Msh2

Overview
NameMsh2 (AEK64794.1)
Smed IDSMED30031773
Length (bp)2701
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Msh2 (SMED30031773) t-SNE clustered cells

Violin plots show distribution of expression levels for Msh2 (SMED30031773) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Msh2 (SMED30031773) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Msh2 (SMED30031773) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031773

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 19

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30031773SMESG000016751.1 SmedASXL_013478SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
protonephridiaSMED30031773SMESG000016751.1 dd_Smed_v4_11434_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30031773SMESG000016751.1 dd_Smed_v4_11434_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30031773SMESG000016751.1 dd_Smed_v4_11434_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031773SMESG000016752.1 SMESG000016751.1 SMESG000016749.1 Contig49435newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031773SMESG000016752.1 SMESG000016751.1 SMESG000016749.1 Contig49435uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031773SMESG000016752.1 SMESG000016751.1 SMESG000016750.1 SMESG000016749.1 SMESG000016748.1 Contig17129newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031773SMESG000016752.1 SMESG000016751.1 SMESG000016750.1 SMESG000016749.1 SMESG000016748.1 Contig17129uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
parapharyngeal regionSMED30031773SMESG000016751.1 dd_Smed_v6_11434_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30031773SMESG000016752.1 SMESG000016751.1 SMESG000016750.1 SMESG000016749.1 SMESG000016748.1 Contig17129newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30031773SMESG000016752.1 SMESG000016751.1 SMESG000016750.1 SMESG000016749.1 SMESG000016748.1 Contig17129uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
zeta neoblastSMED30031773SMESG000016751.1 dd_Smed_v4_11434_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30031773SMESG000016751.1 JF511467smed_ncbi_20200123PMID:21747960
Hollenbach et al., 2011
whole organism asexual adult RNA-sequencing evidence
neoblastSMED30031773SMESG000016751.1 JF511467smed_ncbi_20200123PMID:21747960
Hollenbach et al., 2011
whole organism adult hermaphrodite RNA-sequencing evidence
neoblastSMED30031773SMESG000016751.1 JF511467smed_ncbi_20200123PMID:21747960
Hollenbach et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
X1 cellSMED30031773SMESG000016751.1 JF511467smed_ncbi_20200123PMID:21747960
Hollenbach et al., 2011
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30031773SMESG000016751.1 SmWIOct06_002501GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30031773SMESG000016751.1 SMED_30426_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30031773SMESG000016751.1 SMED_30426_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Msh2 vs. Ensembl Human
Match: MSH2 (mutS homolog 2 [Source:HGNC Symbol;Acc:HGNC:7325])

HSP 1 Score: 624.394 bits (1609), Expect = 0.000e+0
Identity = 342/841 (40.67%), Postives = 526/841 (62.54%), Query Frame = 1
Query:   28 SFSLFWNSLGDKPNSTIRFFDRQDYYTVHFEDAEMLARSYYKSMEILKYFRRDSVSS-PYINISKSNSDGVFKYLLIANQYKVEVYSN---NKS--HDSWNLDFVATPGNLEKYQDILFKDVELVSSNSLLGLNIKRINDDYRIFLGFCDLDNGIFMIGGFEESFTGYEQLANLSSALFQLNCRECLIPN-DTRPELLAVKNAVQSAGLLVTEVKKSFFSSENVMNSILKLICKTKLNNENTVLKLVDTEGAETIGCLGSVITYLDLANDESFFNFFDVQTFKLDNYMRVGEQCSRALNILP-SPNDLRKHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLINDNKLRGCLYEENLRRIPDLQRITRRLQRNKGNLQDIYKLYVALRQASDMLNLLNEHNGPYKCIIQSELSSVIQEILKDTENFIQMFTSFFDFEAVKNHEFKVKCDVDESLKECENSMITLKSQMETESSRVSDKLGIESTKQLKFESSNSLGYYMRVSRKDENVLRNKSFISIIETLKDGVKFHSTQMTLMNESYLQHXXXXXXXXXXXXXXXMKITNKYVGSLHQLSSIIAKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVEMQNNMSYIANDISFDESRT-FQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIHCNVNNLHVTAQTIGNELIFMYKVEEGPAVRSYGIEVAKASGLPDESIKLAKLKLSEYE 2523
             F  F+  + +KP +T+R FDR D+YT H EDA + AR  +K+  ++KY       +   + +SK N +   K LL+  QY+VEVY N   NK+   + W L + A+PGNL +++DILF + ++ +S  ++G+ +  ++   ++ +G+ D    I    G  E F   +Q +NL + L Q+  +EC++P  +T  ++  ++  +Q  G+L+TE KK+ FS++++   + +L+   K    N+ + L + E    +  L +VI +L+L +D+S F  F++ TF    YM++     RALN+   S  D     SL  LLN C+T  G+RL+ QWIKQPLMD N I  RL++VE+ + D +LR  L E+ LRR PDL R+ ++ QR   NLQD Y+LY  + Q  +++  L +H G ++ ++ +   + + ++  D   F +M  +  D + V+NHEF VK   D +L E    M  L+ +M++     +  LG++  KQ+K +SS   GYY RV+ K+E VLRN    S ++  K+GVKF ++++T +NE Y +++ +YEE + +I++EI+ I++ YV  +  L+ ++A+LD + S A +  GAP  Y RP +++  + R+  +K  RH  VE+Q+ +++I ND+ F++ +  F IITGPNMGGKSTYIR  G+I +MAQIG FVPC+ AE+SI D I+ R+GAGD QL GVSTFMAEML+ + IL++AT  SLIIIDELGRGTST+DGFGLAW+ISE+IAT++ AF  FATHFHELT L+     VNNLHVTA T    L  +Y+V++G   +S+GI VA+ +  P   I+ AK K  E E
Sbjct:   18 GFVRFFQGMPEKPTTTVRLFDRGDFYTAHGEDALLAAREVFKTQGVIKYMGPAGAKNLQSVVLSKMNFESFVKDLLLVRQYRVEVYKNRAGNKASKENDWYLAYKASPGNLSQFEDILFGNNDMSASIGVVGVKMSAVDGQRQVGVGYVD---SIQRKLGLCE-FPDNDQFSNLEALLIQIGPKECVLPGGETAGDMGKLRQIIQRGGILITERKKADFSTKDIYQDLNRLLKGKKGEQMNSAV-LPEMENQVAVSSLSAVIKFLELLSDDSNFGQFELTTFDFSQYMKLDIAAVRALNLFQGSVEDTTGSQSLAALLNKCKTPQGQRLVNQWIKQPLMDKNRIEERLNLVEAFVEDAELRQTLQEDLLRRFPDLNRLAKKFQRQAANLQDCYRLYQGINQLPNVIQALEKHEGKHQKLLLAVFVTPLTDLRSDFSKFQEMIETTLDMDQVENHEFLVKPSFDPNLSELREIMNDLEKKMQSTLISAARDLGLDPGKQIKLDSSAQFGYYFRVTCKEEKVLRNNKNFSTVDIQKNGVKFTNSKLTSLNEEYTKNKTEYEEAQDAIVKEIVNISSGYVEPMQTLNDVLAQLDAVVSFAHVSNGAPVPYVRPAILEKGQGRII-LKASRHACVEVQDEIAFIPNDVYFEKDKQMFHIITGPNMGGKSTYIRQTGVIVLMAQIGCFVPCESAEVSIVDCILARVGAGDSQLKGVSTFMAEMLETASILRSATKDSLIIIDELGRGTSTYDGFGLAWAISEYIATKIGAFCMFATHFHELTALANQIPTVNNLHVTALTTEETLTMLYQVKKGVCDQSFGIHVAELANFPKHVIECAKQKALELE 852          
BLAST of Msh2 vs. Ensembl Human
Match: MSH2 (mutS homolog 2 [Source:HGNC Symbol;Acc:HGNC:7325])

HSP 1 Score: 624.009 bits (1608), Expect = 0.000e+0
Identity = 342/841 (40.67%), Postives = 526/841 (62.54%), Query Frame = 1
Query:   28 SFSLFWNSLGDKPNSTIRFFDRQDYYTVHFEDAEMLARSYYKSMEILKYFRRDSVSS-PYINISKSNSDGVFKYLLIANQYKVEVYSN---NKS--HDSWNLDFVATPGNLEKYQDILFKDVELVSSNSLLGLNIKRINDDYRIFLGFCDLDNGIFMIGGFEESFTGYEQLANLSSALFQLNCRECLIPN-DTRPELLAVKNAVQSAGLLVTEVKKSFFSSENVMNSILKLICKTKLNNENTVLKLVDTEGAETIGCLGSVITYLDLANDESFFNFFDVQTFKLDNYMRVGEQCSRALNILP-SPNDLRKHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLINDNKLRGCLYEENLRRIPDLQRITRRLQRNKGNLQDIYKLYVALRQASDMLNLLNEHNGPYKCIIQSELSSVIQEILKDTENFIQMFTSFFDFEAVKNHEFKVKCDVDESLKECENSMITLKSQMETESSRVSDKLGIESTKQLKFESSNSLGYYMRVSRKDENVLRNKSFISIIETLKDGVKFHSTQMTLMNESYLQHXXXXXXXXXXXXXXXMKITNKYVGSLHQLSSIIAKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVEMQNNMSYIANDISFDESRT-FQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIHCNVNNLHVTAQTIGNELIFMYKVEEGPAVRSYGIEVAKASGLPDESIKLAKLKLSEYE 2523
             F  F+  + +KP +T+R FDR D+YT H EDA + AR  +K+  ++KY       +   + +SK N +   K LL+  QY+VEVY N   NK+   + W L + A+PGNL +++DILF + ++ +S  ++G+ +  ++   ++ +G+ D    I    G  E F   +Q +NL + L Q+  +EC++P  +T  ++  ++  +Q  G+L+TE KK+ FS++++   + +L+   K    N+ + L + E    +  L +VI +L+L +D+S F  F++ TF    YM++     RALN+   S  D     SL  LLN C+T  G+RL+ QWIKQPLMD N I  RL++VE+ + D +LR  L E+ LRR PDL R+ ++ QR   NLQD Y+LY  + Q  +++  L +H G ++ ++ +   + + ++  D   F +M  +  D + V+NHEF VK   D +L E    M  L+ +M++     +  LG++  KQ+K +SS   GYY RV+ K+E VLRN    S ++  K+GVKF ++++T +NE Y +++ +YEE + +I++EI+ I++ YV  +  L+ ++A+LD + S A +  GAP  Y RP +++  + R+  +K  RH  VE+Q+ +++I ND+ F++ +  F IITGPNMGGKSTYIR  G+I +MAQIG FVPC+ AE+SI D I+ R+GAGD QL GVSTFMAEML+ + IL++AT  SLIIIDELGRGTST+DGFGLAW+ISE+IAT++ AF  FATHFHELT L+     VNNLHVTA T    L  +Y+V++G   +S+GI VA+ +  P   I+ AK K  E E
Sbjct:   18 GFVRFFQGMPEKPTTTVRLFDRGDFYTAHGEDALLAAREVFKTQGVIKYMGPAGAKNLQSVVLSKMNFESFVKDLLLVRQYRVEVYKNRAGNKASKENDWYLAYKASPGNLSQFEDILFGNNDMSASIGVVGVKMSAVDGQRQVGVGYVD---SIQRKLGLCE-FPDNDQFSNLEALLIQIGPKECVLPGGETAGDMGKLRQIIQRGGILITERKKADFSTKDIYQDLNRLLKGKKGEQMNSAV-LPEMENQVAVSSLSAVIKFLELLSDDSNFGQFELTTFDFSQYMKLDIAAVRALNLFQGSVEDTTGSQSLAALLNKCKTPQGQRLVNQWIKQPLMDKNRIEERLNLVEAFVEDAELRQTLQEDLLRRFPDLNRLAKKFQRQAANLQDCYRLYQGINQLPNVIQALEKHEGKHQKLLLAVFVTPLTDLRSDFSKFQEMIETTLDMDQVENHEFLVKPSFDPNLSELREIMNDLEKKMQSTLISAARDLGLDPGKQIKLDSSAQFGYYFRVTCKEEKVLRNNKNFSTVDIQKNGVKFTNSKLTSLNEEYTKNKTEYEEAQDAIVKEIVNISSGYVEPMQTLNDVLAQLDAVVSFAHVSNGAPVPYVRPAILEKGQGRII-LKASRHACVEVQDEIAFIPNDVYFEKDKQMFHIITGPNMGGKSTYIRQTGVIVLMAQIGCFVPCESAEVSIVDCILARVGAGDSQLKGVSTFMAEMLETASILRSATKDSLIIIDELGRGTSTYDGFGLAWAISEYIATKIGAFCMFATHFHELTALANQIPTVNNLHVTALTTEETLTMLYQVKKGVCDQSFGIHVAELANFPKHVIECAKQKALELE 852          
BLAST of Msh2 vs. Ensembl Human
Match: MSH2 (mutS homolog 2 [Source:HGNC Symbol;Acc:HGNC:7325])

HSP 1 Score: 623.624 bits (1607), Expect = 0.000e+0
Identity = 342/841 (40.67%), Postives = 526/841 (62.54%), Query Frame = 1
Query:   28 SFSLFWNSLGDKPNSTIRFFDRQDYYTVHFEDAEMLARSYYKSMEILKYFRRDSVSS-PYINISKSNSDGVFKYLLIANQYKVEVYSN---NKS--HDSWNLDFVATPGNLEKYQDILFKDVELVSSNSLLGLNIKRINDDYRIFLGFCDLDNGIFMIGGFEESFTGYEQLANLSSALFQLNCRECLIPN-DTRPELLAVKNAVQSAGLLVTEVKKSFFSSENVMNSILKLICKTKLNNENTVLKLVDTEGAETIGCLGSVITYLDLANDESFFNFFDVQTFKLDNYMRVGEQCSRALNILP-SPNDLRKHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLINDNKLRGCLYEENLRRIPDLQRITRRLQRNKGNLQDIYKLYVALRQASDMLNLLNEHNGPYKCIIQSELSSVIQEILKDTENFIQMFTSFFDFEAVKNHEFKVKCDVDESLKECENSMITLKSQMETESSRVSDKLGIESTKQLKFESSNSLGYYMRVSRKDENVLRNKSFISIIETLKDGVKFHSTQMTLMNESYLQHXXXXXXXXXXXXXXXMKITNKYVGSLHQLSSIIAKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVEMQNNMSYIANDISFDESRT-FQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIHCNVNNLHVTAQTIGNELIFMYKVEEGPAVRSYGIEVAKASGLPDESIKLAKLKLSEYE 2523
             F  F+  + +KP +T+R FDR D+YT H EDA + AR  +K+  ++KY       +   + +SK N +   K LL+  QY+VEVY N   NK+   + W L + A+PGNL +++DILF + ++ +S  ++G+ +  ++   ++ +G+ D    I    G  E F   +Q +NL + L Q+  +EC++P  +T  ++  ++  +Q  G+L+TE KK+ FS++++   + +L+   K    N+ + L + E    +  L +VI +L+L +D+S F  F++ TF    YM++     RALN+   S  D     SL  LLN C+T  G+RL+ QWIKQPLMD N I  RL++VE+ + D +LR  L E+ LRR PDL R+ ++ QR   NLQD Y+LY  + Q  +++  L +H G ++ ++ +   + + ++  D   F +M  +  D + V+NHEF VK   D +L E    M  L+ +M++     +  LG++  KQ+K +SS   GYY RV+ K+E VLRN    S ++  K+GVKF ++++T +NE Y +++ +YEE + +I++EI+ I++ YV  +  L+ ++A+LD + S A +  GAP  Y RP +++  + R+  +K  RH  VE+Q+ +++I ND+ F++ +  F IITGPNMGGKSTYIR  G+I +MAQIG FVPC+ AE+SI D I+ R+GAGD QL GVSTFMAEML+ + IL++AT  SLIIIDELGRGTST+DGFGLAW+ISE+IAT++ AF  FATHFHELT L+     VNNLHVTA T    L  +Y+V++G   +S+GI VA+ +  P   I+ AK K  E E
Sbjct:   18 GFVRFFQGMPEKPTTTVRLFDRGDFYTAHGEDALLAAREVFKTQGVIKYMGPAGAKNLQSVVLSKMNFESFVKDLLLVRQYRVEVYKNRAGNKASKENDWYLAYKASPGNLSQFEDILFGNNDMSASIGVVGVKMSAVDGQRQVGVGYVD---SIQRKLGLCE-FPDNDQFSNLEALLIQIGPKECVLPGGETAGDMGKLRQIIQRGGILITERKKADFSTKDIYQDLNRLLKGKKGEQMNSAV-LPEMENQVAVSSLSAVIKFLELLSDDSNFGQFELTTFDFSQYMKLDIAAVRALNLFQGSVEDTTGSQSLAALLNKCKTPQGQRLVNQWIKQPLMDKNRIEERLNLVEAFVEDAELRQTLQEDLLRRFPDLNRLAKKFQRQAANLQDCYRLYQGINQLPNVIQALEKHEGKHQKLLLAVFVTPLTDLRSDFSKFQEMIETTLDMDQVENHEFLVKPSFDPNLSELREIMNDLEKKMQSTLISAARDLGLDPGKQIKLDSSAQFGYYFRVTCKEEKVLRNNKNFSTVDIQKNGVKFTNSKLTSLNEEYTKNKTEYEEAQDAIVKEIVNISSGYVEPMQTLNDVLAQLDAVVSFAHVSNGAPVPYVRPAILEKGQGRII-LKASRHACVEVQDEIAFIPNDVYFEKDKQMFHIITGPNMGGKSTYIRQTGVIVLMAQIGCFVPCESAEVSIVDCILARVGAGDSQLKGVSTFMAEMLETASILRSATKDSLIIIDELGRGTSTYDGFGLAWAISEYIATKIGAFCMFATHFHELTALANQIPTVNNLHVTALTTEETLTMLYQVKKGVCDQSFGIHVAELANFPKHVIECAKQKALELE 852          
BLAST of Msh2 vs. Ensembl Human
Match: MSH2 (mutS homolog 2 [Source:HGNC Symbol;Acc:HGNC:7325])

