLHIPYNFIVTGNGLVYQGKGWIYKNQANTDLYNDKSLSIAFCGRYKNKEPDVVSLNSVK-MLINLAIENKKVARNYTIYLLKDISLLNFPSDGLSSVIELWPRYR 1899
             +I R  W AK+ KG +  F   P+  V I  T  P   C +   C   MR +Q        +  I Y+F+V  NG +Y+G+GW  +  A+T  YN     ++F G Y +  P    L  VK   +  A+    +  NY I   + +   + P D L   I+ W  ++
Sbjct:  330 AVIPRCMWGAKRYKG-KPIFLGLPLSRVFIHHTYEPSQPCTSFSQCAANMRSMQRFHQQDRGWDDIGYSFVVGSNGYLYEGRGW-NRAGAHTRGYNSVGYGVSFIGDYTSIVPKDSILALVKDRFLRCAVRLGYITPNYIIQGHRQVVSTSCPGDALYKEIQSWDHFK 495          
BLAST of Peptidoglycan-recognition protein vs. Ensembl Mouse
Match: Pglyrp3 (peptidoglycan recognition protein 3 [Source:MGI Symbol;Acc:MGI:2685266])

HSP 1 Score: 79.7221 bits (195), Expect = 2.481e-15
Identity = 55/173 (31.79%), Postives = 83/173 (47.98%), Query Frame = 1
Query: 1396 PKKL--TIISRKQWYAKKSKGIEDEFPNFPVPFVIITDTERPFCNCYTKEACDFQMRMIQDIL---TPFLHIPYNFIVTGNGLVYQGKGWIYKNQANTDLYNDKSLSIAFCGRYKNKEPDVVSLNSVKMLINLAIENKKVARNYTIYLLKDISLLNFPSDGLSSVIELWPRYR 1899
            PKK    I  R  W A+++   +    N P  FVII  T    CN      C  ++R  Q        F  I Y+F+V  +G VY+G GW  +  ++T  YND +L IAF G +  K P+  SL + + LI  A+    +  NY +    D+S +  P   L ++I+ WP ++
Sbjct:  180 PKKACPNITPRSAWEARETHCPQM---NLPAKFVIIIHTAGKSCN--ESADCLVRVRDTQSFHIDNQDFCDIAYHFLVGQDGEVYEGVGWNIEG-SHTYGYNDIALGIAFMGNFVEKPPNEASLKAAQSLIQCAVAKGYLTSNYLLMGHSDVSNILSPGQALYNIIKTWPHFK 346          

HSP 2 Score: 67.0106 bits (162), Expect = 2.936e-11
Identity = 52/154 (33.77%), Postives = 81/154 (52.60%), Query Frame = 1
Query: 1408 TIISRKQWYAKKSKGIEDEFP-NFPVPFVIITDTERPFCNCYTKEACDFQMRMIQDILTPFLH------IPYNFIVTGNGLVYQGKGWIYKNQANTDLYNDKSLSIAFCGRYKNKEPDVVSLNSVKMLINLAIENKKVARNY-TIYLLKDISLL 1845
            TI+SRK+W A     +    P + PVP++II    R    C  +  C   +R++Q   + ++H      I +NF+V  +G VY+G GW Y    +T  YN+ SL IAF G  K   P   +L++ + LI  AI+N  ++  Y   +LLK+ + L
Sbjct:   29 TIVSRKEWGASS---LTCRVPLSLPVPYLIIEQVTR--MQCQDQITCSQVVRVLQ---SQYVHNKGWCDIAFNFLVGDDGKVYEGVGW-YVQGLHTQGYNNVSLGIAFFGS-KIGSPSPAALSATEDLIFFAIQNGYLSPKYIQPFLLKEETCL 172          
BLAST of Peptidoglycan-recognition protein vs. Ensembl Mouse
Match: Pglyrp1 (peptidoglycan recognition protein 1 [Source:MGI Symbol;Acc:MGI:1345092])

HSP 1 Score: 75.8702 bits (185), Expect = 3.063e-15
Identity = 47/166 (28.31%), Postives = 79/166 (47.59%), Query Frame = 1
Query: 1411 IISRKQWYAKKSKGIEDEFPNFPVPFVIITDTERPFCNCYTKEACDFQMRMIQDILTPFL---HIPYNFIVTGNGLVYQGKGWIYKNQANTDLYNDKSLSIAFCGRYKNKEPDVVSLNSVKMLINLAIENKKVARNYTIYLLKDISLLNFPSDGLSSVIELWPRYR 1899
            I+ R +W A  S+         PV +V+I+ T   FCN  + ++C+ Q R +Q      L    + YNF++  +G VY+G+GW  K      ++N  S+ I F G + ++ P   +L +   L+   +    +  NY +   +D+     P D L  VI+ W  YR
Sbjct:   20 IVPRSEWRALPSEC--SSRLGHPVRYVVISHTAGSFCN--SPDSCEQQARNVQHYHKNELGWCDVAYNFLIGEDGHVYEGRGWNIKGDHTGPIWNPMSIGITFMGNFMDRVPAKRALRAALNLLECGVSRGFLRSNYEVKGHRDVQSTLSPGDQLYQVIQSWEHYR 181          
BLAST of Peptidoglycan-recognition protein vs. Ensembl Mouse
Match: Pglyrp4 (peptidoglycan recognition protein 4 [Source:MGI Symbol;Acc:MGI:2686324])

HSP 1 Score: 76.2554 bits (186), Expect = 3.431e-14
Identity = 52/167 (31.14%), Postives = 78/167 (46.71%), Query Frame = 1
Query: 1411 IISRKQWYAKKSKGIEDEFPNFPVPFVIITDTERPFCNCYTKEACDFQMRMIQDILTPFLH---IPYNFIVTGNGLVYQGKGWIYKNQAN-TDLYNDKSLSIAFCGRYKNKEPDVVSLNSVKMLINLAIENKKVARNYTIYLLKDISLLNFPSDGLSSVIELWPRYR 1899
            I+ R  W A+ S          P  + II  T    C+    + C   +R +Q      L+   I YNF+V  +G VY+G GW   NQ + TD YND SLSI F G +    P+  +L + + LI  A+    +  NY +    D+S    P   L ++I+ WP ++
Sbjct:  215 IVPRSVWGARDS---HCSRMTLPAKYAIILHTAGRTCS--QPDECRLLVRDLQSFFMNRLNACDIGYNFLVGQDGGVYEGVGW--NNQGSKTDSYNDISLSITFMGTFTGSPPNAAALEAAQDLIRCAVVKGYLTPNYLLMGHSDVSNTLSPGQALYNIIKTWPHFK 374          

HSP 2 Score: 65.855 bits (159), Expect = 9.066e-11
Identity = 42/142 (29.58%), Postives = 75/142 (52.82%), Query Frame = 1
Query: 1408 TIISRKQWYAKKSKGIEDEFPNFPVPFVIITDTERPFCNCYTKEACDFQMRMIQ--DILTPFLHIPYNFIVTGNGLVYQGKGWIYKNQANTDLYNDKSLSIAFCGRYKNKEPDVVSLNSVKMLINLAIENKKVARNYTIYLL 1827
            T++SR++W A+ + G   +  + PV  ++I     P   C+ K  C  ++R +Q   I   +  + YNF+V  +G VY+G GW  +   +   Y + SL +AF G  +   P  V+L+++K LI+ A++   ++  Y   LL
Sbjct:   56 TMVSREEWGAE-AIGCSSKL-SRPVDVLVIHHI--PGLECHNKTVCSQKLRELQAYHIHNSWCDVAYNFLVGDDGRVYEGVGWNVQGSHDQG-YKNISLGVAFFGTQEGHSPSPVALSAMKGLISYAVKKGHLSSKYIQPLL 192          
BLAST of Peptidoglycan-recognition protein vs. Ensembl Mouse
Match: Pglyrp4 (peptidoglycan recognition protein 4 [Source:MGI Symbol;Acc:MGI:2686324])

HSP 1 Score: 76.2554 bits (186), Expect = 3.691e-14
Identity = 52/167 (31.14%), Postives = 78/167 (46.71%), Query Frame = 1
Query: 1411 IISRKQWYAKKSKGIEDEFPNFPVPFVIITDTERPFCNCYTKEACDFQMRMIQDILTPFLH---IPYNFIVTGNGLVYQGKGWIYKNQAN-TDLYNDKSLSIAFCGRYKNKEPDVVSLNSVKMLINLAIENKKVARNYTIYLLKDISLLNFPSDGLSSVIELWPRYR 1899
            I+ R  W A+ S          P  + II  T    C+    + C   +R +Q      L+   I YNF+V  +G VY+G GW   NQ + TD YND SLSI F G +    P+  +L + + LI  A+    +  NY +    D+S    P   L ++I+ WP ++
Sbjct:  214 IVPRSVWGARDS---HCSRMTLPAKYAIILHTAGRTCS--QPDECRLLVRDLQSFFMNRLNACDIGYNFLVGQDGGVYEGVGW--NNQGSKTDSYNDISLSITFMGTFTGSPPNAAALEAAQDLIRCAVVKGYLTPNYLLMGHSDVSNTLSPGQALYNIIKTWPHFK 373          