HSP 1 Score: 623.624 bits (1607), Expect = 0.000e+0
Identity = 342/841 (40.67%), Postives = 526/841 (62.54%), Query Frame = 1
Query:   28 SFSLFWNSLGDKPNSTIRFFDRQDYYTVHFEDAEMLARSYYKSMEILKYFRRDSVSS-PYINISKSNSDGVFKYLLIANQYKVEVYSN---NKS--HDSWNLDFVATPGNLEKYQDILFKDVELVSSNSLLGLNIKRINDDYRIFLGFCDLDNGIFMIGGFEESFTGYEQLANLSSALFQLNCRECLIPN-DTRPELLAVKNAVQSAGLLVTEVKKSFFSSENVMNSILKLICKTKLNNENTVLKLVDTEGAETIGCLGSVITYLDLANDESFFNFFDVQTFKLDNYMRVGEQCSRALNILP-SPNDLRKHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLINDNKLRGCLYEENLRRIPDLQRITRRLQRNKGNLQDIYKLYVALRQASDMLNLLNEHNGPYKCIIQSELSSVIQEILKDTENFIQMFTSFFDFEAVKNHEFKVKCDVDESLKECENSMITLKSQMETESSRVSDKLGIESTKQLKFESSNSLGYYMRVSRKDENVLRNKSFISIIETLKDGVKFHSTQMTLMNESYLQHXXXXXXXXXXXXXXXMKITNKYVGSLHQLSSIIAKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVEMQNNMSYIANDISFDESRT-FQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIHCNVNNLHVTAQTIGNELIFMYKVEEGPAVRSYGIEVAKASGLPDESIKLAKLKLSEYE 2523
             F  F+  + +KP +T+R FDR D+YT H EDA + AR  +K+  ++KY       +   + +SK N +   K LL+  QY+VEVY N   NK+   + W L + A+PGNL +++DILF + ++ +S  ++G+ +  ++   ++ +G+ D    I    G  E F   +Q +NL + L Q+  +EC++P  +T  ++  ++  +Q  G+L+TE KK+ FS++++   + +L+   K    N+ + L + E    +  L +VI +L+L +D+S F  F++ TF    YM++     RALN+   S  D     SL  LLN C+T  G+RL+ QWIKQPLMD N I  RL++VE+ + D +LR  L E+ LRR PDL R+ ++ QR   NLQD Y+LY  + Q  +++  L +H G ++ ++ +   + + ++  D   F +M  +  D + V+NHEF VK   D +L E    M  L+ +M++     +  LG++  KQ+K +SS   GYY RV+ K+E VLRN    S ++  K+GVKF ++++T +NE Y +++ +YEE + +I++EI+ I++ YV  +  L+ ++A+LD + S A +  GAP  Y RP +++  + R+  +K  RH  VE+Q+ +++I ND+ F++ +  F IITGPNMGGKSTYIR  G+I +MAQIG FVPC+ AE+SI D I+ R+GAGD QL GVSTFMAEML+ + IL++AT  SLIIIDELGRGTST+DGFGLAW+ISE+IAT++ AF  FATHFHELT L+     VNNLHVTA T    L  +Y+V++G   +S+GI VA+ +  P   I+ AK K  E E
Sbjct:   18 GFVRFFQGMPEKPTTTVRLFDRGDFYTAHGEDALLAAREVFKTQGVIKYMGPAGAKNLQSVVLSKMNFESFVKDLLLVRQYRVEVYKNRAGNKASKENDWYLAYKASPGNLSQFEDILFGNNDMSASIGVVGVKMSAVDGQRQVGVGYVD---SIQRKLGLCE-FPDNDQFSNLEALLIQIGPKECVLPGGETAGDMGKLRQIIQRGGILITERKKADFSTKDIYQDLNRLLKGKKGEQMNSAV-LPEMENQVAVSSLSAVIKFLELLSDDSNFGQFELTTFDFSQYMKLDIAAVRALNLFQGSVEDTTGSQSLAALLNKCKTPQGQRLVNQWIKQPLMDKNRIEERLNLVEAFVEDAELRQTLQEDLLRRFPDLNRLAKKFQRQAANLQDCYRLYQGINQLPNVIQALEKHEGKHQKLLLAVFVTPLTDLRSDFSKFQEMIETTLDMDQVENHEFLVKPSFDPNLSELREIMNDLEKKMQSTLISAARDLGLDPGKQIKLDSSAQFGYYFRVTCKEEKVLRNNKNFSTVDIQKNGVKFTNSKLTSLNEEYTKNKTEYEEAQDAIVKEIVNISSGYVEPMQTLNDVLAQLDAVVSFAHVSNGAPVPYVRPAILEKGQGRII-LKASRHACVEVQDEIAFIPNDVYFEKDKQMFHIITGPNMGGKSTYIRQTGVIVLMAQIGCFVPCESAEVSIVDCILARVGAGDSQLKGVSTFMAEMLETASILRSATKDSLIIIDELGRGTSTYDGFGLAWAISEYIATKIGAFCMFATHFHELTALANQIPTVNNLHVTALTTEETLTMLYQVKKGVCDQSFGIHVAELANFPKHVIECAKQKALELE 852          
BLAST of Msh2 vs. Ensembl Human
Match: MSH2 (mutS homolog 2 [Source:HGNC Symbol;Acc:HGNC:7325])

HSP 1 Score: 623.624 bits (1607), Expect = 0.000e+0
Identity = 342/841 (40.67%), Postives = 526/841 (62.54%), Query Frame = 1
Query:   28 SFSLFWNSLGDKPNSTIRFFDRQDYYTVHFEDAEMLARSYYKSMEILKYFRRDSVSS-PYINISKSNSDGVFKYLLIANQYKVEVYSN---NKS--HDSWNLDFVATPGNLEKYQDILFKDVELVSSNSLLGLNIKRINDDYRIFLGFCDLDNGIFMIGGFEESFTGYEQLANLSSALFQLNCRECLIPN-DTRPELLAVKNAVQSAGLLVTEVKKSFFSSENVMNSILKLICKTKLNNENTVLKLVDTEGAETIGCLGSVITYLDLANDESFFNFFDVQTFKLDNYMRVGEQCSRALNILP-SPNDLRKHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLINDNKLRGCLYEENLRRIPDLQRITRRLQRNKGNLQDIYKLYVALRQASDMLNLLNEHNGPYKCIIQSELSSVIQEILKDTENFIQMFTSFFDFEAVKNHEFKVKCDVDESLKECENSMITLKSQMETESSRVSDKLGIESTKQLKFESSNSLGYYMRVSRKDENVLRNKSFISIIETLKDGVKFHSTQMTLMNESYLQHXXXXXXXXXXXXXXXMKITNKYVGSLHQLSSIIAKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVEMQNNMSYIANDISFDESRT-FQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIHCNVNNLHVTAQTIGNELIFMYKVEEGPAVRSYGIEVAKASGLPDESIKLAKLKLSEYE 2523
             F  F+  + +KP +T+R FDR D+YT H EDA + AR  +K+  ++KY       +   + +SK N +   K LL+  QY+VEVY N   NK+   + W L + A+PGNL +++DILF + ++ +S  ++G+ +  ++   ++ +G+ D    I    G  E F   +Q +NL + L Q+  +EC++P  +T  ++  ++  +Q  G+L+TE KK+ FS++++   + +L+   K    N+ + L + E    +  L +VI +L+L +D+S F  F++ TF    YM++     RALN+   S  D     SL  LLN C+T  G+RL+ QWIKQPLMD N I  RL++VE+ + D +LR  L E+ LRR PDL R+ ++ QR   NLQD Y+LY  + Q  +++  L +H G ++ ++ +   + + ++  D   F +M  +  D + V+NHEF VK   D +L E    M  L+ +M++     +  LG++  KQ+K +SS   GYY RV+ K+E VLRN    S ++  K+GVKF ++++T +NE Y +++ +YEE + +I++EI+ I++ YV  +  L+ ++A+LD + S A +  GAP  Y RP +++  + R+  +K  RH  VE+Q+ +++I ND+ F++ +  F IITGPNMGGKSTYIR  G+I +MAQIG FVPC+ AE+SI D I+ R+GAGD QL GVSTFMAEML+ + IL++AT  SLIIIDELGRGTST+DGFGLAW+ISE+IAT++ AF  FATHFHELT L+     VNNLHVTA T    L  +Y+V++G   +S+GI VA+ +  P   I+ AK K  E E
Sbjct:   18 GFVRFFQGMPEKPTTTVRLFDRGDFYTAHGEDALLAAREVFKTQGVIKYMGPAGAKNLQSVVLSKMNFESFVKDLLLVRQYRVEVYKNRAGNKASKENDWYLAYKASPGNLSQFEDILFGNNDMSASIGVVGVKMSAVDGQRQVGVGYVD---SIQRKLGLCE-FPDNDQFSNLEALLIQIGPKECVLPGGETAGDMGKLRQIIQRGGILITERKKADFSTKDIYQDLNRLLKGKKGEQMNSAV-LPEMENQVAVSSLSAVIKFLELLSDDSNFGQFELTTFDFSQYMKLDIAAVRALNLFQGSVEDTTGSQSLAALLNKCKTPQGQRLVNQWIKQPLMDKNRIEERLNLVEAFVEDAELRQTLQEDLLRRFPDLNRLAKKFQRQAANLQDCYRLYQGINQLPNVIQALEKHEGKHQKLLLAVFVTPLTDLRSDFSKFQEMIETTLDMDQVENHEFLVKPSFDPNLSELREIMNDLEKKMQSTLISAARDLGLDPGKQIKLDSSAQFGYYFRVTCKEEKVLRNNKNFSTVDIQKNGVKFTNSKLTSLNEEYTKNKTEYEEAQDAIVKEIVNISSGYVEPMQTLNDVLAQLDAVVSFAHVSNGAPVPYVRPAILEKGQGRII-LKASRHACVEVQDEIAFIPNDVYFEKDKQMFHIITGPNMGGKSTYIRQTGVIVLMAQIGCFVPCESAEVSIVDCILARVGAGDSQLKGVSTFMAEMLETASILRSATKDSLIIIDELGRGTSTYDGFGLAWAISEYIATKIGAFCMFATHFHELTALANQIPTVNNLHVTALTTEETLTMLYQVKKGVCDQSFGIHVAELANFPKHVIECAKQKALELE 852          
BLAST of Msh2 vs. Ensembl Celegans
Match: msh-2 (MSH (MutS Homolog) family [Source:UniProtKB/TrEMBL;Acc:Q9TXR4])

HSP 1 Score: 375.555 bits (963), Expect = 2.601e-116
Identity = 287/876 (32.76%), Postives = 452/876 (51.60%), Query Frame = 1
Query:   52 LGDKPNSTIRFFDRQDYYTVHFEDAEMLARSYYKSMEILKYFRRDSVSS---PYINISKSNSDGVFKYLLIANQYKVEVYSNNKSHDSWNLDFVATPGNLEKYQDILFKDVELVSSNSLLGLNIKRINDDYRIFLGFCDLDNGIFMIGGF--EESFTGYEQLANLSSALFQLNCRECLIPNDTRPELLAVKNAVQSAGLLVTEVKK--SFFSSENVMNSILKLICKTKLNNENTVLKLVDTEGAETIG-----CLGSVITYLDLANDESFFNFFDVQTFKLDNYMRVGEQCSRAL-------NILPSPNDLRKHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLINDNKLRGCLYEENLRRIPDLQRITRRLQRNKGNLQDIYKLYVA--LRQASDMLNLLNEHNGPYKCIIQSELSSVIQEILKDTENFIQMFTSFFDFEAVK-NHEFKVKCDVDESLKECENSMITLKSQMETESSRVSDKLGIESTKQ-----LKFESSNSLGYYMRVSRKDENVLRNKSFISIIETLK-DGVKFHSTQMTLMNESYLQHXXXXXXXXXXXXXXXMKITNKYVGSLHQLSSIIAKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVEMQNNMSYIANDISFDESRTFQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIHCNVNNLHVTAQTIGNELIFMYKVEEGPAVRSYGIEVAKASGLPDESIKLAKLKLSEYENLMEWDSNHSEKL---AATRNALM 2586
            L  K  +TI  F R +Y++V+ +DA  +A + +KS   +K F   + +S    YI++++   + V +  ++  +  VE+YS+ +    W +    +PGN   ++    +++ +     +L + I   +DD R+ L   D  N   +I  +    SF+  EQ       +F L   E ++ N+               G +  + KK  S F+   V N   +L  K++ ++    + L   + AE        CL   I + + A++ S    + +  +     M +      AL       N L   N+L    +LY +LN C+T  GE+LL  W+ +PL  ++ IN RLDIVE+L  +  +R  L +  L R+PD  ++ RRL R K  LQD+ + Y A  L +  +M  +       +   I   L S I EILK  E F  +   FFDF+  K N E +V+ D    ++E    +     QME    RV++KL  + + +     LK + ++  G+Y RV+ K+E  +R K  + I+ET K  GVKF   +++ +N+ +L+    Y   E  +I  + K   +++  +  ++ +IA LDV  SL+T    + G Y RP ++     R+ ++K CRHP++E  +   +I ND+  D+ R   I+TG NMGGKSTY+RS  L  ++AQIGSFVPC  A IS+ D I TR+GA D Q  G+STFMAEMLD S IL+ AT  S ++IDELGRGTSTFDGFG+A +I++ I   ++  S FATHFHE+  L++    V  L +  Q   NE+  +YKV EG A  S+G++VAK  G+ +  I  A   L   E  +  DS   ++L   A  R A++
Sbjct:   17 LKSKSPNTIAIFSRGEYFSVYGDDATFVATNIFKSDVCVKTFTLSTDNSQQMKYISVNRGQYEKVVRETIVLLRCSVELYSSEQGE--WKMTKRGSPGNTVDFE----QEIGVSDQAPILAIYIHPGDDDNRVTLCAWDAGNVRIVISEYIDTPSFSQTEQ------CIFGLCPTEYILVNE---------------GSVAPKAKKIASMFTRMEVHNK-QQLKPKSQWSDVIESVHLDYKDEAEKQNENIKECLQ--ILHSNAADEYSISEKYSIFNYGTHGNMLIDSCAVEALELFQLNYNYLEKSNNL----TLYNVLNKCKTLPGEKLLRDWLSRPLCQIDHINERLDIVEALFENQTIRQKLRDSILARMPDCSQLARRLMR-KCTLQDLNRFYQAATLLETVEMQLIQLSEAEQFAPSINRLLKSEITEILKKVERFQVLCDEFFDFDYEKENKEIRVRVDFVPEIQEISEKL----EQME----RVAEKLRKKYSAKFECDNLKLDKNSQYGFYFRVTLKEEKSIRKKD-VHILETTKGSGVKFSVGELSDINDEFLEFHLKYTRAEEEVISMLCKKAEEFIPLIPAMAQLIATLDVFVSLSTFAATSSGIYTRPNLLPLGSKRL-ELKQCRHPVIEGNSEKPFIPNDVVLDKCRLI-ILTGANMGGKSTYLRSAALSILLAQIGSFVPCSSATISVVDGIFTRVGASDKQSQGISTFMAEMLDCSAILQRATKNSFVVIDELGRGTSTFDGFGIASAIAQDILNRIQCLSIFATHFHEMGKLAEQPGAV-ALQMGVQIENNEIHMLYKVFEGVAQCSFGLQVAKMVGIDENVINKAAQLLEGLEKKLVIDSKKKKELLESADIRQAIL 845          
BLAST of Msh2 vs. Ensembl Celegans
Match: him-14 (MutS protein homolog him-14 [Source:UniProtKB/Swiss-Prot;Acc:Q23405])