HSP 2 Score: 65.855 bits (159), Expect = 9.509e-11
Identity = 42/142 (29.58%), Postives = 75/142 (52.82%), Query Frame = 1
Query: 1408 TIISRKQWYAKKSKGIEDEFPNFPVPFVIITDTERPFCNCYTKEACDFQMRMIQ--DILTPFLHIPYNFIVTGNGLVYQGKGWIYKNQANTDLYNDKSLSIAFCGRYKNKEPDVVSLNSVKMLINLAIENKKVARNYTIYLL 1827
            T++SR++W A+ + G   +  + PV  ++I     P   C+ K  C  ++R +Q   I   +  + YNF+V  +G VY+G GW  +   +   Y + SL +AF G  +   P  V+L+++K LI+ A++   ++  Y   LL
Sbjct:   56 TMVSREEWGAE-AIGCSSKL-SRPVDVLVIHHI--PGLECHNKTVCSQKLRELQAYHIHNSWCDVAYNFLVGDDGRVYEGVGWNVQGSHDQG-YKNISLGVAFFGTQEGHSPSPVALSAMKGLISYAVKKGHLSSKYIQPLL 192          
BLAST of Peptidoglycan-recognition protein vs. Ensembl Mouse
Match: Pglyrp2 (peptidoglycan recognition protein 2 [Source:MGI Symbol;Acc:MGI:1928099])

HSP 1 Score: 73.1738 bits (178), Expect = 6.015e-13
Identity = 46/167 (27.54%), Postives = 81/167 (48.50%), Query Frame = 1
Query: 1408 TIISRKQWYAKKSKGIEDEFPNFPVPFVIITDTERPFCNCYTKEACDFQMRMIQDI---LTPFLHIPYNFIVTGNGLVYQGKGWIYKNQANTDLYNDKSLSIAFCGRYKNKEPDVVSLNSVK-MLINLAIENKKVARNYTIYLLKDISLLNFPSDGLSSVIELWPRY 1896
             I  R +W A   +G        P+ F+ +  T  P   C T ++C   MR +Q     +  +  I Y+F+V  +G +YQG+GW +   A+T  YN +   +AF G Y    P+  +LN+V+  L + AI    +  +Y +   + + L + P + L +++  WP +
Sbjct:  311 AIHPRCRWGAAPYRGHPTPL-RLPLGFLYVHHTYVPAPPCTTFQSCAADMRSMQRFHQDVRKWDDIGYSFVVGSDGYLYQGRGWHWVG-AHTRGYNSRGFGVAFVGNYTGSLPNEAALNTVRDALPSCAIRAGLLRPDYKLLGHRQLVLTHCPGNALFNLLRTWPHF 475          
BLAST of Peptidoglycan-recognition protein vs. UniProt/SwissProt
Match: sp|O75594|PGRP1_HUMAN (Peptidoglycan recognition protein 1 OS=Homo sapiens OX=9606 GN=PGLYRP1 PE=1 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 3.237e-17
Identity = 45/166 (27.11%), Postives = 83/166 (50.00%), Query Frame = 1
Query: 1411 IISRKQWYAKKSKGIEDEFPNFPVPFVIITDTERPFCNCYTKEACDFQMRMIQDILTPFLH---IPYNFIVTGNGLVYQGKGWIYKNQANTDLYNDKSLSIAFCGRYKNKEPDVVSLNSVKMLINLAIENKKVARNYTIYLLKDISLLNFPSDGLSSVIELWPRYR 1899
            I+ R +W A  S+  +    + P+ +V+++ T    CN  T  +C  Q R +Q      L    + YNF++  +GLVY+G+GW +    +  L+N  S+ I+F G Y ++ P   ++ + + L+   +    +  NY +   +D+     P + L  +I+ WP YR
Sbjct:   33 IVPRNEWKALASECAQHL--SLPLRYVVVSHTAGSSCN--TPASCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHSGHLWNPMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQNWPHYR 194          
BLAST of Peptidoglycan-recognition protein vs. UniProt/SwissProt
Match: sp|Q9GK12|PGRP1_CAMDR (Peptidoglycan recognition protein 1 OS=Camelus dromedarius OX=9838 GN=PGLYRP1 PE=1 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 9.539e-17
Identity = 49/173 (28.32%), Postives = 83/173 (47.98%), Query Frame = 1
Query: 1390 DEPKKLTIISRKQWYAKKSKGIEDEFPNFPVPFVIITDTERPFCNCYTKEACDFQMRMIQDILTPFLH---IPYNFIVTGNGLVYQGKGWIYKNQANTDLYNDKSLSIAFCGRYKNKEPDVVSLNSVKMLINLAIENKKVARNYTIYLLKDISLLNFPSDGLSSVIELWPRYR 1899
            D P   +I+ R++W A  S+  E      PV +V+++ T    C+  T  +C  Q + +Q      L    + YNF++  +GLVY+G+GW  K       +N  S+ I+F G Y N+ P   +L + + L+   +    +  NY +   +D+     P D L  +I+ W  YR
Sbjct:   24 DPPACGSIVPRREWRALASECRERL--TRPVRYVVVSHTAGSHCD--TPASCAQQAQNVQSYHVRNLGWCDVGYNFLIGEDGLVYEGRGWNIKGAHAGPTWNPISIGISFMGNYMNRVPPPRALRAAQNLLACGVALGALRSNYEVKGHRDVQPTLSPGDRLYEIIQTWSHYR 192          
BLAST of Peptidoglycan-recognition protein vs. UniProt/SwissProt
Match: sp|Q70PY2|PGSB1_DROME (Peptidoglycan-recognition protein SB1 OS=Drosophila melanogaster OX=7227 GN=PGRP-SB1 PE=2 SV=2)

HSP 1 Score: 82.4185 bits (202), Expect = 1.306e-16
Identity = 55/171 (32.16%), Postives = 85/171 (49.71%), Query Frame = 1
Query: 1405 LTIISRKQWYAKKSKGIEDEFPNFPVPFVIITDTERPFCNCYTKEACDFQMRMIQDILTP------FLHIPYNFIVTGNGLVYQGKGWIYKNQANTDLYNDKSLSIAFCGRYKNKEPDVVSLNSVKMLINLAIENKKVARNYTIYLLKDISLLNFPSDGLSSVIELWPRYR 1899
            L I  R  W A  ++       +  V +VII  ++ P   C T E C    RMI++I +       F  I YNFIV G+G VY+G+G+  +  +++  YN KS+ I F G ++   P    L + K LI LA +   +  NYT++  +     + P D L + I+ WP +R
Sbjct:   25 LQIEPRSSWGAVSAR--SPSRISGAVDYVIIHHSDNP-NGCSTSEQCK---RMIKNIQSDHKGRRNFSDIGYNFIVAGDGKVYEGRGFGLQG-SHSPNYNRKSIGIVFIGNFERSAPSAQMLQNAKDLIELAKQRGYLKDNYTLFGHRQTKATSCPGDALYNEIKTWPHWR 188          
BLAST of Peptidoglycan-recognition protein vs. UniProt/SwissProt
Match: sp|B5T255|PGRP1_BOSIN (Peptidoglycan recognition protein 1 OS=Bos indicus OX=9915 GN=PGLYRP1 PE=3 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 2.579e-16
Identity = 46/167 (27.54%), Postives = 81/167 (48.50%), Query Frame = 1
Query: 1408 TIISRKQWYAKKSKGIEDEFPNFPVPFVIITDTERPFCNCYTKEACDFQMRMIQDILT---PFLHIPYNFIVTGNGLVYQGKGWIYKNQANTDLYNDKSLSIAFCGRYKNKEPDVVSLNSVKMLINLAIENKKVARNYTIYLLKDISLLNFPSDGLSSVIELWPRYR 1899
            +I+SR +W A  SK    +    PV +V+++ T    CN  T  +C  Q + +Q        +  + YNF++  +GLVY+G+GW      +   +N  ++ I+F G Y ++ P   +L + + L+        +  NY +   +D+     P D L  +I+ WP YR
Sbjct:   26 SIVSRGKWGALASK--CSQRLRQPVRYVVVSHTAGSVCN--TPASCQRQAQNVQHYHVRERGWCDVGYNFLIGEDGLVYEGRGWNTLGAHSGPTWNPIAIGISFMGNYMHRVPPASALRAAQSLLACGAARGYLTPNYEVKGHRDVQQTLSPGDELYKIIQQWPHYR 188          
BLAST of Peptidoglycan-recognition protein vs. UniProt/SwissProt
Match: sp|Q8SXQ7|PGPLF_DROME (Peptidoglycan-recognition protein LF OS=Drosophila melanogaster OX=7227 GN=PGRP-LF PE=1 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 2.789e-16
Identity = 47/169 (27.81%), Postives = 84/169 (49.70%), Query Frame = 1
Query: 1399 KKLTIISRKQWYAKKSKGIEDEFPNFPVPFVIITDTERPFCNCYTKEACDFQMRMIQDILT---PFLHIPYNFIVTGNGLVYQGKGWIYKNQANTDLYNDKSLSIAFCGRYKNKEPDVVSLNSVKMLINLAIENKKVARNYTIYLLKDISLLNFPSDGLSSVIELWPRY 1896
            K L I+ R +W  +   G   ++P+  +P   I         C  ++ C ++M+ IQ        ++ I YNF+V G+G +Y G+GW  + Q + + Y   S+SIAF G + N EP    + + K L++  +   ++  +Y IY  + +S    P   L  +++ WPR+
Sbjct:   55 KGLHILDRSEWLGEPPSG---KYPHLKLPVSNIIIHHTATEGCEQEDVCIYRMKTIQAFHMKSFGWVDIGYNFLVGGDGQIYVGRGWHIQGQ-HVNGYGAISVSIAFIGTFVNMEPPARQIEAAKRLMDEGVRLHRLQPDYHIYAHRQLSPTESPGQKLFELMQNWPRF 219          
BLAST of Peptidoglycan-recognition protein vs. TrEMBL
Match: I1ZIL3 (Peptidoglycan recognition protein-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 5.549e-41
Identity = 148/570 (25.96%), Postives = 270/570 (47.37%), Query Frame = 1
Query:  292 QCYYDCVYHPKCFMAVYIKSNMKCQFFDKASY--IDAYKFDVYLWKCCDVGKT-NSVRNRCSGFWKMSYFSISSNTIRNNDYLN-ENRITNLYQCQNSCLDNPICGAINWENSEIHERLCQQVIQFPVENLWLKSNSKFSTFTWQCALNYT-LPAPDTKCVD-RAGHTFGYWKIENNSTVIPNDSKILLYFYTYDYKSCLENCQLYEHCHRAWYSKKSFLCMLESDGLATCADNRVKFNYVFTTYVWHYCIKFKSSP---NSNFK-----TRKCRKIIDNKNMYIYHTHCGSAPK---YPSLIRECSLNQSMSTIDLEFNESFHCRNRQSFRILDENNEYFENLNWTRVFTGYEIFWLGNVTENNFPISNTSECDIYDSNMNPDEPKKLTIISRKQWYAKKSKGIEDEFPNFPVPFVIITDTERPFCNCYTKEACDFQMRMIQDIL------TP-FLHIPYNFIVTGNGLVYQGKGWIYKNQANTDLYNDKSLSIAFCGRYKNKEPDVVSLNSVKMLINLAIENKKVARNYTIYLLKDISLLNFPSDGLSSVIELWPRYRGHLNFSCDTI 1929
            +C + C+ + +CF  ++   N KC FF+   +  I    ++   WK CD  K       RC G W     +    +I+ N Y + + + T  + C+  C++NP+CG +N  NS +    C  + ++P  N+ +    K     W C  ++     PD   +  R     G WK+ + +   P  +   L+F T  +  CL+ C  Y  C  + YS +   C+LE+   ++      K +++  +Y    C+K  S P   N++ K       KC KI+  + ++I    CG  P    +   I+E   N +++   L  N+++    ++S ++  + +   + +   +++TG + +WL   +++N    +  EC  ++++   ++     I+ R +WYA    G    F N  + F I + +  P+ +C T  AC   +R +Q  L      TP F  IPYNF+V  +G +Y+ +GW Y++ A+  +YN  ++SI + G +K   P++  LNS K LI  A     V ++Y +Y+ +D+ + +   + L   I+ + RYRG L   C TI
Sbjct:   54 ECNFLCLSNSECFATLFY--NRKCSFFNTTDFDVISGQPYEYTKWKSCDTKKGYQPPDGRCEGLW----ITFIHKSIKVNSYTSLDEKFTEEWNCRKLCIENPLCGFVN-RNSGV----CSTIAKWPATNIEITEKRKAQFDKWTCIDDFKDRLQPDGIMIKPRKDKCSGIWKVASRNYTPPKSNFHGLHFQTQIFHDCLKECNEYRECVTSLYSVEYSFCILENIQNSSYMLPSDKMSFIRFSYE---CLKNDSEPPELNADEKRYLDVGMKCNKIVSTEKLFIAKDKCGQFPSISDFAVCIKETGKNLTITDSCL-LNQTYWGLPQESVKLNVKGHIATKRM---KIYTGLQSYWLL-YSKDNLHQVHYLECRHFNASRPVEQLADQEIVDRTKWYALPPNGSLTSFTNKIINFDI-SASFGPYHSCRTIAACTDILRALQVKLHRGAGNTPKFTDIPYNFMVDDSGHIYECRGWHYQS-ASVSMYNYNTISIGYIGWFKFYLPNMNVLNSFKKLIEYADRKGYVEKDYNVYIHQDLGVFSV-HENLVITIKNFYRYRGFLPNDCKTI 601          
BLAST of Peptidoglycan-recognition protein vs. TrEMBL
Match: A0A453YNK2 (Uncharacterized protein OS=Anopheles funestus OX=62324 PE=4 SV=2)