HSP 1 Score: 177.563 bits (449), Expect = 1.051e-45
Identity = 154/561 (27.45%), Postives = 262/561 (46.70%), Query Frame = 1
Query:  925 LRKHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLINDNKLRGCLYEENLRRIPDLQRI---------TRRLQRNKGNLQDIYKLYVALRQASDMLNLLNEHNGPYKCIIQSELSSVIQEILKDTENFIQMFT--------SFFDFEAVKNHEFKVKC---------DVDESLKECENSMITLKSQMETESSRVSDKLGIESTKQLKFESSNSLGYYMRVSRKDENVLRNKSFISIIETLKDGVKFHSTQMTLMNESYLQHXXXXXXXXXXXXXXXMKITNKYVGSLHQLSSIIAKLDVLCSLATMVCGAPGTYARPKVVDDCKTRV---FKVKNCRHPLVEMQNNMSYIANDISFDESRTFQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIHCNVNNLHVTAQTIGNE------LIFMYKVEEGPAVRSYGIEVAKASGLPDESIKLAK 2502
            +++  +L  +LN   T +G RLL   + QP  DV LI +R + +E LI   +L+  L    L R  +L R+         +  ++ ++  +  I KL   L+    +  LL  H+   K  I  E +    E LKD   F Q+          S  D +    H    KC          +D + +  E     +++  ET +  +++     S+ +L F  S    +Y  V+R+ E+V   + F+ +    +  V F+S ++   N+   Q   +       I+ ++++     +  L+     ++ +D LC LAT             + D CK      F +   RHP+++  ++   I ND      R F IITGPNM GKSTY++    +++MAQIG F+P + A + IF+RI +R+G  D  +   S F +EM D + I++ A   SL+++DEL R TST +G  + ++I E +  +L++++  ATHF ++  L+     ++N H   QT  N       L   Y+   GP    YG E+ + S +PDE I+ A+
Sbjct:  233 MKQKRTLMSVLNHTVTTNGYRLLRSSVLQPSTDVYLIQSRQEAIEELIGKPQLKDKL-RRTLSRAHELDRVIAMCIQTSTSWTVRESEAKINQIIKLMHTLKVIQGIRTLL--HSAKMKSNILIEKT----EFLKDP-RFDQIMNILVEKVDDSLLDGKKNSLHLQNTKCYAIRHFVAVQLDLARQTYEE---IIRNVEETGAREIAEYFHGNSSVRLSFSQSRGF-HYTFVTRQAESVTIPRYFLDVFRN-RTTVTFNSRKVIAYNDRLEQVVAEMFLASDVIVCDMIEEMQPMIPVLYYAMDALSSIDFLCGLATY----------SDLRDTCKPTFGPSFSISQGRHPILDWDDSEKTITNDTCLTRDRRFGIITGPNMAGKSTYLKQTAQLAIMAQIGCFIPANYASLPIFNRIFSRMGHNDELIRNKSAFASEMSDAAAIVQYADKNSLVVLDELARSTSTEEGIAITYAICEKV-LKLQSYTFLATHFLDIAALANYSNAIDNYHFLPQTDENSTKKHKLLRGQYR---GPL---YGFELVELSTIPDEVIEHAQ 763          
BLAST of Msh2 vs. Ensembl Celegans
Match: msh-6 (MSH (MutS Homolog) family [Source:UniProtKB/TrEMBL;Acc:Q9N3T8])

HSP 1 Score: 175.637 bits (444), Expect = 1.018e-44
Identity = 162/591 (27.41%), Postives = 269/591 (45.52%), Query Frame = 1
Query:  898 LNILPSPNDLRKH-DSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLIN-DNKLRGCLYEENLRRIPDLQRITRRLQ------RN--------------KGNLQDIYKLYVALRQASDMLNLLNEHNGPY--------KCIIQSELSSVIQEILKDTENFIQMFTSFFDFE-AVKNHEFKVKCDVDESLKECENSMITLKSQMETESSRVSDKLGIESTKQLKFESSNSLGYYMRVSRKDENVLRNKSFISIIETLKDGVKFHSTQMTLMNESYLQHXXXXXXXXXXXXXXXMKITNKYVGSLHQL----SSIIAKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVEMQN------NMSYIANDISFDESRT-FQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIHCNVNNLHV--------TAQTIGNELIFMYKVEEGPAVRSYGIEVAKASGLPDESIKLAKLKLSEY 2520
            LNI+P+  D   H  SLY ++N C T  G RLL  W+ QP  D   +  R   ++ L++ D           L++IPDL R+ +++       R+              K N + I +L  A+    D   L N+    Y         C +  EL    QE+ +  EN I  F   FD   A+K+ +       DE   E  N +    +++      V+ K        +KF  S  + Y + +    EN   + SF   +++ + G   +ST  +   E  +      E+ +  + ++  +   +  G  + +      +++  DVL SLA     +P     P+   +       V    HP + +Q+        S+IAN  +   S     ++TGPNMGGKST +R   +++++A IGS VP     ++  DRI TRIGA D  + G STF  E+ +   +LK AT  SL+++DELGRGTSTFDG  +A ++ + I+ +L   + F+TH+H + D    H NV   H+               ++ F+Y++E G   +SYG   AK +G+  + ++ A L+ +++
Sbjct:  581 LNIVPNGRD--SHLTSLYYVINKCSTPFGRRLLRSWLLQPTCDPKKLEQRQKAIKWLVSPDASSFMTTATATLKKIPDLDRLLQKIHTIGLKYRSEKHPDSRAIFFDTIKTNQKKIAELLAAI----DGFKLCNKLRKEYIKVQKEGEGCELLDELLGNEQEMEEVDEN-IYFFEKMFDRSTAMKDGKIVPNAGCDEEYDEALNRVKEALNELNDYKDSVAKKYSC----SIKFVDSGKVKYLLEMP---ENTKVSSSFE--LKSRRKGFIRYSTPDS---EQLVAALDAVEKEKSKLGDDATRRVFEQFGHKNPIWLETVKLVSSFDVLTSLALFAKSSPFEMCMPEFDFNATDPYLIVDKGVHPCLALQSRNEVTQTTSFIANSTTMGASEAAVMLLTGPNMGGKSTLMRQTAVLAILAHIGSMVPAFSMRLTPIDRIFTRIGANDRIMCGESTFFIELKETDIMLKNATKHSLLLVDELGRGTSTFDGTAIASAVLQKISDDLACRTFFSTHYHSICDSFTNHPNVRLAHMKCVVDKENNEDPTMEDVTFLYELESGICPKSYGFYAAKLAGIDHQVVRNAYLESNKF 1152          
BLAST of Msh2 vs. Ensembl Celegans
Match: msh-5 (MutS protein homolog 5 [Source:UniProtKB/Swiss-Prot;Acc:Q19272])

HSP 1 Score: 145.206 bits (365), Expect = 4.123e-35
Identity = 148/612 (24.18%), Postives = 276/612 (45.10%), Query Frame = 1
Query:  748 DTEGAETIGCLGSVITYLDLANDESFFNFFD-----------VQTFKLDNYMRVGEQCSRALNILPSPNDLRKH----DSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLIND-NKLRGCLYEENLRRIPDLQRITRRLQRNKGNLQDIYKLYVALRQA-SDMLNLLNEHNGPYKCIIQSELSSVIQEILKDTENFIQMFTSFFDFEAVK-NHEFKVKCDVDESLKEC----ENSMITLKSQMETESSRVSDKLGIESTKQLKFESSNSLGYYMRVSRKDENVLRNKSFISIIETLKDGVKFHSTQMTLMNESYLQHXXXXXXXXXXXXXXXMKITNKYVGSLHQLSSIIAKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVEMQNNMSYIANDISFD-ESRTFQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHI---ATELKAFSAFATHFHELTDLSKIHCNVNNL--HVTAQTIGNELIFMYKVEEGPAVRSYGIEVAKASGLPDESIKLA 2499
            D E    I   G+++ +LD    E+     D           ++TF L N + +     +AL+ILP   + +K      SLY L++ CR+  G++ L +W + P  D + + +R   V     D N          L R+  L  + ++ Q     L   ++ +V+   A  ++LN++ +     +  ++S+L       L++      +  S  +F   K      V   +DE L E     EN  + L +  + E +R    LG+     +       +G+ + V R  +  + ++  ++++ +  + ++  +   + +++ +        + + +II  +     K   S+ +L SI +++DVL S    +  A   +  P +VD+    V +     HP+  +    S++ N +S   +     IITGPN  GKS Y++SIG++  ++ IGSFVP   A+I I DRI+TR+   D  L G+STF  ++  ++  L+ AT  SL+IIDE G+GT T  G  L  S+  +      +       ++HFH L +   +  N+         +  G ++ +++++  G    S+ + VAK  G+P   I  A
Sbjct:  231 DIEAVNMIRSFGALLLFLD----ETRMGVTDDPLSVTSPIKSIKTFTLGNLVEIDFNTIQALDILPKETENKKTFGQGRSLYQLMDKCRSTVGKKCLRKWFRNPTTDRDDLVSRQKCVHYFKQDWNAEVTAKLSSILGRVKALNSVFQKFQSGTAQLIH-WECFVSTVNALVEILNIIRQTPISKEFPVESDL-------LREVSEIAVIAGSIINFAESKIQGRVTVMNGIDEELDEIRDTYENMPMVLTAIAKQEEAR----LGLPPYSNVACVYIPLVGFVLSVPR--DYGVESQPDMTLLYSTHEDLRVRNATTSRLDDEFGDILMRLIDSQTAIILTLKTRVMKKKRSIIKLLSIASRIDVLISFG--LIAAQNGWNCPALVDEP---VIEAVELYHPISVLVVKKSFVPNQVSSGRDGIKASIITGPNACGKSVYMKSIGIMVFLSHIGSFVPARHAKIGIVDRIVTRMFTVDSVLDGMSTFAKDVEQVALALRKATGNSLVIIDEFGKGTMTEVGLSLLASVMTYWMNRGADRCPHIFLSSHFHALPNYIPLETNIATFLTFTVLREAGGKIKYLFRMTPGLVDCSFALSVAKEEGIPPPVIGRA 819          
BLAST of Msh2 vs. Ensembl Celegans
Match: msh-5 (MutS protein homolog 5 [Source:UniProtKB/Swiss-Prot;Acc:Q19272])

HSP 1 Score: 123.635 bits (309), Expect = 1.671e-28
Identity = 82/260 (31.54%), Postives = 134/260 (51.54%), Query Frame = 1
Query: 1738 SLHQLSSIIAKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVEMQNNMSYIANDISFD-ESRTFQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHI---ATELKAFSAFATHFHELTDLSKIHCNVNNL--HVTAQTIGNELIFMYKVEEGPAVRSYGIEVAKASGLPDESIKLA 2499
            S+ +L SI +++DVL S    +  A   +  P +VD+    V +     HP+  +    S++ N +S   +     IITGPN  GKS Y++SIG++  ++ IGSFVP   A+I I DRI+TR+   D  L G+STF  ++  ++  L+ AT  SL+IIDE G+GT T  G  L  S+  +      +       ++HFH L +   +  N+         +  G ++ +++++  G    S+ + VAK  G+P   I  A
Sbjct:  119 SIIKLLSIASRIDVLISFG--LIAAQNGWNCPALVDEP---VIEAVELYHPISVLVVKKSFVPNQVSSGRDGIKASIITGPNACGKSVYMKSIGIMVFLSHIGSFVPARHAKIGIVDRIVTRMFTVDSVLDGMSTFAKDVEQVALALRKATGNSLVIIDEFGKGTMTEVGLSLLASVMTYWMNRGADRCPHIFLSSHFHALPNYIPLETNIATFLTFTVLREAGGKIKYLFRMTPGLVDCSFALSVAKEEGIPPPVIGRA 373          
BLAST of Msh2 vs. Ensembl Fly
Match: spel1 (gene:FBgn0015546 transcript:FBtr0344018)

HSP 1 Score: 512.301 bits (1318), Expect = 1.125e-167
Identity = 315/878 (35.88%), Postives = 501/878 (57.06%), Query Frame = 1
Query:    7 NMDELTNS---FSLFWNSLGDKPNSTIRFFDRQDYYTVH-FEDAEMLARSYYKSMEILKYFRRDSVSSP--YINISKSNSDGVFKYLLIANQYKVEVYSNNKSHDSWNLDFVATPGNLEKYQDILFKDVELVSSNSLLGLNIK-RINDDYRIFLGFCDLDNGIFMIGGF--EESFTGYEQLANLSSALFQLNCRECLIPNDTRPELLAVKNAVQSAGLLVTEVKKSFFSSENVMNSILKLICKTKLNNEN-TVLKLVDTEGAETIGCLGSVITYLDLANDESFFNFFDVQTFKLDNYMRVGEQCSRALNILPSPNDLR-----KHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLINDNKLRGCLYEENLRRIPDLQRITRRLQRNKGNLQDIYKLYVALRQASDMLNLLNEHNGPYKCIIQSELSSVIQEILKDTENFIQMFTSFFDFEAVKNHEFKVKCDVDESLKECENSMITLKSQMETESSRVSDKLGIESTKQLKFESSNSLGYYMRVSRKDENVLRNKSFISIIETLKDGVKFHSTQMTLMNESYLQHXXXXXXXXXXXXXXXMKITNKYVGSLHQLSSIIAKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVEMQNNMSYIANDISF--DESRTFQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIHCNVNNLHVTAQTIGNELIFMYKVEEGPAVRSYGIEVAKASGLPDESIKLAKLKLSEYENLMEWDSNHSEKLAATRNALME 2589
            NMD  TN+   F  F   LG+KP +T+RFFD  D YTVH  +D E++A+  YKS   +     D       ++++SK N +   + LL+   Y+VEVY  N S   W +++  +PGNL +++DILF + E++  NS++ L +K       R+ +   + ++  F +  F  ++ FT       L + +  L  +ECL+P+    E  AVK  +   G+++T  KKS     +++  + +L+   K   E+ T LK +  + A     L + I YLDL ND      ++++   L+ ++ +      ALNI+P P         +  S+ G+L+ CRT  G RL+ QW+KQPL   N++N+R +IV+ L+        L  + L+RIPD+  +T++L R K NLQD++++Y  + +   +L +L+E +      I+S + +  +  LKD     QM     DFEA++  E+ VK   D  L E +  M  L S+ME    + S +L ++   Q+K ES   LG++ R++ KD++VLR      I++ +K GV+F S ++    + +   R  YEE + SI+EEI+ +   Y   L  L++ +A+LD L S A     AP  Y RPK++++   R   +++ RHP +E+Q ++++IAN + F  +E   F IITGPNMGGKSTYIRS+G   +MA IG+FVPC  A IS+ D I+ R+GA D  + G+STFM EM++ S I++TAT KSL+IIDELGRGTST++G G+AWSI+EH+A E K F+ FATHFHE+T L++    V N H+ A    ++   +Y+V  G   +S+GI+VA+ +  P+  ++ A+   +E+E+       H +K      AL+E
Sbjct:   15 NMD--TNARRNFIKFHAKLGEKPATTVRFFDHTDRYTVHGSDDCELVAKIVYKSTAFIGALLPDDKKETLQFVSMSKGNFELAVRELLLVRNYRVEVYVKNSS--DWEIEYRGSPGNLLQFEDILFSNKEVLVGNSIISLLVKLDGGGQRRVGVASVEQNDCKFQLLEFLDDDFFT------ELEATVVLLGPKECLLPS-IEGEYSAVKTLLDRNGVMITMPKKS--GDNDLLQDLNRLLRFAKGQQEDATGLKELQLQLASN--ALKTAIKYLDLVNDAGNLGHYEIKQLDLNRFVHLDSAAVAALNIMPKPGTHPSMPSYRWQSVLGVLDHCRTPQGHRLMGQWVKQPLRSRNILNDRHNIVQCLLESPDTMETLSLDYLKRIPDILMLTKKLMRRKANLQDLFRIYQVILRTPKILKVLHELDN---STIESVICAPFKSFLKDLTGLKQMVEQVVDFEAIERGEYLVKASFDSRLMELQQMMTELYSKMEELQFKCSQELNLDGKNQVKLESVAKLGHHFRITVKDDSVLRKNKNYRIVDVIKGGVRFTSDKLEGYADEFASCRTRYEEQQLSIVEEIIHVAVGYAAPLTLLNNELAQLDCLVSFAIAARSAPTPYVRPKMLEE-GARELVLEDVRHPCLELQEHVNFIANSVDFKKEECNMF-IITGPNMGGKSTYIRSVGTAVLMAHIGAFVPCSLATISMVDSILGRVGASDNIIKGLSTFMVEMIETSGIIRTATDKSLVIIDELGRGTSTYEGCGIAWSIAEHLAKETKCFTLFATHFHEITKLAETLSTVKNCHMAAVADADDFTLLYQVRSGVMEKSFGIQVARLANFPEHVVQNAQEVYNEFED------EHVDKQKKEDKALLE 866          
BLAST of Msh2 vs. Ensembl Fly
Match: spel1 (gene:FBgn0015546 transcript:FBtr0344019)