HSP 1 Score: 107.842 bits (268), Expect = 8.620e-21
Identity = 65/195 (33.33%), Postives = 101/195 (51.79%), Query Frame = 1
Query: 1342 ISNTSECDIYDSNMNPDEPKKLTIISRKQWYAKKSKGIEDEFPNFPVPFVIITDTERPFCNCYTKEACDFQMRMIQDI-LTP----FLHIPYNFIVTGNGLVYQGKGWIYKNQANTDLYNDKSLSIAFCGRYKNKEPDVVSLNSVKMLINLAIENKKVARNYTIYLLKDISLLNFPSDGLSSVIELWPRYRGHLN 1911
            I   SE D++     PD PK L +++R +W A+  +G   +    PV  VII  T    C   TK  C +Q+++IQ+    P    F  I Y F+V G+G  Y+G+GW  K  A+T  +N+ S+ IAF G +    P +  L++ K LI L  + K +A NY++Y  + ++    P   L  +I+ WP +  HL 
Sbjct:  237 ILTASEDDLF-----PD-PKPLRLVTRTEWLAQPPRGELTDL-KLPVNLVIIAHTATEGCTTQTK--CMYQVKLIQEFHFDPDSRNFSDIGYQFLVGGDGNAYEGRGWT-KEGAHTKGFNNDSICIAFIGTFIKDPPPIAQLSAAKQLIQLGFQGKYLASNYSLYGHRQLAPFESPGKALYDIIKTWPHWSNHLG 421          
BLAST of Peptidoglycan-recognition protein vs. TrEMBL
Match: A0A453YNH7 (Uncharacterized protein OS=Anopheles funestus OX=62324 PE=4 SV=2)

HSP 1 Score: 107.842 bits (268), Expect = 9.584e-21
Identity = 66/204 (32.35%), Postives = 103/204 (50.49%), Query Frame = 1
Query: 1315 GNVTENNFPISNTSECDIYDSNMNPDEPKKLTIISRKQWYAKKSKGIEDEFPNFPVPFVIITDTERPFCNCYTKEACDFQMRMIQDI-LTP----FLHIPYNFIVTGNGLVYQGKGWIYKNQANTDLYNDKSLSIAFCGRYKNKEPDVVSLNSVKMLINLAIENKKVARNYTIYLLKDISLLNFPSDGLSSVIELWPRYRGHLN 1911
            G+    N P     E D++     PD PK L +++R +W A+  +G   +    PV  VII  T    C   TK  C +Q+++IQ+    P    F  I Y F+V G+G  Y+G+GW  K  A+T  +N+ S+ IAF G +    P +  L++ K LI L  + K +A NY++Y  + ++    P   L  +I+ WP +  HL 
Sbjct:  253 GDDNRPNIPQDKDIEDDLF-----PD-PKPLRLVTRTEWLAQPPRGELTDL-KLPVNLVIIAHTATEGCTTQTK--CMYQVKLIQEFHFDPDSRNFSDIGYQFLVGGDGNAYEGRGWT-KEGAHTKGFNNDSICIAFIGTFIKDPPPIAQLSAAKQLIQLGFQGKYLASNYSLYGHRQLAPFESPGKALYDIIKTWPHWSNHLG 446          
BLAST of Peptidoglycan-recognition protein vs. TrEMBL
Match: A0A2M3Z8Y7 (Putative peptidoglycan recognition protein-lc (Fragment) OS=Anopheles braziliensis OX=58242 PE=4 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 1.220e-20
Identity = 63/206 (30.58%), Postives = 108/206 (52.43%), Query Frame = 1
Query: 1315 GNVTENNFPISNTSECDIYDSNMNPDEPKKLTIISRKQWYAKKSKGIEDEFPNFPVPF--VIITDTERPFCNCYTKEACDFQMRMIQDI-LTP----FLHIPYNFIVTGNGLVYQGKGWIYKNQANTDLYNDKSLSIAFCGRYKNKEPDVVSLNSVKMLINLAIENKKVARNYTIYLLKDISLLNFPSDGLSSVIELWPRYRGHLN 1911
            G+    N P +   E D++     PD PK L +++R +W A+  +   +E  +  +P   VII  T      C T+  C FQ+++IQD  + P    F  I Y F+V G+G  Y+G+GW +K  A+T  +N  S+ IAF G +   +P +  L++ + LI + ++N  +A+NY++Y  + ++    P   L  +I+ WP +   L 
Sbjct:   43 GDDDRQNVPPNKDIEDDLF-----PD-PKPLRLVTRTEWLAQPPR---EELTDLKLPVNNVIIAHTATE--GCTTQSKCMFQVKLIQDFHIEPESRNFSDIAYQFLVGGDGNGYEGRGW-FKQGAHTKGFNVDSICIAFVGTFIKYKPPIAQLSAAQQLIKMGLDNNYIAQNYSLYGHRQLAPFESPGQALYDIIKTWPHWSDKLG 236          
BLAST of Peptidoglycan-recognition protein vs. TrEMBL
Match: A0A0C5PTA0 (Peptidoglycan recognition protein 3 OS=Mytilus galloprovincialis OX=29158 PE=2 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 2.780e-20
Identity = 57/172 (33.14%), Postives = 90/172 (52.33%), Query Frame = 1
Query: 1405 LTIISRKQWYAKKSKGIEDEFPNFPVPFVIITDTERPFCNCYTKEACDFQMRMIQ-----DILTPFLHIPYNFIVTGNGLVYQGKGWIYKNQANTDLYNDKSLSIAFCGRYKNKEPDVVSLNSVKMLINLAIENKKVARNYTIYLLKDISLLNFPSDGLSSVIELWPRYRGH 1905
            + IISR  W A++   I     + PVP   I  TE   C  ++  AC  QM+ IQ     D    +  I Y+F+V  +G +Y+G+GW  +  A+T  YN + L+ +F G +    P+  +LN+VK LI   I   KV+ +Y ++  +D+   + P   L +VI+ WPR+  H
Sbjct:   71 VKIISRDSWGARRPASIST--IHSPVPDFFIHHTEGGACTSFS--ACISQMKGIQNYHMDDANHHWSDIGYSFLVGEDGKIYEGRGW-NRIGAHTQGYNSRGLAASFMGSFMTHSPNSAALNAVKELIQCGISKGKVSHSYALFGHRDVGSTDCPGTALYNVIKTWPRFHAH 237          
BLAST of Peptidoglycan-recognition protein vs. Ensembl Cavefish
Match: pglyrp6 (N-acetylmuramoyl-L-alanine amidase-like [Source:NCBI gene;Acc:111191052])