HSP 1 Score: 512.301 bits (1318), Expect = 1.125e-167
Identity = 315/878 (35.88%), Postives = 501/878 (57.06%), Query Frame = 1
Query:    7 NMDELTNS---FSLFWNSLGDKPNSTIRFFDRQDYYTVH-FEDAEMLARSYYKSMEILKYFRRDSVSSP--YINISKSNSDGVFKYLLIANQYKVEVYSNNKSHDSWNLDFVATPGNLEKYQDILFKDVELVSSNSLLGLNIK-RINDDYRIFLGFCDLDNGIFMIGGF--EESFTGYEQLANLSSALFQLNCRECLIPNDTRPELLAVKNAVQSAGLLVTEVKKSFFSSENVMNSILKLICKTKLNNEN-TVLKLVDTEGAETIGCLGSVITYLDLANDESFFNFFDVQTFKLDNYMRVGEQCSRALNILPSPNDLR-----KHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLINDNKLRGCLYEENLRRIPDLQRITRRLQRNKGNLQDIYKLYVALRQASDMLNLLNEHNGPYKCIIQSELSSVIQEILKDTENFIQMFTSFFDFEAVKNHEFKVKCDVDESLKECENSMITLKSQMETESSRVSDKLGIESTKQLKFESSNSLGYYMRVSRKDENVLRNKSFISIIETLKDGVKFHSTQMTLMNESYLQHXXXXXXXXXXXXXXXMKITNKYVGSLHQLSSIIAKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVEMQNNMSYIANDISF--DESRTFQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIHCNVNNLHVTAQTIGNELIFMYKVEEGPAVRSYGIEVAKASGLPDESIKLAKLKLSEYENLMEWDSNHSEKLAATRNALME 2589
            NMD  TN+   F  F   LG+KP +T+RFFD  D YTVH  +D E++A+  YKS   +     D       ++++SK N +   + LL+   Y+VEVY  N S   W +++  +PGNL +++DILF + E++  NS++ L +K       R+ +   + ++  F +  F  ++ FT       L + +  L  +ECL+P+    E  AVK  +   G+++T  KKS     +++  + +L+   K   E+ T LK +  + A     L + I YLDL ND      ++++   L+ ++ +      ALNI+P P         +  S+ G+L+ CRT  G RL+ QW+KQPL   N++N+R +IV+ L+        L  + L+RIPD+  +T++L R K NLQD++++Y  + +   +L +L+E +      I+S + +  +  LKD     QM     DFEA++  E+ VK   D  L E +  M  L S+ME    + S +L ++   Q+K ES   LG++ R++ KD++VLR      I++ +K GV+F S ++    + +   R  YEE + SI+EEI+ +   Y   L  L++ +A+LD L S A     AP  Y RPK++++   R   +++ RHP +E+Q ++++IAN + F  +E   F IITGPNMGGKSTYIRS+G   +MA IG+FVPC  A IS+ D I+ R+GA D  + G+STFM EM++ S I++TAT KSL+IIDELGRGTST++G G+AWSI+EH+A E K F+ FATHFHE+T L++    V N H+ A    ++   +Y+V  G   +S+GI+VA+ +  P+  ++ A+   +E+E+       H +K      AL+E
Sbjct:   15 NMD--TNARRNFIKFHAKLGEKPATTVRFFDHTDRYTVHGSDDCELVAKIVYKSTAFIGALLPDDKKETLQFVSMSKGNFELAVRELLLVRNYRVEVYVKNSS--DWEIEYRGSPGNLLQFEDILFSNKEVLVGNSIISLLVKLDGGGQRRVGVASVEQNDCKFQLLEFLDDDFFT------ELEATVVLLGPKECLLPS-IEGEYSAVKTLLDRNGVMITMPKKS--GDNDLLQDLNRLLRFAKGQQEDATGLKELQLQLASN--ALKTAIKYLDLVNDAGNLGHYEIKQLDLNRFVHLDSAAVAALNIMPKPGTHPSMPSYRWQSVLGVLDHCRTPQGHRLMGQWVKQPLRSRNILNDRHNIVQCLLESPDTMETLSLDYLKRIPDILMLTKKLMRRKANLQDLFRIYQVILRTPKILKVLHELDN---STIESVICAPFKSFLKDLTGLKQMVEQVVDFEAIERGEYLVKASFDSRLMELQQMMTELYSKMEELQFKCSQELNLDGKNQVKLESVAKLGHHFRITVKDDSVLRKNKNYRIVDVIKGGVRFTSDKLEGYADEFASCRTRYEEQQLSIVEEIIHVAVGYAAPLTLLNNELAQLDCLVSFAIAARSAPTPYVRPKMLEE-GARELVLEDVRHPCLELQEHVNFIANSVDFKKEECNMF-IITGPNMGGKSTYIRSVGTAVLMAHIGAFVPCSLATISMVDSILGRVGASDNIIKGLSTFMVEMIETSGIIRTATDKSLVIIDELGRGTSTYEGCGIAWSIAEHLAKETKCFTLFATHFHEITKLAETLSTVKNCHMAAVADADDFTLLYQVRSGVMEKSFGIQVARLANFPEHVVQNAQEVYNEFED------EHVDKQKKEDKALLE 866          
BLAST of Msh2 vs. Ensembl Fly
Match: spel1 (gene:FBgn0015546 transcript:FBtr0080630)

HSP 1 Score: 512.301 bits (1318), Expect = 1.125e-167
Identity = 315/878 (35.88%), Postives = 501/878 (57.06%), Query Frame = 1
Query:    7 NMDELTNS---FSLFWNSLGDKPNSTIRFFDRQDYYTVH-FEDAEMLARSYYKSMEILKYFRRDSVSSP--YINISKSNSDGVFKYLLIANQYKVEVYSNNKSHDSWNLDFVATPGNLEKYQDILFKDVELVSSNSLLGLNIK-RINDDYRIFLGFCDLDNGIFMIGGF--EESFTGYEQLANLSSALFQLNCRECLIPNDTRPELLAVKNAVQSAGLLVTEVKKSFFSSENVMNSILKLICKTKLNNEN-TVLKLVDTEGAETIGCLGSVITYLDLANDESFFNFFDVQTFKLDNYMRVGEQCSRALNILPSPNDLR-----KHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLINDNKLRGCLYEENLRRIPDLQRITRRLQRNKGNLQDIYKLYVALRQASDMLNLLNEHNGPYKCIIQSELSSVIQEILKDTENFIQMFTSFFDFEAVKNHEFKVKCDVDESLKECENSMITLKSQMETESSRVSDKLGIESTKQLKFESSNSLGYYMRVSRKDENVLRNKSFISIIETLKDGVKFHSTQMTLMNESYLQHXXXXXXXXXXXXXXXMKITNKYVGSLHQLSSIIAKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVEMQNNMSYIANDISF--DESRTFQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIHCNVNNLHVTAQTIGNELIFMYKVEEGPAVRSYGIEVAKASGLPDESIKLAKLKLSEYENLMEWDSNHSEKLAATRNALME 2589
            NMD  TN+   F  F   LG+KP +T+RFFD  D YTVH  +D E++A+  YKS   +     D       ++++SK N +   + LL+   Y+VEVY  N S   W +++  +PGNL +++DILF + E++  NS++ L +K       R+ +   + ++  F +  F  ++ FT       L + +  L  +ECL+P+    E  AVK  +   G+++T  KKS     +++  + +L+   K   E+ T LK +  + A     L + I YLDL ND      ++++   L+ ++ +      ALNI+P P         +  S+ G+L+ CRT  G RL+ QW+KQPL   N++N+R +IV+ L+        L  + L+RIPD+  +T++L R K NLQD++++Y  + +   +L +L+E +      I+S + +  +  LKD     QM     DFEA++  E+ VK   D  L E +  M  L S+ME    + S +L ++   Q+K ES   LG++ R++ KD++VLR      I++ +K GV+F S ++    + +   R  YEE + SI+EEI+ +   Y   L  L++ +A+LD L S A     AP  Y RPK++++   R   +++ RHP +E+Q ++++IAN + F  +E   F IITGPNMGGKSTYIRS+G   +MA IG+FVPC  A IS+ D I+ R+GA D  + G+STFM EM++ S I++TAT KSL+IIDELGRGTST++G G+AWSI+EH+A E K F+ FATHFHE+T L++    V N H+ A    ++   +Y+V  G   +S+GI+VA+ +  P+  ++ A+   +E+E+       H +K      AL+E
Sbjct:   15 NMD--TNARRNFIKFHAKLGEKPATTVRFFDHTDRYTVHGSDDCELVAKIVYKSTAFIGALLPDDKKETLQFVSMSKGNFELAVRELLLVRNYRVEVYVKNSS--DWEIEYRGSPGNLLQFEDILFSNKEVLVGNSIISLLVKLDGGGQRRVGVASVEQNDCKFQLLEFLDDDFFT------ELEATVVLLGPKECLLPS-IEGEYSAVKTLLDRNGVMITMPKKS--GDNDLLQDLNRLLRFAKGQQEDATGLKELQLQLASN--ALKTAIKYLDLVNDAGNLGHYEIKQLDLNRFVHLDSAAVAALNIMPKPGTHPSMPSYRWQSVLGVLDHCRTPQGHRLMGQWVKQPLRSRNILNDRHNIVQCLLESPDTMETLSLDYLKRIPDILMLTKKLMRRKANLQDLFRIYQVILRTPKILKVLHELDN---STIESVICAPFKSFLKDLTGLKQMVEQVVDFEAIERGEYLVKASFDSRLMELQQMMTELYSKMEELQFKCSQELNLDGKNQVKLESVAKLGHHFRITVKDDSVLRKNKNYRIVDVIKGGVRFTSDKLEGYADEFASCRTRYEEQQLSIVEEIIHVAVGYAAPLTLLNNELAQLDCLVSFAIAARSAPTPYVRPKMLEE-GARELVLEDVRHPCLELQEHVNFIANSVDFKKEECNMF-IITGPNMGGKSTYIRSVGTAVLMAHIGAFVPCSLATISMVDSILGRVGASDNIIKGLSTFMVEMIETSGIIRTATDKSLVIIDELGRGTSTYEGCGIAWSIAEHLAKETKCFTLFATHFHEITKLAETLSTVKNCHMAAVADADDFTLLYQVRSGVMEKSFGIQVARLANFPEHVVQNAQEVYNEFED------EHVDKQKKEDKALLE 866          
BLAST of Msh2 vs. Ensembl Fly
Match: spel1 (gene:FBgn0015546 transcript:FBtr0309281)

HSP 1 Score: 512.301 bits (1318), Expect = 1.125e-167
Identity = 315/878 (35.88%), Postives = 501/878 (57.06%), Query Frame = 1
Query:    7 NMDELTNS---FSLFWNSLGDKPNSTIRFFDRQDYYTVH-FEDAEMLARSYYKSMEILKYFRRDSVSSP--YINISKSNSDGVFKYLLIANQYKVEVYSNNKSHDSWNLDFVATPGNLEKYQDILFKDVELVSSNSLLGLNIK-RINDDYRIFLGFCDLDNGIFMIGGF--EESFTGYEQLANLSSALFQLNCRECLIPNDTRPELLAVKNAVQSAGLLVTEVKKSFFSSENVMNSILKLICKTKLNNEN-TVLKLVDTEGAETIGCLGSVITYLDLANDESFFNFFDVQTFKLDNYMRVGEQCSRALNILPSPNDLR-----KHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLINDNKLRGCLYEENLRRIPDLQRITRRLQRNKGNLQDIYKLYVALRQASDMLNLLNEHNGPYKCIIQSELSSVIQEILKDTENFIQMFTSFFDFEAVKNHEFKVKCDVDESLKECENSMITLKSQMETESSRVSDKLGIESTKQLKFESSNSLGYYMRVSRKDENVLRNKSFISIIETLKDGVKFHSTQMTLMNESYLQHXXXXXXXXXXXXXXXMKITNKYVGSLHQLSSIIAKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVEMQNNMSYIANDISF--DESRTFQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIHCNVNNLHVTAQTIGNELIFMYKVEEGPAVRSYGIEVAKASGLPDESIKLAKLKLSEYENLMEWDSNHSEKLAATRNALME 2589
            NMD  TN+   F  F   LG+KP +T+RFFD  D YTVH  +D E++A+  YKS   +     D       ++++SK N +   + LL+   Y+VEVY  N S   W +++  +PGNL +++DILF + E++  NS++ L +K       R+ +   + ++  F +  F  ++ FT       L + +  L  +ECL+P+    E  AVK  +   G+++T  KKS     +++  + +L+   K   E+ T LK +  + A     L + I YLDL ND      ++++   L+ ++ +      ALNI+P P         +  S+ G+L+ CRT  G RL+ QW+KQPL   N++N+R +IV+ L+        L  + L+RIPD+  +T++L R K NLQD++++Y  + +   +L +L+E +      I+S + +  +  LKD     QM     DFEA++  E+ VK   D  L E +  M  L S+ME    + S +L ++   Q+K ES   LG++ R++ KD++VLR      I++ +K GV+F S ++    + +   R  YEE + SI+EEI+ +   Y   L  L++ +A+LD L S A     AP  Y RPK++++   R   +++ RHP +E+Q ++++IAN + F  +E   F IITGPNMGGKSTYIRS+G   +MA IG+FVPC  A IS+ D I+ R+GA D  + G+STFM EM++ S I++TAT KSL+IIDELGRGTST++G G+AWSI+EH+A E K F+ FATHFHE+T L++    V N H+ A    ++   +Y+V  G   +S+GI+VA+ +  P+  ++ A+   +E+E+       H +K      AL+E
Sbjct:   15 NMD--TNARRNFIKFHAKLGEKPATTVRFFDHTDRYTVHGSDDCELVAKIVYKSTAFIGALLPDDKKETLQFVSMSKGNFELAVRELLLVRNYRVEVYVKNSS--DWEIEYRGSPGNLLQFEDILFSNKEVLVGNSIISLLVKLDGGGQRRVGVASVEQNDCKFQLLEFLDDDFFT------ELEATVVLLGPKECLLPS-IEGEYSAVKTLLDRNGVMITMPKKS--GDNDLLQDLNRLLRFAKGQQEDATGLKELQLQLASN--ALKTAIKYLDLVNDAGNLGHYEIKQLDLNRFVHLDSAAVAALNIMPKPGTHPSMPSYRWQSVLGVLDHCRTPQGHRLMGQWVKQPLRSRNILNDRHNIVQCLLESPDTMETLSLDYLKRIPDILMLTKKLMRRKANLQDLFRIYQVILRTPKILKVLHELDN---STIESVICAPFKSFLKDLTGLKQMVEQVVDFEAIERGEYLVKASFDSRLMELQQMMTELYSKMEELQFKCSQELNLDGKNQVKLESVAKLGHHFRITVKDDSVLRKNKNYRIVDVIKGGVRFTSDKLEGYADEFASCRTRYEEQQLSIVEEIIHVAVGYAAPLTLLNNELAQLDCLVSFAIAARSAPTPYVRPKMLEE-GARELVLEDVRHPCLELQEHVNFIANSVDFKKEECNMF-IITGPNMGGKSTYIRSVGTAVLMAHIGAFVPCSLATISMVDSILGRVGASDNIIKGLSTFMVEMIETSGIIRTATDKSLVIIDELGRGTSTYEGCGIAWSIAEHLAKETKCFTLFATHFHEITKLAETLSTVKNCHMAAVADADDFTLLYQVRSGVMEKSFGIQVARLANFPEHVVQNAQEVYNEFED------EHVDKQKKEDKALLE 866          
BLAST of Msh2 vs. Ensembl Fly
Match: Msh6 (gene:FBgn0036486 transcript:FBtr0075646)

HSP 1 Score: 170.244 bits (430), Expect = 6.514e-43
Identity = 104/273 (38.10%), Postives = 145/273 (53.11%), Query Frame = 1
Query: 1714 KITNKYVGSLHQLSSIIAKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVEMQNNMSYIANDISFDESR--TFQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTD---------LSKIHCNVNNLHVTAQTIGNELIFMYKVEEGPAVRSYGIEVAKASGLPDESIKLA 2499
            K +N Y     Q    +A LDVL SLA    G       P++V D      +++   HP     N  +YI N +    +      ++TGPNMGGKST +R +GL+ +MAQIG+ +P     +S+ DRI TR+GA D  L G STF+ E+ + S ILK AT  SL+++DELGRGT+T+DG  +A S+   +A  LK  + F+TH+H L D         L  + C V N    A      + F+YK   G   +SYG   AK +G+P   IK A
Sbjct:  875 KFSNHY-DQWKQCIDCVANLDVLGSLAEYA-GQQMVICVPELVSDADQPFIQLEEGYHPCA---NASTYIPNGLELGTASEAPLSLLTGPNMGGKSTLMREVGLLVIMAQIGAHIPAASCRLSLVDRIFTRLGAQDDILAGHSTFLVELNETSLILKHATCHSLVLLDELGRGTATYDGTAIAASVVNFLAN-LKCRTLFSTHYHNLIDFFHNDKRITLGHMACMVEN-EDNADPTQETVTFLYKYTAGACPKSYGFNAAKLAGMPQGIIKRA 1140          
BLAST of Msh2 vs. Ensembl Zebrafish
Match: msh2 (mutS homolog 2 (E. coli) [Source:ZFIN;Acc:ZDB-GENE-040426-2932])

HSP 1 Score: 625.165 bits (1611), Expect = 0.000e+0
Identity = 346/873 (39.63%), Postives = 538/873 (61.63%), Query Frame = 1
Query:    1 N*NMDELT-NSFSLFWNSLGDKPNSTIRFFDRQDYYTVHFEDAEMLARSYYKSMEILKYFRRDSVSSPYINISKSNSDGVFKYLLIANQYKVEVYSN----NKSHDSWNLDFVATPGNLEKYQDILFKDVELVSSNSL--LGLNIKRINDDYRIFLGFCDLDNGIFMIGGFEESFTGYEQLANLSSALFQLNCRECLIP-NDTRPELLAVKNAVQSAGLLVTEVKKSFFSSENVMNSILKLICKTKLNNENTVLKLVDTEGAETIGCLGSVITYLDLANDESFFNFFDVQTFKLDNYMRVGEQCSRALNILP-SPNDLRKHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLINDNKLRGCLYEENLRRIPDLQRITRRLQRNKGNLQDIYKLYVALRQASDMLNLLNEHNGPYKCIIQSELSSVIQEILKDTENFIQMFTSFFDFEAVKNHEFKVKCDVDESLKECENSMITLKSQMETESSRVSDKLGIESTKQLKFESSNSLGYYMRVSRKDENVLRNKSFISIIETLKDGVKFHSTQMTLMNESYLQHXXXXXXXXXXXXXXXMKITNKYVGSLHQLSSIIAKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVEMQNNMSYIANDISFDES-RTFQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIHCNVNNLHVTAQTIGNELIFMYKVEEGPAVRSYGIEVAKASGLPDESIKLAKLKLSEYENLMEWDSNHSEKLAATRNALME 2589
            N +MD  + + F  F+ S+ DKP++T+R FDR DYYTVH +DA   A+  +K+  ++K     +     + +SK N +   + LL+  QY+VEVY N    +K HD W + F A+PGNL ++++ILF      +  ++  +G+ +    D  R+ +G   +D+ +  +G  E  F   +Q +NL + L Q+  +EC++P  D+  +L  +K  VQ  G+L+T+ KKS F++++++  + +L+ K +     +   L + E    + CL +VI YL+L  DE+ F  F + TF L+ YMR+     +ALN+   S +D     SL GLLN CRT  G+RL+ QWIKQPL+D N I  RLD+VE+ + D++LR    E+ LRR PDL R+ ++ QR   NLQD Y++Y ++ Q  +++  L  ++G ++ ++ +   S + +++ D   F +M  +  D   V++HEF VK   D +L +   +M  L+  M+   S  + +LG+E+ K +K ES+  +GY+ RV+ K+E  LRN    + ++  K+GV+F +++++ +NE Y + R +YEE + +I++EI+ I   YV  +  L+ +IA+LD + S A +   AP  + RPK+++    R+  +K  RHP VE Q+ +++I ND++F    + F IITGPNMGGKSTYIR +G+I +MAQIG FVPCD AE+S+ D ++ R+GAGD Q+ GVSTFMAEML+ + IL++A+  SLIIIDELGRGTST+DGFGLAW+ISE+IAT LK+F  FATHFHELT L++    V NLHVTA T  + L  +YKV++G   +S+GI VA+ +  P   I  A+ K  E E   +  S   E     +   ME
Sbjct:    8 NLSMDSASEHGFLNFYFSMSDKPDTTVRVFDRNDYYTVHGKDAIFAAKEVFKTNGVIKNLGSGNRRLESVVLSKMNFESFVRDLLLVRQYRVEVYKNASKSSKEHD-WQIAFKASPGNLTQFEEILFGSGGGPAEGAVGVVGVRLGTGTDGQRV-VGVGYVDSTLRKLGVCE--FPDNDQFSNLEALLVQIGPKECVLPAGDSGGDLGKLKQVVQRGGILLTDRKKSEFTTKDIVQDLNRLL-KARKGETVSSAALPEMEKKIAMSCLEAVIKYLELLADEANFGSFKMTTFDLNQYMRLDNAAVQALNLFQGSSDDATGTHSLAGLLNKCRTPQGQRLVNQWIKQPLIDKNKIEERLDLVETFVEDSELRKSCQEDLLRRFPDLNRMAKKFQRQSSNLQDCYRVYQSVGQLPNVVLALERYSGKHQVLLHAAFISPLNDLISDFSKFQEMIETTLDMNQVEHHEFLVKPSFDPTLSDLRENMDRLEKAMQAALSSAARELGLEAAKTVKLESNAQIGYFFRVTCKEEKSLRNNKKFTTLDVQKNGVRFTNSKLSSLNEEYTKSREEYEEAQNAIVKEIISIAAGYVDPVQTLNEVIAQLDAVVSFAVVSHAAPVPFIRPKILEKGSGRLV-LKAARHPCVEAQDEVAFIPNDVTFIRGEKMFHIITGPNMGGKSTYIRQVGVIVLMAQIGCFVPCDEAELSVVDCVLARVGAGDSQIKGVSTFMAEMLETAAILRSASEDSLIIIDELGRGTSTYDGFGLAWAISEYIATRLKSFCLFATHFHELTALAQQVPTVRNLHVTALTTDSTLTMLYKVKKGVCDQSFGIHVAELASFPKHVIANAREKALELEEFQDISSVGEEAGPKAKKRCME 874          
BLAST of Msh2 vs. Ensembl Zebrafish
Match: msh2 (mutS homolog 2 (E. coli) [Source:ZFIN;Acc:ZDB-GENE-040426-2932])

HSP 1 Score: 625.165 bits (1611), Expect = 0.000e+0
Identity = 346/873 (39.63%), Postives = 538/873 (61.63%), Query Frame = 1
Query:    1 N*NMDELT-NSFSLFWNSLGDKPNSTIRFFDRQDYYTVHFEDAEMLARSYYKSMEILKYFRRDSVSSPYINISKSNSDGVFKYLLIANQYKVEVYSN----NKSHDSWNLDFVATPGNLEKYQDILFKDVELVSSNSL--LGLNIKRINDDYRIFLGFCDLDNGIFMIGGFEESFTGYEQLANLSSALFQLNCRECLIP-NDTRPELLAVKNAVQSAGLLVTEVKKSFFSSENVMNSILKLICKTKLNNENTVLKLVDTEGAETIGCLGSVITYLDLANDESFFNFFDVQTFKLDNYMRVGEQCSRALNILP-SPNDLRKHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLINDNKLRGCLYEENLRRIPDLQRITRRLQRNKGNLQDIYKLYVALRQASDMLNLLNEHNGPYKCIIQSELSSVIQEILKDTENFIQMFTSFFDFEAVKNHEFKVKCDVDESLKECENSMITLKSQMETESSRVSDKLGIESTKQLKFESSNSLGYYMRVSRKDENVLRNKSFISIIETLKDGVKFHSTQMTLMNESYLQHXXXXXXXXXXXXXXXMKITNKYVGSLHQLSSIIAKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVEMQNNMSYIANDISFDES-RTFQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIHCNVNNLHVTAQTIGNELIFMYKVEEGPAVRSYGIEVAKASGLPDESIKLAKLKLSEYENLMEWDSNHSEKLAATRNALME 2589
            N +MD  + + F  F+ S+ DKP++T+R FDR DYYTVH +DA   A+  +K+  ++K     +     + +SK N +   + LL+  QY+VEVY N    +K HD W + F A+PGNL ++++ILF      +  ++  +G+ +    D  R+ +G   +D+ +  +G  E  F   +Q +NL + L Q+  +EC++P  D+  +L  +K  VQ  G+L+T+ KKS F++++++  + +L+ K +     +   L + E    + CL +VI YL+L  DE+ F  F + TF L+ YMR+     +ALN+   S +D     SL GLLN CRT  G+RL+ QWIKQPL+D N I  RLD+VE+ + D++LR    E+ LRR PDL R+ ++ QR   NLQD Y++Y ++ Q  +++  L  ++G ++ ++ +   S + +++ D   F +M  +  D   V++HEF VK   D +L +   +M  L+  M+   S  + +LG+E+ K +K ES+  +GY+ RV+ K+E  LRN    + ++  K+GV+F +++++ +NE Y + R +YEE + +I++EI+ I   YV  +  L+ +IA+LD + S A +   AP  + RPK+++    R+  +K  RHP VE Q+ +++I ND++F    + F IITGPNMGGKSTYIR +G+I +MAQIG FVPCD AE+S+ D ++ R+GAGD Q+ GVSTFMAEML+ + IL++A+  SLIIIDELGRGTST+DGFGLAW+ISE+IAT LK+F  FATHFHELT L++    V NLHVTA T  + L  +YKV++G   +S+GI VA+ +  P   I  A+ K  E E   +  S   E     +   ME
Sbjct:    8 NLSMDSASEHGFLNFYFSMSDKPDTTVRVFDRNDYYTVHGKDAIFAAKEVFKTNGVIKNLGSGNRRLESVVLSKMNFESFVRDLLLVRQYRVEVYKNASKSSKEHD-WQIAFKASPGNLTQFEEILFGSGGGPAEGAVGVVGVRLGTGTDGQRV-VGVGYVDSTLRKLGVCE--FPDNDQFSNLEALLVQIGPKECVLPAGDSGGDLGKLKQVVQRGGILLTDRKKSEFTTKDIVQDLNRLL-KARKGETVSSAALPEMEKKIAMSCLEAVIKYLELLADEANFGSFKMTTFDLNQYMRLDNAAVQALNLFQGSSDDATGTHSLAGLLNKCRTPQGQRLVNQWIKQPLIDKNKIEERLDLVETFVEDSELRKSCQEDLLRRFPDLNRMAKKFQRQSSNLQDCYRVYQSVGQLPNVVLALERYSGKHQVLLHAAFISPLNDLISDFSKFQEMIETTLDMNQVEHHEFLVKPSFDPTLSDLRENMDRLEKAMQAALSSAARELGLEAAKTVKLESNAQIGYFFRVTCKEEKSLRNNKKFTTLDVQKNGVRFTNSKLSSLNEEYTKSREEYEEAQNAIVKEIISIAAGYVDPVQTLNEVIAQLDAVVSFAVVSHAAPVPFIRPKILEKGSGRLV-LKAARHPCVEAQDEVAFIPNDVTFIRGEKMFHIITGPNMGGKSTYIRQVGVIVLMAQIGCFVPCDEAELSVVDCVLARVGAGDSQIKGVSTFMAEMLETAAILRSASEDSLIIIDELGRGTSTYDGFGLAWAISEYIATRLKSFCLFATHFHELTALAQQVPTVRNLHVTALTTDSTLTMLYKVKKGVCDQSFGIHVAELASFPKHVIANAREKALELEEFQDISSVGEEAGPKAKKRCME 874          
BLAST of Msh2 vs. Ensembl Zebrafish
Match: msh4 (mutS homolog 4 [Source:ZFIN;Acc:ZDB-GENE-131121-643])

HSP 1 Score: 211.075 bits (536), Expect = 2.406e-56
Identity = 172/582 (29.55%), Postives = 291/582 (50.00%), Query Frame = 1
Query:  928 RKHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLINDNKLRGCLYE------------ENLRRIPDLQ-------RITRRLQRNKGNLQDIYKLYVALRQASDMLNLLNEHNGPYKCIIQSELSSVIQEILKDTENFIQMFTSFFDFEAVKNHE--FKVKCDVDESLKECENSMITLKSQMETESSRVSDKLGIESTKQLKFESSNSLGYYMRVSRKDENVLRNK---SFISIIETLKDGVKFHSTQMTLMNESYLQHXXXXXXXXXXXXXXXMKITNKYVGSLHQLSSIIAKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVEMQNNMSYIANDISFDESRTFQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIHCNVNNLHVTAQTI------GNELIFMYKVEEGPA-VRSYGIEVAKASGLPDESIKLAKLKLSEYENLMEWDSNHSEKLAATRNA 2580
            R   +L+G+LN  +T+ GER L   I +PL++V+ I +R D ++ L+ + +L   L                L +IP  +       +IT+ +Q     L+ I +L  +L+    ML     H     C  +S        IL   ++ I   TS+         +  + V+ +V E L     +     +++  + + +  +LG +    L+   SN+ G+++++  +   +   K    FI + +  K+   F +  +  MN+   +  +D       ++ +++   ++ +  L++LS +++ LD+L SLA   C     Y RP+  D        ++  RHP++E  +    I+N+    E   F IITGPNM GKST+++ + L+ +MAQIG FVP + A + I D+I TRIG  D   T  STFM EM ++S+I+  AT+ SLIIIDELGRGTS  +G G+  S+ E +   LKAF+ FATHF EL  L  ++ NV N H+  Q I         +++ Y++  G +  R+YGI  A+ + LP + I+ AK  +++  N   W  +HS+     + A
Sbjct:  322 RSEHTLFGVLNHTKTSGGERRLRSNILEPLLEVDTIKSRQDTIQELLQNEELFFSLKNAIAHFLDIDELLSALVQIPKQETIAVAEAKITQVIQ-----LKHIVELVPSLKV---MLQHSTTHLLTAYC--KSLEDCRFNSILDHIKSLINDDTSYMKGSLTMRTQKCYAVRPNVSEFLDIARRAY----TEVVDDIAGLVAQLGEKHNLPLRTSFSNARGFFIQMKLEGGALPGGKLPDEFIKVSKQ-KNNFSFTTLDLMKMNDHCEEALKDIFHMSYVVVSKLLNEVHEQIHCLYKLSDVVSMLDMLLSLAN-ACTI-SNYVRPEFTD-----TLAIQQGRHPVLERISGQQPISNNSYISEGSNFVIITGPNMSGKSTFLKQVALVQIMAQIGCFVPAEYASVRIADQIFTRIGVDDDFETNSSTFMVEMKEVSYIIHNATNSSLIIIDELGRGTSPEEGIGICHSVCEFL-INLKAFTLFATHFLELCQLQTLYPNVENQHMQVQHIRTGDGRAERVVYTYQLSRGHSEERNYGIRAAEMTNLPLDIIQEAK-TVADKINQKLWAKHHSDPATLKQRA 879          
BLAST of Msh2 vs. Ensembl Zebrafish
Match: msh3 (mutS homolog 3 (E. coli) [Source:ZFIN;Acc:ZDB-GENE-060526-307])

HSP 1 Score: 209.92 bits (533), Expect = 1.253e-55
Identity = 204/737 (27.68%), Postives = 344/737 (46.68%), Query Frame = 1
Query:  469 GIFMIGGFEESFTGYEQLANLSSALFQLNCRECLIPND---TRPELLA--VKNAVQSAGLLVTEVKKSFFSSENVMNSILKLICK-----TKLNNENTVLKLVDTEGAETIGCLGSVITYLDLANDESFFNFFDVQTFKL----DNYMRVGEQCSRALNILPSPNDLRKHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLINDNKLRGCLYEENLRRIPDLQRITRRLQRNKGNLQDIYKLYVALRQASDMLNLLNEHNGPYKCIIQSELSS-VIQEILKDTENFIQMFTSFFDFEAVKNHEFKVKCDVDESLKECENSMITLKSQMETESSRVSDKLGIESTKQLKFESSNSLGYYMRVSRKDENVLRNKSFISIIETLKDGVKFHSTQM--------TLMNESYLQHXXXXXXXXXXXXXXXMKITNKYVGSLHQLSS---IIAKLDVLCSLATMVC-------GAPGTYARPKVVDDCKTRVFKVKNCRHPLVE--MQNNMSYIANDISFD-ESRTFQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIHC-NVNNLHVT-----AQTIGNE-------LIFMYKVEEGPAVRSYGIEVAKASGLPDESIKLAKLKLSEYENLM 2532
            G  M+  F+++ +  E    L S + ++   E L+P+D   T   LL     ++VQ+   +  E ++S         SI+K   +        N+E     +     +  I CLG VI YL     E         +FK      ++M +     + L IL +        SL  +L+  +T  G+RLL +W+ QPL  V  I  R + V  +++         +  L R+PDL+R    +   + + Q+ Y +  +L + +  L  L          IQS+LSS +++ +L DT    Q+ +   +F  V N +     +  E   +  +  +  K++ E ES  +     +E  ++++    N    Y  VS +   +    S +SI+    D VK  ST++         +     LQ  R+            +   ++++  L        I+ K   +C LATM C            Y RP+V+++ K+++  +   +HP++   M +   Y+ ND     + +   IITGPNMGGKS+YIR + L+++MAQ+GSFVP   A + I D I  R+GA D    G STFM E+L+ S +L  ATS+SL+I+DELGRGTST DG  +A++  E    E++  + F TH+  L +L  ++  +V N H+       ++  +E       + F+Y++ EG A RSYG+ VA+ + +P+  ++ A  K  E E L+
Sbjct:  353 GDVMVDCFKDNMSHSE----LESRILRIQPVEILVPSDLSETTERLLRNIALSSVQADDRIRIEKRESAMFEYPTALSIIKDFYRGGPHSAARNHEKGSYSICMGLESPIICCLGPVIQYLTEFKLEKIL--LCSSSFKRLSSDPDHMLLSAATMKNLEILCNQTTGSVKGSLLWVLDHTQTLFGKRLLRKWVSQPLKSVIDIQARQEAVAEILSSESSVLPSIQSLLTRLPDLERGLCSIYHKRCSTQEFYLIISSLSRLNVELQALMP-------AIQSQLSSPLLKTLLLDTP---QLLSPAHNFLKVLNEKAAKTGNKTEMFVDLTDFPVIRKTKEEIESVLLDI---MEHRREVRLLLKNPSLDYTTVSGQQFLIEVKNSMLSIVPA--DWVKISSTKVFGRYHTPFIVEKHRRLQQLREQLV---------IDCNHEWINFLQLFGDHYYILRK--AVCHLATMDCLFSLAQVAKENNYCRPEVLEE-KSQIL-ITAGKHPVITSLMGDQDQYVPNDTHLQGDGKRAMIITGPNMGGKSSYIRQVALVTIMAQLGSFVPAREASVGIVDGIYVRMGASDNISRGRSTFMEELLETSDVLACATSRSLVILDELGRGTSTHDGIAIAYATLESFIREVRCMTLFVTHYPPLCELEHLYPQHVGNYHMAFLLNEPESTSDEEEAQPEFITFLYQLIEGAAARSYGLNVARLAEIPESILRTAAFKSKELEALV 1055          
BLAST of Msh2 vs. Ensembl Zebrafish
Match: msh3 (mutS homolog 3 (E. coli) [Source:ZFIN;Acc:ZDB-GENE-060526-307])