HSP 1 Score: 69.3218 bits (168), Expect = 9.238e-12
Identity = 45/167 (26.95%), Postives = 77/167 (46.11%), Query Frame = 1
Query: 1411 IISRKQWYAKKSKGIEDEFPNFPVPFVIITDTERPFCNCYTKEACDFQMRMIQ---DILTPFLHIPYNFIVTGNGLVYQGKGWIYKNQANTDLYNDKSLSIAFCGRYKNKEPDVVSLNSVK-MLINLAIENKKVARNYTIYLLKDISLLNFPSDGLSSVIELWPRYR 1899
            I+SR  W A+  KG        P+ ++ I  T  P   C T   C   MR +Q        +  I Y+F+   +G +Y+G+GW ++  A+T  YN K   ++F G Y +  P   +++ V+  L   A    ++  NY I+  + +   + P +   + I  WP +R
Sbjct:  315 IVSRCMWEARPYKGTPTML-KLPLSYLYIHHTYEPSKPCLTFADCSRDMRSMQRYHQDSNGWDDIGYSFVAGSDGNIYEGRGWNWQG-AHTKGYNSKGYGVSFIGDYTSSLPSKSAMDLVRNQLAKCATGGGRLVSNYIIHGHRQLVSTSCPGNAFYTEIRGWPNFR 479          
BLAST of Peptidoglycan-recognition protein vs. Ensembl Cavefish
Match: pglyrp6 (N-acetylmuramoyl-L-alanine amidase-like [Source:NCBI gene;Acc:111191052])

HSP 1 Score: 68.5514 bits (166), Expect = 1.577e-11
Identity = 45/167 (26.95%), Postives = 77/167 (46.11%), Query Frame = 1
Query: 1411 IISRKQWYAKKSKGIEDEFPNFPVPFVIITDTERPFCNCYTKEACDFQMRMIQ---DILTPFLHIPYNFIVTGNGLVYQGKGWIYKNQANTDLYNDKSLSIAFCGRYKNKEPDVVSLNSVK-MLINLAIENKKVARNYTIYLLKDISLLNFPSDGLSSVIELWPRYR 1899
            I+SR  W A+  KG        P+ ++ I  T  P   C T   C   MR +Q        +  I Y+F+   +G +Y+G+GW ++  A+T  YN K   ++F G Y +  P   +++ V+  L   A    ++  NY I+  + +   + P +   + I  WP +R
Sbjct:  310 IVSRCMWEARPYKGTPTML-KLPLSYLYIHHTYEPSKPCLTFADCSRDMRSMQRYHQDSNGWDDIGYSFVAGSDGNIYEGRGWNWQG-AHTKGYNSKGYGVSFIGDYTSSLPSKSAMDLVRNQLAKCATGGGRLVSNYIIHGHRQLVSTSCPGNAFYTEIRGWPNFR 474          
BLAST of Peptidoglycan-recognition protein vs. Ensembl Medaka
Match: pglyrp5 (peptidoglycan-recognition protein SC2-like [Source:NCBI gene;Acc:101158548])

HSP 1 Score: 60.077 bits (144), Expect = 4.347e-10
Identity = 44/163 (26.99%), Postives = 73/163 (44.79%), Query Frame = 1
Query: 1399 KKLTIISRKQWYAKKSKGIEDEFPNFPVPFVIITDTERPFCNCYTKEACDFQMRMIQDI---LTPFLHIPYNFIVTGNGLVYQGKGWIYKNQANTDLYNDKSLSIAFCGRYKNKEPDVVSLNSVKMLINLAIENKKVARNYTIYLLKDISLLNFPSDGLSSVI 1878
            + + ++SR QW A   K  + E        V+I  T     NC         +  IQ +      F  I YNF+V G+G V++G+GW     A+T  +N  SL IAF G + + +    +L SVK L+   +    +   + +   +D++    P D L + +
Sbjct:    3 QTVNVVSRLQWGAAAPK--QKEALKGSAQRVVIHHT--ALQNCRGLADSKEHLVSIQSMHMNQRGFDDIGYNFLVGGDGTVFEGRGWGVVG-AHTKGHNHDSLGIAFMGNFNSDKLSKEALLSVKRLLLFGVSQSYIHPKFVLCGHRDLASTQCPGDNLYAAL 160          
BLAST of Peptidoglycan-recognition protein vs. Ensembl Medaka
Match: ENSORLT00000000385.2 (N-acetylmuramoyl-L-alanine amidase-like [Source:NCBI gene;Acc:101163952])

HSP 1 Score: 61.2326 bits (147), Expect = 3.282e-9
Identity = 44/170 (25.88%), Postives = 76/170 (44.71%), Query Frame = 1
Query: 1411 IISRKQWYAKKSKGIEDEFPNFPVPFVIITDTERPFCNCYTKEACDFQMRMIQDILT---PFLHIPYNFIVTGNGLVYQGKGWIYKNQANTDLYNDKSLSIAFCGRYKNKEPDVVSLNSVK-MLINLAIENKKVARNYTIYLLKDISLLNF---PSDGLSSVIELWPRYR 1899
            II R QW AK  +G      + P+ ++ I  T  P   C +   C   MR +Q        +  I Y+F+V  +G +Y+G+GW Y+   +T  +N     +A  G Y    P   +   ++  L   A++   +A N++I   + +  +N+   P D     I+ W  +R
Sbjct:  315 IIPRCQWGAKPQQGTPVPL-SLPLQYLYIHHTYLPSSPCLSFPNCSRDMRSMQRFHQEDRGWDDIGYSFVVGSDGYIYEGRGWTYRG-THTRGHNSIGYGVAVIGNYTASLPSRHATRLLRDRLAQCAVDGGALAANFSIQGHRQV--VNYTTCPGDAFFGEIKTWEHFR 480          
BLAST of Peptidoglycan-recognition protein vs. Ensembl Medaka
Match: pglyrp6 (peptidoglycan recognition protein 2 [Source:NCBI gene;Acc:101165982])

HSP 1 Score: 59.3066 bits (142), Expect = 1.157e-8
Identity = 42/167 (25.15%), Postives = 74/167 (44.31%), Query Frame = 1
Query: 1411 IISRKQWYAKKSKGIEDEFPNFPVPFVIITDTERPFCNCYTKEACDFQMRMIQDI---LTPFLHIPYNFIVTGNGLVYQGKGWIYKNQANTDLYNDKSLSIAFCGRYKNKEPDVVSLNSVK-MLINLAIENKKVARNYTIYLLKDISLLNFPSDGLSSVIELWPRYR 1899
            II+R  W A    G      + P+ ++ I  T  P   C T E C   MR +Q        +  I Y+F+   +G +Y+G+GW ++  A+T  YN K   ++F G Y +  P   ++  V+  L + A+   ++  +Y +   + +     P +     I  W  Y+
Sbjct:  303 IIARCTWGAAPYIGTPTML-SLPLTYLFIHHTASPSQPCLTFEQCSADMRSMQRFHQQTNGWDDIGYSFVAGSDGNIYEGRGWKWQG-AHTGGYNSKGYGVSFIGDYTSTLPSQHAMALVRDQLASCAVAGGQLVSSYILKGHRQMVSTECPGNIFYKEITTWEHYQ 467          
BLAST of Peptidoglycan-recognition protein vs. Ensembl Medaka
Match: pglyrp6 (peptidoglycan recognition protein 2 [Source:NCBI gene;Acc:101165982])

HSP 1 Score: 59.3066 bits (142), Expect = 1.173e-8
Identity = 42/167 (25.15%), Postives = 74/167 (44.31%), Query Frame = 1
Query: 1411 IISRKQWYAKKSKGIEDEFPNFPVPFVIITDTERPFCNCYTKEACDFQMRMIQDI---LTPFLHIPYNFIVTGNGLVYQGKGWIYKNQANTDLYNDKSLSIAFCGRYKNKEPDVVSLNSVK-MLINLAIENKKVARNYTIYLLKDISLLNFPSDGLSSVIELWPRYR 1899
            II+R  W A    G      + P+ ++ I  T  P   C T E C   MR +Q        +  I Y+F+   +G +Y+G+GW ++  A+T  YN K   ++F G Y +  P   ++  V+  L + A+   ++  +Y +   + +     P +     I  W  Y+
Sbjct:  303 IIARCTWGAAPYIGTPTML-SLPLTYLFIHHTASPSQPCLTFEQCSADMRSMQRFHQQTNGWDDIGYSFVAGSDGNIYEGRGWKWQG-AHTGGYNSKGYGVSFIGDYTSTLPSQHAMALVRDQLASCAVAGGQLVSSYILKGHRQMVSTECPGNIFYKEITTWEHYQ 467          
BLAST of Peptidoglycan-recognition protein vs. Ensembl Medaka
Match: pglyrp6 (peptidoglycan recognition protein 2 [Source:NCBI gene;Acc:101165982])