HSP 1 Score: 204.912 bits (520), Expect = 5.688e-54
Identity = 204/738 (27.64%), Postives = 345/738 (46.75%), Query Frame = 1
Query:  469 GIFMIGGFEESFTGYEQLANLSSALFQLNCRECLIPND---TRPELLA--VKNAVQSAGLLVTEVKKSFFSSENVMNSILKLICK-----TKLNNENTVLKLVDTEGAETIGCLGSVITYLDLANDESFFNFFDVQTFKL----DNYMRVGEQCSRALNILPSPNDLRKHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLINDNKLRGCLYEENLRRIPDLQRITRRLQRNKGNLQDIY---KLYVALRQASDMLNLLNEHNGPYKCIIQSELSS-VIQEILKDTENFIQMFTSFFDFEAVKNHEFKVKCDVDESLKECENSMITLKSQMETESSRVSDKLGIESTKQLKFESSNSLGYYMRVSRKDENVLRNKSFISIIETLKDGVKFHSTQM------TLMNESYLQHXXXXXXXXXXXXXXXMKITNKYVGSLHQLSS---IIAKLDVLCSLATMVC-------GAPGTYARPKVVDDCKTRVFKVKNCRHPLVE--MQNNMSYIANDISFD-ESRTFQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIHC-NVNNLHVT-----AQTIGNE-------LIFMYKVEEGPAVRSYGIEVAKASGLPDESIKLAKLKLSEYENLM 2532
            G  M+  F+++ +  E    L S + ++   E L+P+D   T   LL     ++VQ+   +  E ++S         SI+K   +        N+E     +     +  I CLG VI YL     E         +FK      ++M +     + L IL +        SL  +L+  +T  G+RLL +W+ QPL  V  I  R + V  +++         +  L R+PDL+R           L  IY   + Y+ +      L+ LN         IQS+LSS +++ +L DT    Q+ +   +F  V N +     +  E   +  +  +  K++ E ES  +     +E  ++++    N    Y  VS +   +    S +SI+    D VK  ST++        + E + +        ++   + ++   ++++  L        I+ K   +C LATM C            Y RP+V+++ K+++  +   +HP++   M +   Y+ ND     + +   IITGPNMGGKS+YIR + L+++MAQ+GSFVP   A + I D I  R+GA D    G STFM E+L+ S +L  ATS+SL+I+DELGRGTST DG  +A++  E    E++  + F TH+  L +L  ++  +V N H+       ++  +E       + F+Y++ EG A RSYG+ VA+ + +P+  ++ A  K  E E L+
Sbjct:  353 GDVMVDCFKDNMSHSE----LESRILRIQPVEILVPSDLSETTERLLRNIALSSVQADDRIRIEKRESAMFEYPTALSIIKDFYRGGPHSAARNHEKGSYSICMGLESPIICCLGPVIQYLTEFKLEKIL--LCSSSFKRLSSDPDHMLLSAATMKNLEILCNQTTGSVKGSLLWVLDHTQTLFGKRLLRKWVSQPLKSVIDIQARQEAVAEILSSESSVLPSIQSLLTRLPDLER----------GLCSIYHKREFYLIISS----LSRLNVELQALMPAIQSQLSSPLLKTLLLDTP---QLLSPAHNFLKVLNEKAAKTGNKTEMFVDLTDFPVIRKTKEEIESVLLDI---MEHRREVRLLLKNPSLDYTTVSGQQFLIEVKNSMLSIVPA--DWVKISSTKVFGRYHTPFIVEKHRR-------LQQLREQLVIDCNHEWINFLQLFGDHYYILRK--AVCHLATMDCLFSLAQVAKENNYCRPEVLEE-KSQIL-ITAGKHPVITSLMGDQDQYVPNDTHLQGDGKRAMIITGPNMGGKSSYIRQVALVTIMAQLGSFVPAREASVGIVDGIYVRMGASDNISRGRSTFMEELLETSDVLACATSRSLVILDELGRGTSTHDGIAIAYATLESFIREVRCMTLFVTHYPPLCELEHLYPQHVGNYHMAFLLNEPESTSDEEEAQPEFITFLYQLIEGAAARSYGLNVARLAEIPESILRTAAFKSKELEALV 1051          
BLAST of Msh2 vs. Ensembl Xenopus
Match: MSH2 (mutS homolog 2 [Source:NCBI gene;Acc:100380043])

HSP 1 Score: 645.58 bits (1664), Expect = 0.000e+0
Identity = 349/868 (40.21%), Postives = 543/868 (62.56%), Query Frame = 1
Query:   25 NSFSLFWNSLGDKPNSTIRFFDRQDYYTVHFEDAEMLARSYYKSMEILKYFRRDSVSSPYINISKSNSDGVFKYLLIANQYKVEVYSNNKSHDS-----WNLDFVATPGNLEKYQDILFKDVELVSSNSLLGLNIKRINDDYRIFLGFCDLDNGIFMIGGFEESFTGYEQLANLSSALFQLNCRECLIPN-DTRPELLAVKNAVQSAGLLVTEVKKSFFSSENVMNSILKLICKTKLNNENTVLKLVDTEGAETIGCLGSVITYLDLANDESFFNFFDVQTFKLDNYMRVGEQCSRALNILP-SPNDLRKHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLINDNKLRGCLYEENLRRIPDLQRITRRLQRNKGNLQDIYKLYVALRQASDMLNLLNEHNGPYKCIIQSELSSVIQEILKDTENFIQMFTSFFDFEAVKNHEFKVKCDVDESLKECENSMITLKSQMETESSRVSDKLGIESTKQLKFESSNSLGYYMRVSRKDENVLRNKSFISIIETLKDGVKFHSTQMTLMNESYLQHXXXXXXXXXXXXXXXMKITNKYVGSLHQLSSIIAKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVEMQNNMSYIANDISFD-ESRTFQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIHCNVNNLHVTAQTIGNELIFMYKVEEGPAVRSYGIEVAKASGLPDESIKLAK---LKLSEYENLMEWDSNHSEKLAATRNALMEFC 2595
            N F  F+ S+ +KP++T+R FDR DYYTVH  DA   A+  +K+  ++KY    +     + +SK N + V K LL+  QY+VEVY N     S     W L F A+PGNL ++++ILF + ++ ++  ++G  IK ++ + +  +G   +D+ +  +G  E  F   +Q +NL + L Q+  +EC++P  DT  ++  ++  V+  G+L+T+ KK+ F++++ +  + +L+ K K   + T   L + E    +  L SV+ YL+L +DES F  F +  F L  YM++      ALN+ P S  D     SL GLLN C+T  G+RL+ QWIKQPLMD N I  RL++VE+ + D +LR CL E+ LRR PDL R+ ++ QR   NLQD Y+LY A+ Q   ++  + ++ G ++ ++ +  ++ + ++  D   F +M  +  D + V+NHEF VK   D +L E    M  L+  M+   +  + +LG+++ K +K ES++ +G++ RV+ K+E  LRN    + I+  K+GV+F + +++ ++E Y+++R +YEE + +I++EI+ I+  YV  +  L+ +IA+LD   S A +   AP  Y RP +++  + ++  +++ RHP +EMQ+++++I NDI+F+ E + F IITGPNMGGKSTYIR  G+I +MAQIGSFVPCD AEISI D I+ R+GAGD QL GVSTFMAEML+ + IL++AT  SLIIIDELGRGTST+DGFGLAW+ISE+I+T++KAF  FATHFHELT L+     VNNLHVTA T  + L  +Y+++ G   +S+GI VA+ +  P   I+ AK   L+L E++ +   D    E     R    E C
Sbjct:   17 NGFISFYQSMPEKPDTTVRVFDRNDYYTVHGGDAIFAAKEVFKTNGVIKYLGSGASKLESVVLSKMNFESVVKDLLLVRQYRVEVYKNKSGGKSSKENDWQLAFKASPGNLTQFEEILFGNSDMSTAVGVVG--IKLVSAEGQRLVGVGYVDSTLRKLGVCE--FPDNDQFSNLEALLVQIGPKECVMPGGDTAGDMGKLRQIVKRGGILITDRKKAEFTTKDSVQDLNRLL-KAKKGEQVTSAALPEMEKQVAMSALASVMKYLELLSDESNFGQFVMTNFDLSQYMKLDNAAVGALNLFPGSAEDTSGTQSLAGLLNKCKTPQGQRLVNQWIKQPLMDKNRIEERLNLVEAFVTDAELRQCLQEDLLRRFPDLNRLAKKFQRQTANLQDCYRLYQAVNQLPGVIQAIEKYEGTHQMLLLAVFATPLSDLSSDFSKFQEMIETTLDMDQVENHEFLVKASFDPNLTELREKMNELEKNMQAALNGAARELGLDAGKSIKLESNSQVGHFFRVTCKEEKALRNNKKFTTIDIQKNGVRFTNGKLSSLSEEYMRNREEYEEAQNAIVKEIISISAGYVDPIQTLNDVIAQLDAAVSFAYVSNSAPVPYVRPVILEKGQGKIM-LQSARHPCIEMQDDVAFIPNDITFEKEKQMFHIITGPNMGGKSTYIRQTGVIVLMAQIGSFVPCDSAEISIVDCILARVGAGDSQLKGVSTFMAEMLETASILRSATENSLIIIDELGRGTSTYDGFGLAWAISEYISTKIKAFCMFATHFHELTALADQVPTVNNLHVTALTTEDTLTMLYRIKRGVCDQSFGIHVAELANFPKHVIETAKEKALQLEEFQFVGNPDDCDDEPTRKRRCKEKEVC 878          
BLAST of Msh2 vs. Ensembl Xenopus
Match: MSH2 (mutS homolog 2 [Source:NCBI gene;Acc:100380043])

HSP 1 Score: 639.802 bits (1649), Expect = 0.000e+0
Identity = 345/845 (40.83%), Postives = 536/845 (63.43%), Query Frame = 1
Query:   25 NSFSLFWNSLGDKPNSTIRFFDRQDYYTVHFEDAEMLARSYYKSMEILKYFRRDSVSSPYINISKSNSDGVFKYLLIANQYKVEVYSNNKSHDS-----WNLDFVATPGNLEKYQDILFKDVELVSSNSLLGLNIKRINDDYRIFLGFCDLDNGIFMIGGFEESFTGYEQLANLSSALFQLNCRECLIPN-DTRPELLAVKNAVQS-AGLLVTEVKKSFFSSENVMNSILKLICKTKLNNENTVLKLVDTEGAETIGCLGSVITYLDLANDESFFNFFDVQTFKLDNYMRVGEQCSRALNILP-SPNDLRKHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLINDNKLRGCLYEENLRRIPDLQRITRRLQRNKGNLQDIYKLYVALRQASDMLNLLNEHNGPYKCIIQSELSSVIQEILKDTENFIQMFTSFFDFEAVKNHEFKVKCDVDESLKECENSMITLKSQMETESSRVSDKLGIESTKQLKFESSNSLGYYMRVSRKDENVLRNKSFISIIETLKDGVKFHSTQMTLMNESYLQHXXXXXXXXXXXXXXXMKITNKYVGSLHQLSSIIAKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVEMQNNMSYIANDISFD-ESRTFQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIHCNVNNLHVTAQTIGNELIFMYKVEEGPAVRSYGIEVAKASGLPDESIKLAK---LKLSEYE 2523
            N F  F+ S+ +KP++T+R FDR DYYTVH  DA   A+  +K+  ++KY    S     + +SK N + V K LL+  QY+VEVY N     S     W L F A+PGNL ++++ILF + ++ ++  ++G  IK ++ + +  +G   +D+ +  +G  E  F   +Q +NL + L Q+  +EC++P  DT  ++  ++    S  G+L+T+ KK+ F++++ +  + +L+ K K   + T   L + E    +  L SV+ YL+L +DES F  F +  F L  YM++      ALN+ P S  D     SL GLLN C+T  G+RL+ QWIKQPLMD N I  RL++VE+ + D +LR CL E+ LRR PDL R+ ++ QR   NLQD Y+LY A+ Q   ++  + ++ G ++ ++ +  ++ + ++  D   F +M  +  D + V+NHEF VK   D +L E    M  L+  M+   +  + +LG+++ K +K ES++ +G++ RV+ K+E  LRN    + I+  K+GV+F + +++ ++E Y+++R +YEE + +I++EI+ I+  YV  +  L+ +IA+LD   S A +   AP  Y RP +++  + ++  +++ RHP +EMQ+++++I NDI+F+ E + F IITGPNMGGKSTYIR  G+I +MAQIGSFVPCD AEISI D I+ R+GAGD QL GVSTFMAEML+ + IL++AT  SLIIIDELGRGTST+DGFGLAW+ISE+I+T++KAF  FATHFHELT L+     VNNLHVTA T  + L  +Y+++ G   +S+GI VA+ +  P   I+ AK   L+L E++
Sbjct:   17 NGFISFYQSMPEKPDTTVRVFDRNDYYTVHGGDAIFAAKEVFKTNGVIKYLGSGSKKLESVVLSKMNFESVVKDLLLVRQYRVEVYKNKSGGKSSKENDWQLAFKASPGNLTQFEEILFGNSDMSTAVGVVG--IKLVSAEGQRLVGVGYVDSTLRKLGVCE--FPDNDQFSNLEALLVQIGPKECVMPGGDTAGDMGKLRQVRDSRGGILITDRKKAEFTTKDSVQDLNRLL-KAKKGEQVTSAALPEMEKQVAMSALASVMKYLELLSDESNFGQFVMTNFDLSQYMKLDNAAVGALNLFPGSAEDTSGTQSLAGLLNKCKTPQGQRLVNQWIKQPLMDKNRIEERLNLVEAFVTDAELRQCLQEDLLRRFPDLNRLAKKFQRQTANLQDCYRLYQAVNQLPGVIQAIEKYEGTHQMLLLAVFATPLSDLSSDFSKFQEMIETTLDMDQVENHEFLVKASFDPNLTELREKMNELEKNMQAALNGAARELGLDAGKSIKLESNSQVGHFFRVTCKEEKALRNNKKFTTIDIQKNGVRFTNGKLSSLSEEYMRNREEYEEAQNAIVKEIISISAGYVDPIQTLNDVIAQLDAAVSFAYVSNSAPVPYVRPVILEKGQGKIM-LQSARHPCIEMQDDVAFIPNDITFEKEKQMFHIITGPNMGGKSTYIRQTGVIVLMAQIGSFVPCDSAEISIVDCILARVGAGDSQLKGVSTFMAEMLETASILRSATENSLIIIDELGRGTSTYDGFGLAWAISEYISTKIKAFCMFATHFHELTALADQVPTVNNLHVTALTTEDTLTMLYRIKRGVCDQSFGIHVAELANFPKHVIETAKEKALQLEEFQ 855          
BLAST of Msh2 vs. Ensembl Xenopus
Match: MSH2 (mutS homolog 2 [Source:NCBI gene;Acc:100380043])

HSP 1 Score: 638.647 bits (1646), Expect = 0.000e+0
Identity = 344/845 (40.71%), Postives = 536/845 (63.43%), Query Frame = 1
Query:   25 NSFSLFWNSLGDKPNSTIRFFDRQDYYTVHFEDAEMLARSYYKSMEILKYFRRDSVSSPYINISKSNSDGVFKYLLIANQYKVEVYSNNKSHDS-----WNLDFVATPGNLEKYQDILFKDVELVSSNSLLGLNIKRINDDYRIFLGFCDLDNGIFMIGGFEESFTGYEQLANLSSALFQLNCRECLIPN-DTRPELLAVKNAVQS-AGLLVTEVKKSFFSSENVMNSILKLICKTKLNNENTVLKLVDTEGAETIGCLGSVITYLDLANDESFFNFFDVQTFKLDNYMRVGEQCSRALNILP-SPNDLRKHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLINDNKLRGCLYEENLRRIPDLQRITRRLQRNKGNLQDIYKLYVALRQASDMLNLLNEHNGPYKCIIQSELSSVIQEILKDTENFIQMFTSFFDFEAVKNHEFKVKCDVDESLKECENSMITLKSQMETESSRVSDKLGIESTKQLKFESSNSLGYYMRVSRKDENVLRNKSFISIIETLKDGVKFHSTQMTLMNESYLQHXXXXXXXXXXXXXXXMKITNKYVGSLHQLSSIIAKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVEMQNNMSYIANDISFD-ESRTFQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIHCNVNNLHVTAQTIGNELIFMYKVEEGPAVRSYGIEVAKASGLPDESIKLAK---LKLSEYE 2523
            N F  F+ S+ +KP++T+R FDR DYYTVH  DA   A+  +K+  ++KY    +     + +SK N + V K LL+  QY+VEVY N     S     W L F A+PGNL ++++ILF + ++ ++  ++G  IK ++ + +  +G   +D+ +  +G  E  F   +Q +NL + L Q+  +EC++P  DT  ++  ++    S  G+L+T+ KK+ F++++ +  + +L+ K K   + T   L + E    +  L SV+ YL+L +DES F  F +  F L  YM++      ALN+ P S  D     SL GLLN C+T  G+RL+ QWIKQPLMD N I  RL++VE+ + D +LR CL E+ LRR PDL R+ ++ QR   NLQD Y+LY A+ Q   ++  + ++ G ++ ++ +  ++ + ++  D   F +M  +  D + V+NHEF VK   D +L E    M  L+  M+   +  + +LG+++ K +K ES++ +G++ RV+ K+E  LRN    + I+  K+GV+F + +++ ++E Y+++R +YEE + +I++EI+ I+  YV  +  L+ +IA+LD   S A +   AP  Y RP +++  + ++  +++ RHP +EMQ+++++I NDI+F+ E + F IITGPNMGGKSTYIR  G+I +MAQIGSFVPCD AEISI D I+ R+GAGD QL GVSTFMAEML+ + IL++AT  SLIIIDELGRGTST+DGFGLAW+ISE+I+T++KAF  FATHFHELT L+     VNNLHVTA T  + L  +Y+++ G   +S+GI VA+ +  P   I+ AK   L+L E++
Sbjct:   17 NGFISFYQSMPEKPDTTVRVFDRNDYYTVHGGDAIFAAKEVFKTNGVIKYLGSGASKLESVVLSKMNFESVVKDLLLVRQYRVEVYKNKSGGKSSKENDWQLAFKASPGNLTQFEEILFGNSDMSTAVGVVG--IKLVSAEGQRLVGVGYVDSTLRKLGVCE--FPDNDQFSNLEALLVQIGPKECVMPGGDTAGDMGKLRQVRDSRGGILITDRKKAEFTTKDSVQDLNRLL-KAKKGEQVTSAALPEMEKQVAMSALASVMKYLELLSDESNFGQFVMTNFDLSQYMKLDNAAVGALNLFPGSAEDTSGTQSLAGLLNKCKTPQGQRLVNQWIKQPLMDKNRIEERLNLVEAFVTDAELRQCLQEDLLRRFPDLNRLAKKFQRQTANLQDCYRLYQAVNQLPGVIQAIEKYEGTHQMLLLAVFATPLSDLSSDFSKFQEMIETTLDMDQVENHEFLVKASFDPNLTELREKMNELEKNMQAALNGAARELGLDAGKSIKLESNSQVGHFFRVTCKEEKALRNNKKFTTIDIQKNGVRFTNGKLSSLSEEYMRNREEYEEAQNAIVKEIISISAGYVDPIQTLNDVIAQLDAAVSFAYVSNSAPVPYVRPVILEKGQGKIM-LQSARHPCIEMQDDVAFIPNDITFEKEKQMFHIITGPNMGGKSTYIRQTGVIVLMAQIGSFVPCDSAEISIVDCILARVGAGDSQLKGVSTFMAEMLETASILRSATENSLIIIDELGRGTSTYDGFGLAWAISEYISTKIKAFCMFATHFHELTALADQVPTVNNLHVTALTTEDTLTMLYRIKRGVCDQSFGIHVAELANFPKHVIETAKEKALQLEEFQ 855          
BLAST of Msh2 vs. Ensembl Xenopus
Match: MSH2 (mutS homolog 2 [Source:NCBI gene;Acc:100380043])

HSP 1 Score: 622.468 bits (1604), Expect = 0.000e+0
Identity = 339/846 (40.07%), Postives = 532/846 (62.88%), Query Frame = 1
Query:   25 NSFSLFWNSLGDKPNSTIRFFDRQDYYTVHFEDAEMLARSYYKSMEILKYFRRDSVSSPYINISKSNSDGVFKYLLIANQYKVEVYSNNKSHDS-----WNLDFVATPGNLEKYQDILFKDVELVSSNSLLGLNIKRINDDYRIFLGFCDLDNGIFMIGGFEESFTGYEQLANLSSALFQLNCRECLIPN-DTRPELLAVKNAVQSAGLLVTEVKKSFFSSENVMNSILKLICKTKLNNENTVLKLVDTEGAETIGCLGSVITYLDLANDESFFNFFDVQTFKLDNYMRVGEQCSRALNILP---SPNDLRKHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLINDNKLRGCLYEENLRRIPDLQRITRRLQRNKGNLQDIYKLYVALRQASDMLNLLNEHNGPYKCIIQSELSSVIQEILKDTENFIQMFTSFFDFEAVKNHEFKVKCDVDESLKECENSMITLKSQMETESSRVSDKLGIESTKQLKFESSNSLGYYMRVSRKDENVLRNKSFISIIETLKDGVKFHSTQMTLMNESYLQHXXXXXXXXXXXXXXXMKITNKYVGSLHQLSSIIAKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVEMQNNMSYIANDISFD-ESRTFQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIHCNVNNLHVTAQTIGNELIFMYKVEEGPAVRSYGIEVAKASGLPDESIKLAK---LKLSEYE 2523
            N F  F+ S+ +KP++T+R FDR DYYTVH  DA   A+  +K+  ++KY    S     + +SK N + V K LL+  QY+VEVY N     S     W L F A+PGNL ++++ILF + ++ ++  ++G  IK ++ + +  +G   +D+ +  +G  E  F   +Q +NL + L Q+  +EC++P  DT  ++  ++  V+  G+L+T+ KK+ F++++ +  + +L+ K K   + T   L + E    +  L SV+ YL+L +DES F  F +  F L  YM++      ALN+ P   +P       SL GLLN C+T  G+RL+ QWIKQPLMD N I  RL++VE+ + D +LR CL E+ LRR PDL R+ ++ QR   NLQD Y+LY A+ Q   ++  + ++ G ++ ++ +  ++ + ++  D   F +M  +  D + V+NHEF VK   D +L E    M  L+  M+   +  + +LG+++ K +K ES++ +G++ RV+ K+E  LRN    + I+  K+GV+F + +++ ++E Y+++R +YEE + +I++EI+ I+  YV  +  L+ +IA+LD   S A +   AP  Y RP +++  + ++  +++ RHP +EMQ+++++I NDI+F+ E + F IITGPNMGGKSTYIR  G+I +MAQIGSFVPCD AEISI D I+ R+GAGD QL GVSTFMAEML+ + IL++AT  SLIIIDELGRGTST+DGFGLAW+ISE+I+T++KAF  FATHFHELT L+     VNNLHVT   + ++ +  +       + S+GI VA+ +  P   I+ AK   L+L E++
Sbjct:    7 NGFISFYQSMPEKPDTTVRVFDRNDYYTVHGGDAIFAAKEVFKTNGVIKYLGSGSKKLESVVLSKMNFESVVKDLLLVRQYRVEVYKNKSGGKSSKENDWQLAFKASPGNLTQFEEILFGNSDMSTAVGVVG--IKLVSAEGQRLVGVGYVDSTLRKLGVCE--FPDNDQFSNLEALLVQIGPKECVMPGGDTAGDMGKLRQIVKRGGILITDRKKAEFTTKDSVQDLNRLL-KAKKGEQVTSAALPEMEKQVAMSALASVMKYLELLSDESNFGQFVMTNFDLSQYMKLDNAAVGALNLFPVSVTPIIHSGTQSLAGLLNKCKTPQGQRLVNQWIKQPLMDKNRIEERLNLVEAFVTDAELRQCLQEDLLRRFPDLNRLAKKFQRQTANLQDCYRLYQAVNQLPGVIQAIEKYEGTHQMLLLAVFATPLSDLSSDFSKFQEMIETTLDMDQVENHEFLVKASFDPNLTELREKMNELEKNMQAALNGAARELGLDAGKSIKLESNSQVGHFFRVTCKEEKALRNNKKFTTIDIQKNGVRFTNGKLSSLSEEYMRNREEYEEAQNAIVKEIISISAGYVDPIQTLNDVIAQLDAAVSFAYVSNSAPVPYVRPVILEKGQGKIM-LQSARHPCIEMQDDVAFIPNDITFEKEKQMFHIITGPNMGGKSTYIRQTGVIVLMAQIGSFVPCDSAEISIVDCILARVGAGDSQLKGVSTFMAEMLETASILRSATENSLIIIDELGRGTSTYDGFGLAWAISEYISTKIKAFCMFATHFHELTALADQVPTVNNLHVTYILMASKTVCSFV---DAHLLSFGIHVAELANFPKHVIETAKEKALQLEEFQ 843          
BLAST of Msh2 vs. Ensembl Xenopus
Match: MSH2 (mutS homolog 2 [Source:NCBI gene;Acc:100380043])

HSP 1 Score: 622.083 bits (1603), Expect = 0.000e+0
Identity = 344/845 (40.71%), Postives = 525/845 (62.13%), Query Frame = 1
Query:   25 NSFSLFWNSLGDKPNSTIRFFDRQDYYTVHFEDAEMLARSYYKSMEILKYFRRDSVSSPYINISKSNSDGVFKYLLIANQYKVEVYSNNKSHDS-----WNLDFVATPGNLEKYQDILFKDVELVSSNSLLGLNIKRINDDYRIFLGFCDLDNGIFMIGGFEESFTGYEQLANLSSALFQLNCRECLIPN-DTRPELLAVKNAVQSAGLLVTEVKKSFFSSENVMNSILKLICKTKLNNENTVLKLVDTEGAETIGCLGSVITYLDLANDESFFNFFDVQTFKLDNYMRVGEQCSRALNILP-SPNDLRKHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLINDNKLRGCLYEENLRRIPDLQRITRRLQRNKGNLQDIYKLYVALRQASDMLNLLNEHNGPYKCIIQSE-LSSVIQEILKDTENFIQMFTSFFDFEAVKNHEFKVKCDVDESLKECENSMITLKSQMETESSRVSDKLGIESTKQLKFESSNSLGYYMRVSRKDENVLRNKSFISIIETLKDGVKFHSTQMTLMNESYLQHXXXXXXXXXXXXXXXMKITNKYVGSLHQLSSIIAKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVEMQNNMSYIANDISFD-ESRTFQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIHCNVNNLHVTAQTIGNELIFMYKVEEGPAVRSYGIEVAKASGLPDESIKLAK---LKLSEYE 2523
            N F  F+ S+ +KP++T+R FDR DYYTVH  DA   A+  +K+  ++KY    S     + +SK N + V K LL+  QY+VEVY N     S     W L F A+PGNL ++++ILF + ++ ++  ++G  IK ++ + +  +G   +D+ +  +G  E  F   +Q +NL + L Q+  +EC++P  DT  ++  ++  V+  G+L+T+ KK+ F++++ +  + +L+ K K   + T   L + E    +  L SV+ YL+L +DES F  F +  F L  YM++      ALN+ P S  D     SL GLLN C+T  G+RL+ QWIKQPLMD N I  RL++VE+ + D +LR CL E+ LRR PDL R+ ++ QR   NLQD Y+LY A+ Q   ++  + ++        Q + LS  +Q                     V+NHEF VK   D +L E    M  L+  M+   +  + +LG+++ K +K ES++ +G++ RV+ K+E  LRN    + I+  K+GV+F + +++ ++E Y+++R +YEE + +I++EI+ I+  YV  +  L+ +IA+LD   S A +   AP  Y RP +++  + ++  +++ RHP +EMQ+++++I NDI+F+ E + F IITGPNMGGKSTYIR  G+I +MAQIGSFVPCD AEISI D I+ R+GAGD QL GVSTFMAEML+ + IL++AT  SLIIIDELGRGTST+DGFGLAW+ISE+I+T++KAF  FATHFHELT L+     VNNLHVTA T  + L  +Y+++ G   +S+GI VA+ +  P   I+ AK   L+L E++
Sbjct:   17 NGFISFYQSMPEKPDTTVRVFDRNDYYTVHGGDAIFAAKEVFKTNGVIKYLGSGSKKLESVVLSKMNFESVVKDLLLVRQYRVEVYKNKSGGKSSKENDWQLAFKASPGNLTQFEEILFGNSDMSTAVGVVG--IKLVSAEGQRLVGVGYVDSTLRKLGVCE--FPDNDQFSNLEALLVQIGPKECVMPGGDTAGDMGKLRQIVKRGGILITDRKKAEFTTKDSVQDLNRLL-KAKKGEQVTSAALPEMEKQVAMSALASVMKYLELLSDESNFGQFVMTNFDLSQYMKLDNAAVGALNLFPGSAEDTSGTQSLAGLLNKCKTPQGQRLVNQWIKQPLMDKNRIEERLNLVEAFVTDAELRQCLQEDLLRRFPDLNRLAKKFQRQTANLQDCYRLYQAVNQLPGVIQAIEKYEAASFSAWQDQRLSQPLQ--------------------LVENHEFLVKASFDPNLTELREKMNELEKNMQAALNGAARELGLDAGKSIKLESNSQVGHFFRVTCKEEKALRNNKKFTTIDIQKNGVRFTNGKLSSLSEEYMRNREEYEEAQNAIVKEIISISAGYVDPIQTLNDVIAQLDAAVSFAYVSNSAPVPYVRPVILEKGQGKIM-LQSARHPCIEMQDDVAFIPNDITFEKEKQMFHIITGPNMGGKSTYIRQTGVIVLMAQIGSFVPCDSAEISIVDCILARVGAGDSQLKGVSTFMAEMLETASILRSATENSLIIIDELGRGTSTYDGFGLAWAISEYISTKIKAFCMFATHFHELTALADQVPTVNNLHVTALTTEDTLTMLYRIKRGVCDQSFGIHVAELANFPKHVIETAKEKALQLEEFQ 835          
BLAST of Msh2 vs. Ensembl Mouse
Match: Msh2 (mutS homolog 2 [Source:MGI Symbol;Acc:MGI:101816])