HSP 1 Score: 58.9214 bits (141), Expect = 1.421e-8
Identity = 42/167 (25.15%), Postives = 74/167 (44.31%), Query Frame = 1
Query: 1411 IISRKQWYAKKSKGIEDEFPNFPVPFVIITDTERPFCNCYTKEACDFQMRMIQDI---LTPFLHIPYNFIVTGNGLVYQGKGWIYKNQANTDLYNDKSLSIAFCGRYKNKEPDVVSLNSVK-MLINLAIENKKVARNYTIYLLKDISLLNFPSDGLSSVIELWPRYR 1899
            II+R  W A    G      + P+ ++ I  T  P   C T E C   MR +Q        +  I Y+F+   +G +Y+G+GW ++  A+T  YN K   ++F G Y +  P   ++  V+  L + A+   ++  +Y +   + +     P +     I  W  Y+
Sbjct:  303 IIARCTWGAAPYIGTPTML-SLPLTYLFIHHTASPSQPCLTFEQCSADMRSMQRFHQQTNGWDDIGYSFVAGSDGNIYEGRGWKWQG-AHTGGYNSKGYGVSFIGDYTSTLPSQHAMALVRDQLASCAVAGGQLVSSYILKGHRQMVSTECPGNIFYKEITTWEHYQ 467          
BLAST of Peptidoglycan-recognition protein vs. Planmine SMEST
Match: SMESG000020172.1 (SMESG000020172.1)

HSP 1 Score: 1681.77 bits (4354), Expect = 0.000e+0
Identity = 844/852 (99.06%), Postives = 849/852 (99.65%), Query Frame = 1
Query:   88 MKISLLLWNFKITIFISILKSCLARKTFDTCIAGHPSKCMGESFGYWHIGYPNADAKLISENRTEISIQCYYDCVYHPKCFMAVYIKSNMKCQFFDKASYIDAYKFDVYLWKCCDVGKTNSVRNRCSGFWKMSYFSISSNTIRNNDYLNENRITNLYQCQNSCLDNPICGAINWENSEIHERLCQQVIQFPVENLWLKSNSKFSTFTWQCALNYTLPAPDTKCVDRAGHTFGYWKIENNSTVIPNDSKILLYFYTYDYKSCLENCQLYEHCHRAWYSKKSFLCMLESDGLATCADNRVKFNYVFTTYVWHYCIKFKSSPNSNFKTRKCRKIIDNKNMYIYHTHCGSAPKYPSLIRECSLNQSMSTIDLEFNESFHCRNRQSFRILDENNEYFENLNWTRVFTGYEIFWLGNVTENNFPISNTSECDIYDSNMNPDEPKKLTIISRKQWYAKKSKGIEDEFPNFPVPFVIITDTERPFCNCYTKEACDFQMRMIQDILTPFLHIPYNFIVTGNGLVYQGKGWIYKNQANTDLYNDKSLSIAFCGRYKNKEPDVVSLNSVKMLINLAIENKKVARNYTIYLLKDISLLNFPSDGLSSVIELWPRYRGHLNFSCDTIRPXXXXXXXXXXXXXXXXXXXXXXXXXKKLYHNKLCSTLRTFKIVSVYIANSDKDQLLLSFINSIPITIFENKNLFVSPFTSSIIWIENKHLFAINENSTYKCLCKKSIFSYIDLVRFQASMFDISIASKMFEIQSCGHSLVFIFEHHLLINNQSVLILHCESLLSAKRCIDLLNRQSCLCCQFTFSIYKPKTTNFKLSHNSVKMSKSTEMTDKSIRSTIEEKYCFMVDNFDSVCFYQ 2643
            MKISLLLWNFKITIFISILKSCLARKTFDTCIAGHPSKCMGESFGYWHIGYPNADAKLISENRTEISIQCYYDCVYHPKCFMAVYIKSNMKCQFFDKASYIDAYKFDVYLWKCCDVGKTNSVRNRCSGFWKMSYFSISSNTIRNNDYLNENRITNLYQCQNSCLDNPICGAINWENSEIHERLCQQVIQFPVENLWLKSNSKFSTFTWQCALNYTLP+PDTKCVDRAGHTFGYWKIENNSTV+PNDSKILLYFYTYDYKSCLENCQLYEHCHRAWYSKKSFLCMLESDGLATCADNRVKFNYVFTTYVWHYCIKFKSS NSNFKTRKCRKIIDNKNMYIYHTHCGSAPKYPSLIRECSLNQSMSTIDLEFNESFHCRNRQSFRILDENNEYFENLNWTRVFTGYEIFWLGNVTENNFPISN SECDIYDSNMNPDEPKKLTIISRKQWYAKKSKGIEDEFPNFPVPFVIITDTERPFCNCYTKEACDFQMRM QDILTPFLHIP+NFIVTGNGLVYQGKGWIYKNQANTDLYNDKSLSIAFCGRYKNKEPDVVSLNSVKMLINLAIENKKVARNYTIYLLKDISLLNFPSDGLSSVIELWPRYRGHLNFSCDTIRPLIISLNIIAFIIISFIFAILHHFLFKKLYHNKLCSTLRTFKIVSVYIANSDKDQLLLSFINSIPITIFENKNLFVSPFTSSIIWIENKHLFAINENSTYKCLCKKSIFSYIDLVRFQASMFDISIASKMFEI+SCGHSLVFIFEHHLLINNQSVLILHCESLLSAKRCIDLLNRQSCLCCQFTFSIYKPKTTNFKLSHNSVKMSKSTEMTDKSIRSTIEEKYCFM+DNFDSVCFYQ
Sbjct:    1 MKISLLLWNFKITIFISILKSCLARKTFDTCIAGHPSKCMGESFGYWHIGYPNADAKLISENRTEISIQCYYDCVYHPKCFMAVYIKSNMKCQFFDKASYIDAYKFDVYLWKCCDVGKTNSVRNRCSGFWKMSYFSISSNTIRNNDYLNENRITNLYQCQNSCLDNPICGAINWENSEIHERLCQQVIQFPVENLWLKSNSKFSTFTWQCALNYTLPSPDTKCVDRAGHTFGYWKIENNSTVMPNDSKILLYFYTYDYKSCLENCQLYEHCHRAWYSKKSFLCMLESDGLATCADNRVKFNYVFTTYVWHYCIKFKSSLNSNFKTRKCRKIIDNKNMYIYHTHCGSAPKYPSLIRECSLNQSMSTIDLEFNESFHCRNRQSFRILDENNEYFENLNWTRVFTGYEIFWLGNVTENNFPISNPSECDIYDSNMNPDEPKKLTIISRKQWYAKKSKGIEDEFPNFPVPFVIITDTERPFCNCYTKEACDFQMRMTQDILTPFLHIPFNFIVTGNGLVYQGKGWIYKNQANTDLYNDKSLSIAFCGRYKNKEPDVVSLNSVKMLINLAIENKKVARNYTIYLLKDISLLNFPSDGLSSVIELWPRYRGHLNFSCDTIRPLIISLNIIAFIIISFIFAILHHFLFKKLYHNKLCSTLRTFKIVSVYIANSDKDQLLLSFINSIPITIFENKNLFVSPFTSSIIWIENKHLFAINENSTYKCLCKKSIFSYIDLVRFQASMFDISIASKMFEIRSCGHSLVFIFEHHLLINNQSVLILHCESLLSAKRCIDLLNRQSCLCCQFTFSIYKPKTTNFKLSHNSVKMSKSTEMTDKSIRSTIEEKYCFMMDNFDSVCFYQ 852          
BLAST of Peptidoglycan-recognition protein vs. Planmine SMEST
Match: SMESG000028122.1 (SMESG000028122.1)

HSP 1 Score: 180.259 bits (456), Expect = 9.369e-47
Identity = 167/648 (25.77%), Postives = 293/648 (45.22%), Query Frame = 1
Query:  106 LWNFKITIFISILKSCLARKTFDTCIAGHPSKCMGESFGYWHIGYPNADAKLISENRTEISIQ---CYYDCVYHPKCFMAVYIKSNMKCQFFDKASYIDAY--KFDVYLWKCCDVGKTNSVRNRCSGFWKMSYFSISSNTIRNNDYLNENRI----TNLYQCQNSCLDNPICGAINWENSEIHERLCQQVIQFPVENLWLKSNSKFSTFTWQCALNYTL----PAPDTKCVDRAGHTFGYWKIENNSTVIPNDSKILLYFYTYDYKSCLENCQLYEHCHRAWYSKKSFLCMLESDGLATCADNRVKF-NYVFTTYVWHYCIKFKSS--PNSNFKTR------KCRKIIDNKNMYIYHTHCGSAPKYPSLIRECSLNQSMSTIDLEFNESFHCRNRQSFRI-------LDENNEYFENLNWTRVFTGYEIFWL----GNVTENNFPISNTSECDIYDSNMNPDEPKKLTIISRKQWYAKKSKGIEDEFPNFPVPFVIITDTERPFCNCYTKEACDFQMRMIQDIL-------TPFLHIPYNFIVTGNGLVYQGKGWIYKNQANTDLYNDKSLSIAFCGRYKNKEPDVVSLNSVKMLINLAIENKKVARNYTIYLLKDISLLNFPSDGLSSVIELWPRYRGHLNFSCDTI 1929
             W F +T+    + S L+      C+   P+K  G      +I       + I+   +E S     C   C  +  C+   ++  N  C F++   +  ++    +   W  C +        RC G++ ++Y        +   +  EN +     N + C+  CL NP CG IN     + E  CQ + ++PV+NL  ++ S+F    W C  +Y +    P  ++K +D      GYWK+ + +T I  D    L F T  + +CL+ C LY HCH AW+S     C+L+       +D  + F N  F  + W  C+K  S   P +  + R      KC  I + +N+YI    CG  P     +   S N ++   +  ++    C   QS+         ++      +NL   +VFTG +I+W+    G+++E N+      +C  ++++   +   K  II++  WY++   G    F   P   ++IT +++P  +C TK AC   +R +Q++          F  IPYNF++   G +Y+ +GW Y   A    YND ++ + + G + +K P+   LNSVK  I+ A++N+ +  +Y +++ +D++ +    + L  VI+   RYRG L   C  I
Sbjct:    5 FWPFVLTLISISIVSVLSNIISQQCLYATPNKSPGV-----YIDDTGKAVENITSFYSEPSKDRNDCKSKCRINDNCYAISFL--NKICSFYNTNKFTVSHISNIEYSWWNACGIV-YQPEDGRCKGYY-LTYID------KELSFSKENHLRSFSANYFFCRIECLKNPFCGYIN----RVKET-CQLISRWPVQNLKTENRSEFELDVWTCVDDYIIKLEPPNENSKPIDEK--CTGYWKVTDRNTTITKDQSKGLNFQTQAFINCLKECNLYPHCHTAWFSLNYSTCILKD---IEPSDEHLPFDNMEFIEFEW-ICVKNDSQNKPLNEDEKRYDTLEMKCYTINNYENLYIGLDECGRCPHKSKFV---SCNHTIPESNKHWHIKDSCLINQSYWAFPPTKTNMNIGRSTLQNL--IKVFTGLQIYWIVFSDGDISEANY-----LQCRHFNASRPSEILYKSDIITKNDWYSRPPNGELKLFSGTPKQ-ILITASQQPLHSCRTKAACMDILRSLQEVYFHGSGTSGNFSDIPYNFMIDDLGHIYECRGWKYACAA-VYPYNDVTICLGYIGWFAHKYPNEQYLNSVKKFIDFAVKNEYIKSDYELFIHQDLTTVKIHRN-LKIVIKNLYRYRGFLPEKCSNI 613          
BLAST of Peptidoglycan-recognition protein vs. Planmine SMEST
Match: SMESG000081052.1 (SMESG000081052.1)

HSP 1 Score: 176.022 bits (445), Expect = 2.805e-45
Identity = 165/648 (25.46%), Postives = 292/648 (45.06%), Query Frame = 1
Query:  106 LWNFKITIFISILKSCLARKTFDTCIAGHPSKCMGESFGYWHIGYPNADAKLISENRTEISIQ---CYYDCVYHPKCFMAVYIKSNMKCQFFDKASYIDAY--KFDVYLWKCCDVGKTNSVRNRCSGFWKMSYFSISSNTIRNNDYLNENRI----TNLYQCQNSCLDNPICGAINWENSEIHERLCQQVIQFPVENLWLKSNSKFSTFTWQCALNYTL----PAPDTKCVDRAGHTFGYWKIENNSTVIPNDSKILLYFYTYDYKSCLENCQLYEHCHRAWYSKKSFLCMLESDGLATCADNRVKF-NYVFTTYVWHYCIKFKSS--PNSNFKTR------KCRKIIDNKNMYIYHTHCGSAPKYPSLIRECSLNQSMSTIDLEFNESFHCRNRQSFRI-------LDENNEYFENLNWTRVFTGYEIFWL----GNVTENNFPISNTSECDIYDSNMNPDEPKKLTIISRKQWYAKKSKGIEDEFPNFPVPFVIITDTERPFCNCYTKEACDFQMRMIQDIL-------TPFLHIPYNFIVTGNGLVYQGKGWIYKNQANTDLYNDKSLSIAFCGRYKNKEPDVVSLNSVKMLINLAIENKKVARNYTIYLLKDISLLNFPSDGLSSVIELWPRYRGHLNFSCDTI 1929
             W F +T+    + S L+      C+   P+K  G      +I       + I+   +E S     C   C  +  C+   ++  N  C F++   +  ++    +   W  C +        RC G++ ++Y        +   +  EN +     N + C+  CL NP CG IN     + E  CQ + ++PV+N+  ++ S+F    W C  +Y +    P  ++K +D      GYWK+ + +T I  D    L F T  + +CL+ C LY +CH AW+S     C+L+       +D  + F N  F  + W  C+K  S   P +  + R      KC  I +  N+YI    CG  P     +   S N ++   +  ++    C   QS+         ++      +NL   +VFTG +I+W+    G+++E N+      +C  ++++   +   K  II++  WY++   G    F   P   ++IT +++P  +C TK AC   +R +Q++          F  IPYNF++   G +Y+ +GW Y   A    YND ++ + + G + +K P+   LNSVK  I+ A++N+ +  +Y +++ +D++ +    + L  VI+   RYRG L   C  I
Sbjct:   41 FWPFVLTLISISIVSVLSNIISQQCLYATPNKSPGV-----YIDDTGKAVENITSFYSEPSKDRNDCKSKCRINDNCYAISFL--NKICSFYNTNKFTVSHISNIEYSWWNACGI-VYQPEDGRCKGYY-LTYID------KELSFSKENHLRSFSANYFFCRIECLKNPFCGYIN----RVKET-CQLISRWPVQNIKTENRSEFELDVWTCVDDYIIKLEPPNENSKPIDEK--CTGYWKVTDRNTTITKDQSKGLNFQTQAFINCLKECNLYPNCHTAWFSLNYSTCILKD---IEPSDEHLPFDNMEFIEFEW-ICVKNDSQNKPLNEDEKRYDTLEMKCYTINNYDNLYIGLDECGRCPHKSKFV---SCNHTIPESNKHWHIKDSCLINQSYWAFPPTKTNMNIGRSTLQNL--IKVFTGLQIYWIVFSDGDISEANY-----LQCRHFNASRPSEILYKSDIITKNDWYSRPPNGELKLFSGTPKQ-ILITASQQPLHSCRTKAACMDILRSLQEVYFHGSGTSGNFSDIPYNFMIDDLGHIYECRGWKYACAA-VYPYNDVTICLGYIGWFAHKYPNEQYLNSVKKFIDFAVKNEYIKSDYELFIHQDLTTVKIHRN-LKIVIKNLYRYRGFLPEKCSNI 649          
BLAST of Peptidoglycan-recognition protein vs. Planmine SMEST
Match: SMESG000081052.1 (SMESG000081052.1)

HSP 1 Score: 176.022 bits (445), Expect = 3.970e-45
Identity = 165/648 (25.46%), Postives = 292/648 (45.06%), Query Frame = 1
Query:  106 LWNFKITIFISILKSCLARKTFDTCIAGHPSKCMGESFGYWHIGYPNADAKLISENRTEISIQ---CYYDCVYHPKCFMAVYIKSNMKCQFFDKASYIDAY--KFDVYLWKCCDVGKTNSVRNRCSGFWKMSYFSISSNTIRNNDYLNENRI----TNLYQCQNSCLDNPICGAINWENSEIHERLCQQVIQFPVENLWLKSNSKFSTFTWQCALNYTL----PAPDTKCVDRAGHTFGYWKIENNSTVIPNDSKILLYFYTYDYKSCLENCQLYEHCHRAWYSKKSFLCMLESDGLATCADNRVKF-NYVFTTYVWHYCIKFKSS--PNSNFKTR------KCRKIIDNKNMYIYHTHCGSAPKYPSLIRECSLNQSMSTIDLEFNESFHCRNRQSFRI-------LDENNEYFENLNWTRVFTGYEIFWL----GNVTENNFPISNTSECDIYDSNMNPDEPKKLTIISRKQWYAKKSKGIEDEFPNFPVPFVIITDTERPFCNCYTKEACDFQMRMIQDIL-------TPFLHIPYNFIVTGNGLVYQGKGWIYKNQANTDLYNDKSLSIAFCGRYKNKEPDVVSLNSVKMLINLAIENKKVARNYTIYLLKDISLLNFPSDGLSSVIELWPRYRGHLNFSCDTI 1929
             W F +T+    + S L+      C+   P+K  G      +I       + I+   +E S     C   C  +  C+   ++  N  C F++   +  ++    +   W  C +        RC G++ ++Y        +   +  EN +     N + C+  CL NP CG IN     + E  CQ + ++PV+N+  ++ S+F    W C  +Y +    P  ++K +D      GYWK+ + +T I  D    L F T  + +CL+ C LY +CH AW+S     C+L+       +D  + F N  F  + W  C+K  S   P +  + R      KC  I +  N+YI    CG  P     +   S N ++   +  ++    C   QS+         ++      +NL   +VFTG +I+W+    G+++E N+      +C  ++++   +   K  II++  WY++   G    F   P   ++IT +++P  +C TK AC   +R +Q++          F  IPYNF++   G +Y+ +GW Y   A    YND ++ + + G + +K P+   LNSVK  I+ A++N+ +  +Y +++ +D++ +    + L  VI+   RYRG L   C  I
Sbjct:   41 FWPFVLTLISISIVSVLSNIISQQCLYATPNKSPGV-----YIDDTGKAVENITSFYSEPSKDRNDCKSKCRINDNCYAISFL--NKICSFYNTNKFTVSHISNIEYSWWNACGIVYQPE-DGRCKGYY-LTYID------KELSFSKENHLRSFSANYFFCRIECLKNPFCGYIN----RVKET-CQLISRWPVQNIKTENRSEFELDVWTCVDDYIIKLEPPNENSKPIDEK--CTGYWKVTDRNTTITKDQSKGLNFQTQAFINCLKECNLYPNCHTAWFSLNYSTCILKD---IEPSDEHLPFDNMEFIEFEW-ICVKNDSQNKPLNEDEKRYDTLEMKCYTINNYDNLYIGLDECGRCPHKSKFV---SCNHTIPESNKHWHIKDSCLINQSYWAFPPTKTNMNIGRSTLQNL--IKVFTGLQIYWIVFSDGDISEANY-----LQCRHFNASRPSEILYKSDIITKNDWYSRPPNGELKLFSGTPKQ-ILITASQQPLHSCRTKAACMDILRSLQEVYFHGSGTSGNFSDIPYNFMIDDLGHIYECRGWKYACAA-VYPYNDVTICLGYIGWFAHKYPNEQYLNSVKKFIDFAVKNEYIKSDYELFIHQDLTTVKIHRN-LKIVIKNLYRYRGFLPEKCSNI 649          
BLAST of Peptidoglycan-recognition protein vs. Planmine SMEST
Match: SMESG000063454.1 (SMESG000063454.1)

HSP 1 Score: 174.481 bits (441), Expect = 7.827e-45
Identity = 148/570 (25.96%), Postives = 271/570 (47.54%), Query Frame = 1
Query:  292 QCYYDCVYHPKCFMAVYIKSNMKCQFFDKASY--IDAYKFDVYLWKCCDVGKT-NSVRNRCSGFWKMSYFSISSNTIRNNDYLN-ENRITNLYQCQNSCLDNPICGAINWENSEIHERLCQQVIQFPVENLWLKSNSKFSTFTWQCALNYT-LPAPDTKCVD-RAGHTFGYWKIENNSTVIPNDSKILLYFYTYDYKSCLENCQLYEHCHRAWYSKKSFLCMLESDGLATCADNRVKFNYVFTTYVWHYCIKFKSSP---NSNFK-----TRKCRKIIDNKNMYIYHTHCGSAPK---YPSLIRECSLNQSMSTIDLEFNESFHCRNRQSFRILDENNEYFENLNWTRVFTGYEIFWLGNVTENNFPISNTSECDIYDSNMNPDEPKKLTIISRKQWYAKKSKGIEDEFPNFPVPFVIITDTERPFCNCYTKEACDFQMRMIQDIL------TP-FLHIPYNFIVTGNGLVYQGKGWIYKNQANTDLYNDKSLSIAFCGRYKNKEPDVVSLNSVKMLINLAIENKKVARNYTIYLLKDISLLNFPSDGLSSVIELWPRYRGHLNFSCDTI 1929
            +C + C+ + +CF  ++   N KC FF+   +  I+   ++   WK CD  K       RC G W     +    +I+ N Y + + + T  + C+  C++NP+CG +N  NS +    C  + ++P  N+ +    K     W C  ++     PD   +  R     G WK+ + +   P  +   L+F T  +  CL+ C  Y  C  + YS +   C+LE+   ++      K +++  +Y    C+K  S P   N++ K       KC KI+  + ++I    CG  P    +   I+E   N +++   L  N+++    ++S ++  + +   + +   +++TG + +WL   +++N    +  EC  ++++   ++     I+ R +WYA    G    F N  + F I + +  P+ +C T  AC   +R +Q  L      TP F  IPYNF+V  +G +Y+ +GW Y++ A+  +YN  ++SI + G +K   P++  LNS K LI  A     V ++Y +Y+ +D+ + +   + L   I+ + RYRG L   C TI
Sbjct:   62 ECNFLCLSNSECFATLFY--NRKCSFFNTTDFDVINGQPYEYTKWKSCDTKKGYQPPDGRCEGLW----ITFIHKSIKVNSYTSLDEKFTEEWNCRKLCIENPLCGFVN-RNSGV----CSTIAKWPATNIEITEKRKAQFDKWTCIDDFKDRLQPDGIMIKPRKDKCSGIWKVASRNYTPPKSNFHGLHFQTQIFHDCLKECNEYRECVTSLYSVEYSFCILENIQNSSYMLPSDKMSFIRFSYE---CLKNDSEPPELNADEKRYLDVGMKCNKIVSTEKLFIAKDKCGQFPSISDFAVCIKETGKNLTITDSCL-LNQTYWGLPQESVKLNVKGHIATKRM---KIYTGLQSYWLL-YSKDNLHQVHYLECRHFNASRPVEQLADQEIVDRTKWYALPPNGSLTSFTNKIINFDI-SASFGPYHSCRTIAACTDILRALQVKLHRGAGNTPKFTDIPYNFMVDDSGHIYECRGWHYQS-ASVSMYNYNTISIGYIGWFKFYLPNMNVLNSFKKLIEYADRKGYVEKDYNVYIHQDLGVFSV-HENLVITIKNFYRYRGFLPNDCKTI 609          
The following BLAST results are available for this feature:
BLAST of Peptidoglycan-recognition protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PGLYRP16.740e-1827.11peptidoglycan recognition protein 1 [Source:HGNC S... [more]
PGLYRP32.745e-1430.73peptidoglycan recognition protein 3 [Source:HGNC S... [more]
PGLYRP46.342e-1227.38peptidoglycan recognition protein 4 [Source:HGNC S... [more]
PGLYRP47.383e-1227.38peptidoglycan recognition protein 4 [Source:HGNC S... [more]
PGLYRP25.636e-824.55peptidoglycan recognition protein 2 [Source:HGNC S... [more]
back to top
BLAST of Peptidoglycan-recognition protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidoglycan-recognition protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PGRP-LC2.729e-2027.96gene:FBgn0035976 transcript:FBtr0300291[more]
PGRP-LC3.067e-1827.96gene:FBgn0035976 transcript:FBtr0300290[more]
PGRP-LC3.067e-1827.96gene:FBgn0035976 transcript:FBtr0089490[more]
PGRP-LC1.117e-1730.72gene:FBgn0035976 transcript:FBtr0472540[more]
PGRP-SB11.302e-1732.16gene:FBgn0043578 transcript:FBtr0075348[more]
back to top
BLAST of Peptidoglycan-recognition protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pglyrp65.271e-1327.00peptidoglycan recognition protein 6 [Source:ZFIN;A... [more]
pglyrp21.083e-926.04peptidoglycan recognition protein 2 [Source:ZFIN;A... [more]
pglyrp51.180e-728.57peptidoglycan recognition protein 5 [Source:ZFIN;A... [more]
pglyrp51.180e-728.57peptidoglycan recognition protein 5 [Source:ZFIN;A... [more]
pglyrp25.259e-725.37peptidoglycan recognition protein 2 [Source:ZFIN;A... [more]
back to top
BLAST of Peptidoglycan-recognition protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pglyrp1-like.14.202e-1631.14pglyrp1 protein [Source:NCBI gene;Acc:595014][more]
cnn24.979e-1526.35calponin 2 [Source:Xenbase;Acc:XB-GENE-1005289][more]
cnn24.301e-1326.79calponin 2 [Source:Xenbase;Acc:XB-GENE-1005289][more]
pglyrp24.892e-1028.57peptidoglycan recognition protein 2 [Source:NCBI g... [more]
pglyrp24.892e-1028.57peptidoglycan recognition protein 2 [Source:NCBI g... [more]
back to top
BLAST of Peptidoglycan-recognition protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pglyrp32.481e-1531.79peptidoglycan recognition protein 3 [Source:MGI Sy... [more]
Pglyrp13.063e-1528.31peptidoglycan recognition protein 1 [Source:MGI Sy... [more]
Pglyrp43.431e-1431.14peptidoglycan recognition protein 4 [Source:MGI Sy... [more]
Pglyrp43.691e-1431.14peptidoglycan recognition protein 4 [Source:MGI Sy... [more]
Pglyrp26.015e-1327.54peptidoglycan recognition protein 2 [Source:MGI Sy... [more]
back to top
BLAST of Peptidoglycan-recognition protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O75594|PGRP1_HUMAN3.237e-1727.11Peptidoglycan recognition protein 1 OS=Homo sapien... [more]
sp|Q9GK12|PGRP1_CAMDR9.539e-1728.32Peptidoglycan recognition protein 1 OS=Camelus dro... [more]
sp|Q70PY2|PGSB1_DROME1.306e-1632.16Peptidoglycan-recognition protein SB1 OS=Drosophil... [more]
sp|B5T255|PGRP1_BOSIN2.579e-1627.54Peptidoglycan recognition protein 1 OS=Bos indicus... [more]
sp|Q8SXQ7|PGPLF_DROME2.789e-1627.81Peptidoglycan-recognition protein LF OS=Drosophila... [more]
back to top
BLAST of Peptidoglycan-recognition protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZIL35.549e-4125.96Peptidoglycan recognition protein-1 OS=Schmidtea m... [more]
A0A453YNK28.620e-2133.33Uncharacterized protein OS=Anopheles funestus OX=6... [more]
A0A453YNH79.584e-2132.35Uncharacterized protein OS=Anopheles funestus OX=6... [more]
A0A2M3Z8Y71.220e-2030.58Putative peptidoglycan recognition protein-lc (Fra... [more]
A0A0C5PTA02.780e-2033.14Peptidoglycan recognition protein 3 OS=Mytilus gal... [more]
back to top
BLAST of Peptidoglycan-recognition protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pglyrp69.238e-1226.95N-acetylmuramoyl-L-alanine amidase-like [Source:NC... [more]
pglyrp61.577e-1126.95N-acetylmuramoyl-L-alanine amidase-like [Source:NC... [more]
back to top
BLAST of Peptidoglycan-recognition protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidoglycan-recognition protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidoglycan-recognition protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidoglycan-recognition protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pglyrp54.347e-1026.99peptidoglycan-recognition protein SC2-like [Source... [more]
ENSORLT00000000385.23.282e-925.88N-acetylmuramoyl-L-alanine amidase-like [Source:NC... [more]
pglyrp61.157e-825.15peptidoglycan recognition protein 2 [Source:NCBI g... [more]
pglyrp61.173e-825.15peptidoglycan recognition protein 2 [Source:NCBI g... [more]
pglyrp61.421e-825.15peptidoglycan recognition protein 2 [Source:NCBI g... [more]
back to top
BLAST of Peptidoglycan-recognition protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000020172.10.000e+099.06SMESG000020172.1[more]
SMESG000028122.19.369e-4725.77SMESG000028122.1[more]
SMESG000081052.12.805e-4525.46SMESG000081052.1[more]
SMESG000081052.13.970e-4525.46SMESG000081052.1[more]
SMESG000063454.17.827e-4525.96SMESG000063454.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031777 ID=SMED30031777|Name=Peptidoglycan-recognition protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2671bp
ATCGATCACAAAATGCTGCGATTTTGATTTGGTTTGCTAGCCATTTTTTG
TAACAATCTATAATATTGTCTTGATCAAAATATTCGCATGAAAATCAGCC
TGCTATTATGGAATTTTAAAATCACGATTTTCATATCTATTTTGAAATCA
TGCCTTGCTAGAAAAACCTTTGATACGTGCATCGCAGGCCATCCATCTAA
ATGCATGGGAGAATCATTTGGTTACTGGCATATTGGATATCCGAATGCCG
ATGCTAAATTGATATCAGAGAATCGAACAGAAATAAGTATTCAGTGCTAT
TATGACTGCGTTTATCATCCAAAATGTTTCATGGCCGTTTATATCAAGAG
CAACATGAAATGTCAGTTTTTCGACAAAGCCAGTTACATTGATGCTTACA
AATTCGACGTCTACCTTTGGAAATGTTGTGATGTGGGAAAAACAAATTCA
GTTAGAAATCGCTGTTCGGGATTCTGGAAAATGAGTTACTTTTCGATTTC
CTCAAATACAATTCGCAACAATGATTATTTGAATGAAAATCGAATTACGA
ATTTGTATCAGTGTCAAAACTCATGTTTGGATAATCCGATTTGTGGAGCA
ATAAATTGGGAAAATTCTGAAATACACGAAAGATTATGTCAACAAGTGAT
TCAGTTTCCGGTTGAGAATTTGTGGTTGAAATCAAATTCGAAATTTTCGA
CTTTTACTTGGCAATGTGCTTTGAACTATACTTTGCCGGCTCCCGATACG
AAATGTGTTGATAGAGCCGGGCATACTTTTGGTTATTGGAAAATTGAAAA
CAATTCAACAGTCATTCCAAATGATTCGAAGATTTTACTTTACTTCTACA
CTTATGACTATAAATCTTGTTTGGAAAATTGCCAGCTTTATGAACATTGT
CATCGAGCATGGTATAGCAAGAAGAGCTTTTTGTGCATGTTGGAATCAGA
TGGTTTAGCGACCTGCGCTGATAATCGAGTAAAATTTAACTATGTCTTCA
CAACCTACGTTTGGCACTATTGCATCAAATTTAAATCATCACCGAATTCA
AATTTTAAAACGAGAAAATGCCGAAAGATTATTGACAATAAAAATATGTA
CATTTATCATACGCATTGCGGTTCCGCTCCAAAATATCCTTCACTTATTC
GAGAATGTTCTCTTAATCAATCAATGAGCACTATTGATTTAGAATTCAAC
GAAAGTTTTCATTGTCGCAATAGGCAGTCGTTTCGAATTTTGGATGAAAA
CAACGAATATTTTGAAAATTTAAATTGGACACGAGTCTTTACTGGGTATG
AAATCTTTTGGTTGGGTAATGTCACTGAAAACAATTTCCCTATATCTAAT
ACATCGGAGTGTGACATCTATGATTCAAATATGAATCCAGATGAGCCGAA
AAAATTGACAATTATTTCAAGAAAACAGTGGTACGCTAAAAAAAGTAAAG
GTATTGAAGATGAATTCCCTAATTTCCCAGTTCCATTTGTAATTATAACC
GATACTGAAAGGCCCTTTTGCAATTGTTATACAAAGGAAGCTTGTGACTT
TCAAATGAGAATGATTCAAGATATATTAACGCCATTTCTGCATATTCCTT
ATAATTTTATTGTTACCGGAAATGGACTAGTTTACCAAGGAAAAGGTTGG
ATTTACAAAAACCAAGCTAACACGGACCTTTACAATGATAAATCCCTAAG
TATTGCGTTTTGCGGTAGGTACAAAAATAAAGAACCAGATGTAGTAAGTT
TAAATTCAGTAAAAATGCTGATAAATCTAGCGATAGAAAACAAAAAAGTT
GCCAGAAATTACACAATTTATTTATTGAAAGATATAAGCCTTTTAAATTT
TCCATCTGACGGCCTGAGCTCCGTCATAGAACTGTGGCCTCGTTATAGAG
GGCACCTGAATTTTAGTTGTGATACAATACGGCCGCTGATTATTTCCCTC
AATATTATTGCTTTTATTATAATTTCTTTTATTTTTGCAATTTTACATCA
TTTCTTGTTTAAAAAATTATATCATAATAAATTATGTTCAACATTGAGAA
CATTTAAAATCGTAAGTGTTTACATTGCTAATTCAGATAAAGACCAACTC
CTTTTATCTTTTATTAATTCCATTCCAATAACAATCTTTGAAAATAAAAA
CTTGTTTGTTTCTCCTTTTACGTCCTCTATAATCTGGATAGAAAATAAAC
ATTTATTCGCAATCAATGAAAACTCTACTTATAAATGTTTATGTAAAAAG
TCAATATTTTCTTATATAGATCTGGTGAGATTTCAGGCTTCGATGTTTGA
CATTAGCATTGCATCAAAGATGTTTGAAATTCAAAGCTGCGGTCATTCGC
TGGTATTTATTTTTGAGCATCATTTGTTGATCAATAATCAGAGCGTATTG
ATTTTACACTGCGAATCTTTATTGTCTGCTAAAAGATGTATTGACTTGCT
GAATAGACAGTCATGCCTCTGTTGTCAGTTTACATTTTCTATTTACAAAC
CGAAAACAACAAATTTCAAGTTATCCCATAATTCTGTGAAAATGTCAAAA
TCTACTGAAATGACAGACAAATCAATCCGATCAACGATTGAGGAGAAATA
TTGTTTTATGGTGGATAATTTTGATAGTGTTTGTTTTTATCAGTAGATTT
TTTGATATATTTCCAATGCTG
back to top

protein sequence of SMED30031777-orf-1

>SMED30031777-orf-1 ID=SMED30031777-orf-1|Name=SMED30031777-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=853bp
MKISLLLWNFKITIFISILKSCLARKTFDTCIAGHPSKCMGESFGYWHIG
YPNADAKLISENRTEISIQCYYDCVYHPKCFMAVYIKSNMKCQFFDKASY
IDAYKFDVYLWKCCDVGKTNSVRNRCSGFWKMSYFSISSNTIRNNDYLNE
NRITNLYQCQNSCLDNPICGAINWENSEIHERLCQQVIQFPVENLWLKSN
SKFSTFTWQCALNYTLPAPDTKCVDRAGHTFGYWKIENNSTVIPNDSKIL
LYFYTYDYKSCLENCQLYEHCHRAWYSKKSFLCMLESDGLATCADNRVKF
NYVFTTYVWHYCIKFKSSPNSNFKTRKCRKIIDNKNMYIYHTHCGSAPKY
PSLIRECSLNQSMSTIDLEFNESFHCRNRQSFRILDENNEYFENLNWTRV
FTGYEIFWLGNVTENNFPISNTSECDIYDSNMNPDEPKKLTIISRKQWYA
KKSKGIEDEFPNFPVPFVIITDTERPFCNCYTKEACDFQMRMIQDILTPF
LHIPYNFIVTGNGLVYQGKGWIYKNQANTDLYNDKSLSIAFCGRYKNKEP
DVVSLNSVKMLINLAIENKKVARNYTIYLLKDISLLNFPSDGLSSVIELW
PRYRGHLNFSCDTIRPLIISLNIIAFIIISFIFAILHHFLFKKLYHNKLC
STLRTFKIVSVYIANSDKDQLLLSFINSIPITIFENKNLFVSPFTSSIIW
IENKHLFAINENSTYKCLCKKSIFSYIDLVRFQASMFDISIASKMFEIQS
CGHSLVFIFEHHLLINNQSVLILHCESLLSAKRCIDLLNRQSCLCCQFTF
SIYKPKTTNFKLSHNSVKMSKSTEMTDKSIRSTIEEKYCFMVDNFDSVCF
YQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0002376immune system process
GO:0045087innate immune response
GO:0009253peptidoglycan catabolic process
Vocabulary: molecular function
TermDefinition
GO:0042834peptidoglycan binding
GO:0008745N-acetylmuramoyl-L-alanine amidase activity
GO:0008270zinc ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
Vocabulary: INTERPRO
TermDefinition
IPR036505Amidase/PGRP_sf
IPR015510PGRP
IPR006619PGRP_domain_met/bac
IPR002502Amidase_domain
IPR003609Pan_app
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006619Peptidoglycan recognition protein family domain, metazoa/bacteriaSMARTSM00701pgrpcoord: 440..584
e-value: 7.6E-14
score: 62.0
IPR036505N-acetylmuramoyl-L-alanine amidase/PGRP domain superfamilyGENE3DG3DSA:3.40.80.10coord: 435..586
e-value: 1.6E-26
score: 94.8
IPR036505N-acetylmuramoyl-L-alanine amidase/PGRP domain superfamilySUPERFAMILYSSF55846N-acetylmuramoyl-L-alanine amidase-likecoord: 440..607
IPR015510Peptidoglycan recognition proteinPANTHERPTHR11022PEPTIDOGLYCAN RECOGNITION PROTEINcoord: 435..607
NoneNo IPR availablePANTHERPTHR11022:SF67PEPTIDOGLYCAN-RECOGNITION PROTEIN LB-RELATEDcoord: 435..607
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..24
score: 0.752
NoneNo IPR availableTMHMMTMhelixcoord: 618..640
IPR003609PAN/Apple domainPROSITEPS50948PANcoord: 126..210
score: 7.509
IPR003609PAN/Apple domainPROSITEPS50948PANcoord: 223..312
score: 5.862
IPR002502N-acetylmuramoyl-L-alanine amidase domainCDDcd06583PGRPcoord: 464..584
e-value: 7.72929E-16
score: 72.7066