HSP 1 Score: 622.468 bits (1604), Expect = 0.000e+0
Identity = 340/846 (40.19%), Postives = 529/846 (62.53%), Query Frame = 1
Query:   28 SFSLFWNSLGDKPNSTIRFFDRQDYYTVHFEDAEMLARSYYKSMEILKYF-RRDSVSSPYINISKSNSDGVFKYLLIANQYKVEVYSN---NKS--HDSWNLDFVATPGNLEKYQDILFKDVELVSSNSLLGLNIKRINDDYRIFLGFCDLDNGIFMIGGFEESFTGYEQLANLSSALFQLNCRECLIPN-DTRPELLAVKNAVQSAGLLVTEVKKSFFSSENVMNSILKLICKTKLNNENTVLKLVDTEGAETIGCLGSVITYLDLANDESFFNFFDVQTFKLDNYMRVGEQCSRALNILP-SPNDLRKHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLINDNKLRGCLYEENLRRIPDLQRITRRLQRNKGNLQDIYKLYVALRQASDMLNLLNEHNGPYKCIIQSELSSVIQEILKDTENFIQMFTSFFDFEAVKNHEFKVKCDVDESLKECENSMITLKSQMETESSRVSDKLGIESTKQLKFESSNSLGYYMRVSRKDENVLRNKSFISIIETLKDGVKFHSTQMTLMNESYLQHXXXXXXXXXXXXXXXMKITNKYVGSLHQLSSIIAKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVEMQNNMSYIANDISFDESRT-FQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIHCNVNNLHVTAQTIGNELIFMYKVEEGPAVRSYGIEVAKASGLPDESIKLAK---LKLSEYENL 2529
             F  F+  + +KP++T+R FDR D+YT H EDA + AR  +K+  ++KY     S +   + +SK N +   K LL+  QY+VEVY N   NK+   + W L F A+PGNL +++DILF + ++ +S  ++G+ +  ++    + +G+ D       +  F E+    +Q +NL + L Q+  +EC++P  +T  ++  ++  +Q  G+L+TE K++ FS++++   + +L+ K K   +     L + E    +  L +VI +L+L +D+S F  F++ TF    YM++     RALN+   S  D     SL  LLN C+TA G+RL+ QWIKQPLMD N I  RL++VE+ + D++LR  L E+ LRR PDL R+ ++ QR   NLQD Y+LY  + Q   ++  L ++ G ++ ++ +   + + ++  D   F +M  +  D + V+NHEF VK   D +L E    M  L+ +M++     +  LG++  KQ+K +SS   GYY RV+ K+E VLRN    S ++  K+GVKF +++++ +NE Y +++ +YEE + +I++EI+ I++ YV  +  L+ ++A LD + S A +   AP  Y RP +++  K R+  +K  RH  VE+Q+ +++I ND+ F++ +  F IITGPNMGGKSTYIR  G+I +MAQIG FVPC+ AE+SI D I+ R+GAGD QL GVSTFMAEML+ + IL++AT  SLIIIDELGRGTST+DGFGLAW+IS++IAT++ AF  FATHFHELT L+     VNNLHVTA T    L  +Y+V++G   +S+GI VA+ +  P   I  AK   L+L E++N+
Sbjct:   18 GFVRFFEGMPEKPSTTVRLFDRGDFYTAHGEDALLAAREVFKTQGVIKYMGPAGSKTLQSVVLSKMNFESFVKDLLLVRQYRVEVYKNKAGNKASKENEWYLAFKASPGNLSQFEDILFGNNDMSASVGVMGIKMAVVDGQRHVGVGYVDSTQRKLGLCEFPEN----DQFSNLEALLIQIGPKECVLPGGETTGDMGKLRQVIQRGGILITERKRADFSTKDIYQDLNRLL-KGKKGEQINSAALPEMENQVAVSSLSAVIKFLELLSDDSNFGQFELATFDFSQYMKLDMAAVRALNLFQGSVEDTTGSQSLAALLNKCKTAQGQRLVNQWIKQPLMDRNRIEERLNLVEAFVEDSELRQSLQEDLLRRFPDLNRLAKKFQRQAANLQDCYRLYQGINQLPSVIQALEKYEGRHQALLLAVFVTPLIDLRSDFSKFQEMIETTLDMDQVENHEFLVKPSFDPNLSELREVMDGLEKKMQSTLINAARGLGLDPGKQIKLDSSAQFGYYFRVTCKEEKVLRNNKNFSTVDIQKNGVKFTNSELSSLNEEYTKNKGEYEEAQDAIVKEIVNISSGYVEPMQTLNDVLAHLDAIVSFAHVSNAAPVPYVRPVILEKGKGRII-LKASRHACVEVQDEVAFIPNDVHFEKDKQMFHIITGPNMGGKSTYIRQTGVIVLMAQIGCFVPCESAEVSIVDCILARVGAGDSQLKGVSTFMAEMLETASILRSATKDSLIIIDELGRGTSTYDGFGLAWAISDYIATKIGAFCMFATHFHELTALANQIPTVNNLHVTALTTEETLTMLYQVKKGVCDQSFGIHVAELANFPRHVIACAKQKALELEEFQNI 857          
BLAST of Msh2 vs. Ensembl Mouse
Match: Msh3 (mutS homolog 3 [Source:MGI Symbol;Acc:MGI:109519])

HSP 1 Score: 229.565 bits (584), Expect = 4.343e-62
Identity = 202/736 (27.45%), Postives = 349/736 (47.42%), Query Frame = 1
Query:  490 FEESFTGYEQLANLSSALFQLNCRECLIPND-TRPELLAVKNA----VQSAGLLVTEVKKSFFSSENVMNSILKLICKTKLNNENTVLKLVDTEGAET-----------IGCLGSVITYLDLANDESFFNFFDVQTFKLDN----YMRVGEQCSRALNILPSPNDLRKHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLINDNKLRGCLYEENLRRIPDLQRITRRLQRNKGNLQDIYKLYVALRQASDMLNLL----NEHNGPYKCIIQSELSSVI----QEILKDTENFIQMFTSFFDFEAVKNHEFKVKCDVDESLKECENSMITLKSQMETESSRVSDKLGIESTKQ-LKFESSNSLGYYMRVSRKDENVLRNKSFISIIETLKDGVKFHSTQMT------LMNESYLQHXXXXXXXXXXXXXXXMKITNKYVGSLHQLSSII---AKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVE--MQNNMSYIANDISFDESRTFQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIHC-NVNNLHV--------------TAQTIGNELIFMYKVEEGPAVRSYGIEVAKASGLPDESIKLAKLKLSEYENLM 2532
            F++S +  E    +SS    L   E L+P+D + P  + ++ A    V+   + V  +  ++F   +   ++ +   +          ++VD++G+++           I  L +VI YL   N E   +    ++FK  +    +MR+     R L IL +  D++   SL  +L+  +T+ G R L  W+ QPL+ +  IN RLD V  +++         E  LR++PD++R    +   K + Q+ + +  +L Q    L  L    N H       +QS+L   +     E+L   E+++++           N       D  E  K+  +  +  K + E +    S ++ ++  ++ LK  S      Y+ VS ++  +    S +S I    D VK  ST+         + ESY +  +  E+       E +     +    H L   +   A +D + SLA +     G Y RP + ++ K     +KN RHP+++  +     ++ N  S  +S    IITGPNMGGKS+YI+ + L+++MAQIGS+VP + A I I D I TR+GA D    G STFM E+ D + I++ A+ +SL+I+DELGRGTST DG  +A++  E+   ++K+ + F TH+  + +L K +   V N H+                + + + + F+Y++  G A RSYG+ VAK + +P E ++ A  K  E E L+
Sbjct:  363 FQDSASRLELETRISS----LQPVELLLPSDLSVPTEMLIQRATNVSVRDDRIRVERMNNTYFEYSHAFQTVTEFYAR----------EIVDSQGSQSLSGVINLEKPVICALAAVIRYLKEFNLEKMLS--KPESFKQLSSGMEFMRINGTTLRNLEILQNQTDMKTKGSLLWVLDHTKTSFGRRKLKNWVTQPLLKLREINARLDAVSDVLHSESSVFEQIENLLRKLPDVERGLCSIYHKKCSTQEFFLIVKSLCQLKSELQALMPAVNSH-------VQSDLLRALIVEAPELLSPVEHYLKVL----------NGPAAKVGDKTELFKDLSDFPLIKKRKNEIQEVIHSIQMRLQEFRKILKLPSLQ----YVTVSGQEFMIEIKNSAVSCIPA--DWVKVGSTKAVSRFHPPFIVESYRRLNQLREQLVLDCNAEWLGFLENFGEHYHTLCKAVDHLATVDCIFSLAKV--AKQGNYCRPTLQEEKK---IIIKNGRHPMIDVLLGEQDQFVPNSTSLSDSERVMIITGPNMGGKSSYIKQVALVTIMAQIGSYVPAEEATIGIVDGIFTRMGAADNIYKGRSTFMEELTDTAEIIRRASPQSLVILDELGRGTSTHDGIAIAYATLEYFIRDVKSLTLFVTHYPPVCELEKCYPEQVGNYHMGFLVNEDESKQDSGDMEQMPDSVTFLYQITRGIAARSYGLNVAKLADVPREVLQKAAHKSKELEGLV 1054          
BLAST of Msh2 vs. Ensembl Mouse
Match: Msh3 (mutS homolog 3 [Source:MGI Symbol;Acc:MGI:109519])

HSP 1 Score: 225.328 bits (573), Expect = 1.156e-60
Identity = 202/737 (27.41%), Postives = 349/737 (47.35%), Query Frame = 1
Query:  490 FEESFTGYEQLANLSSALFQLNCRECLIPND-TRPELLAVKNA----VQSAGLLVTEVKKSFFSSENVMNSILKLICKTKLNNENTVLKLVDTEGAET-----------IGCLGSVITYLDLANDESFFNFFDVQTFKLDN----YMRVGEQCSRALNILPSPNDLRKHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLINDNKLRGCLYEENLRRIPDLQRITRRLQRNKGNLQDIYKLYVALRQASDMLNLL----NEHNGPYKCIIQSELSSVI----QEILKDTENFIQMFTSFFDFEAVKNHEFKVKCDVDESLKECENSMITLKSQMETESSRVSDKLGIESTKQ-LKFESSNSLGYYMRVSRKDENVLRNKSFISIIETLKDGVKFHSTQMT------LMNESYLQHXXXXXXXXXXXXXXXMKITNKYVGSLHQLSSII---AKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVE--MQNNMSYIANDISFDE-SRTFQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIHC-NVNNLHV--------------TAQTIGNELIFMYKVEEGPAVRSYGIEVAKASGLPDESIKLAKLKLSEYENLM 2532
            F++S +  E    +SS    L   E L+P+D + P  + ++ A    V+   + V  +  ++F   +   ++ +   +          ++VD++G+++           I  L +VI YL   N E   +    ++FK  +    +MR+     R L IL +  D++   SL  +L+  +T+ G R L  W+ QPL+ +  IN RLD V  +++         E  LR++PD++R    +   K + Q+ + +  +L Q    L  L    N H       +QS+L   +     E+L   E+++++           N       D  E  K+  +  +  K + E +    S ++ ++  ++ LK  S      Y+ VS ++  +    S +S I    D VK  ST+         + ESY +  +  E+       E +     +    H L   +   A +D + SLA +     G Y RP + ++ K     +KN RHP+++  +     ++ N  S  + S    IITGPNMGGKS+YI+ + L+++MAQIGS+VP + A I I D I TR+GA D    G STFM E+ D + I++ A+ +SL+I+DELGRGTST DG  +A++  E+   ++K+ + F TH+  + +L K +   V N H+                + + + + F+Y++  G A RSYG+ VAK + +P E ++ A  K  E E L+
Sbjct:  363 FQDSASRLELETRISS----LQPVELLLPSDLSVPTEMLIQRATNVSVRDDRIRVERMNNTYFEYSHAFQTVTEFYAR----------EIVDSQGSQSLSGVINLEKPVICALAAVIRYLKEFNLEKMLS--KPESFKQLSSGMEFMRINGTTLRNLEILQNQTDMKTKGSLLWVLDHTKTSFGRRKLKNWVTQPLLKLREINARLDAVSDVLHSESSVFEQIENLLRKLPDVERGLCSIYHKKCSTQEFFLIVKSLCQLKSELQALMPAVNSH-------VQSDLLRALIVEAPELLSPVEHYLKVL----------NGPAAKVGDKTELFKDLSDFPLIKKRKNEIQEVIHSIQMRLQEFRKILKLPSLQ----YVTVSGQEFMIEIKNSAVSCIPA--DWVKVGSTKAVSRFHPPFIVESYRRLNQLREQLVLDCNAEWLGFLENFGEHYHTLCKAVDHLATVDCIFSLAKV--AKQGNYCRPTLQEEKK---IIIKNGRHPMIDVLLGEQDQFVPNSTSLSQDSERVMIITGPNMGGKSSYIKQVALVTIMAQIGSYVPAEEATIGIVDGIFTRMGAADNIYKGRSTFMEELTDTAEIIRRASPQSLVILDELGRGTSTHDGIAIAYATLEYFIRDVKSLTLFVTHYPPVCELEKCYPEQVGNYHMGFLVNEDESKQDSGDMEQMPDSVTFLYQITRGIAARSYGLNVAKLADVPREVLQKAAHKSKELEGLV 1055          
BLAST of Msh2 vs. Ensembl Mouse
Match: Msh4 (mutS homolog 4 [Source:MGI Symbol;Acc:MGI:1860077])

HSP 1 Score: 209.149 bits (531), Expect = 2.480e-56
Identity = 166/568 (29.23%), Postives = 283/568 (49.82%), Query Frame = 1
Query:  874 VGEQCSRALNILPSPNDLRKHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLINDNKLRGCLYEENLRRIPDLQRITRRLQRN-------------------KGNLQDIYKLYVALRQASDMLNLLNEHNGPYK----CIIQSELSSVIQEILKDTENFIQMFTSFFDFEAVKNHEFKVKCDVDESLKECENSMITLKSQMETESSRVSDKLGIESTKQLKFESSNSLGYYMRVSRKDENVLRNK---SFISIIETLKDGVKFHSTQMTLMNESYLQHXXXXXXXXXXXXXXXMKITNKYVGSLHQLSSIIAKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVEMQNNMSYIANDISFDESRTFQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIHCNVNNLHVTAQTIGN------ELIFMYKVEEG-PAVRSYGIEVAKASGLP 2478
            +    ++ L +L +  D R + +L+G+LN  +TA G R L   I +PL+DV  I+ RLD V+ L+ D +L   L +  + R  D +++   L +                    K  L+ +  L V L+  S    LL  + G  +     +I  ++ +VI +  +  +  + M T            + V+ ++ E L     +   +   +    +++++K  +     L+   S+S G++++++     +  ++    FI I   +K+   F S  +  MNE   +  R+       I+ +++    +++  L++LS  ++ LD+L S A   C     Y RP+  D        +K   HP++E  +    +AN+    E     IITGPNM GKSTY++ I L  +MAQIGS+VP + A   I  +I TRI   D   T  STFM EM +I++IL  A  KSLI+IDELGRGT+T +G G+++++ EH+ + +KAF+ F THF EL  L  ++ NV N+H   Q + N       +++ YK+  G    ++YG++ A+AS LP
Sbjct:  140 IDSSSAQNLELLVNNQDYRSNHTLFGVLNYTKTAGGSRRLRSNILEPLVDVETISMRLDCVQELLQDEELFFGL-QSVISRFLDTEQLLSVLVQIPKQDTVNAAESKITNLIYLKHTLELVEPLKVTLKNCST--PLLRAYYGSLEDHRFGLILDKIKTVINDDARYMKGCLNMRT---------QKCYAVRSNISEFLDIARRTYTEIVDDIAGMIAQLAEKYSLP----LRTSFSSSRGFFIQMTTDCAALSSDQLPSEFIKI-SKVKNSYSFTSADLIKMNERCQESLREIYHMTYMIVCKLLSEIYEHIHCLYKLSDTVSMLDMLLSFA-HACTL-SDYVRPEFTD-----TLAIKQGWHPILEKISAEKPVANNTYITEGSNVLIITGPNMSGKSTYLKQIALCQIMAQIGSYVPAEYASFRIAAQIFTRISTDDDIETNSSTFMKEMKEIAYILHNANDKSLILIDELGRGTNTEEGIGISYAVCEHLLS-IKAFTLFTTHFLELCHLDALYLNVENMHFEVQHVKNTSRNKDAILYTYKLSRGLTEEKNYGLKAAEASSLP 682          
BLAST of Msh2 vs. Ensembl Mouse
Match: Msh4 (mutS homolog 4 [Source:MGI Symbol;Acc:MGI:1860077])

HSP 1 Score: 207.994 bits (528), Expect = 2.007e-55
Identity = 169/560 (30.18%), Postives = 280/560 (50.00%), Query Frame = 1
Query:  898 LNILPSPNDLRKHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLINDNKLRGCLYEENLRRIPD-------LQRITRRLQRN------------KGNLQDIYKLYVALRQASDMLNLLNEHNGPYK----CIIQSELSSVIQEILKDTENFIQMFTSFFDFEAVKNHEFKVKCDVDESLKECENSMITLKSQMETESSRVSDKLGIESTKQLKFESSNSLGYYMRVSRKDENVLRNKSFIS---IIETLKDGVKFHSTQMTLMNESYLQHXXXXXXXXXXXXXXXMKITNKYVGSLHQLSSIIAKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVEMQNNMSYIANDISFDESRTFQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIHCNVNNLHVTAQTIGN------ELIFMYKVEEG-PAVRSYGIEVAKASGLP 2478
            L +L +  D R + +L+G+LN  +TA G R L   I +PL+DV  I+ RLD V+ L+ D +L   L +  + R  D       L +I ++   N            K  L+ +  L V L+  S    LL  + G  +     +I  ++ +VI +  +  +  + M T            + V+ ++ E L     +   +   +    +++++K  +     L+   S+S G++++++  D   L +    S    I  +K+   F S  +  MNE   +  R+       I+ +++    +++  L++LS  ++ LD+L S A   C     Y RP+  D        +K   HP++E  +    +AN+    E     IITGPNM GKSTY++ I L  +MAQIGS+VP + A   I  +I TRI   D   T  STFM EM +I++IL  A  KSLI+IDELGRGT+T +G G+++++ EH+ + +KAF+ F THF EL  L  ++ NV N+H   Q + N       +++ YK+  G    ++YG++ A+AS LP
Sbjct:  254 LELLVNNQDYRSNHTLFGVLNYTKTAGGSRRLRSNILEPLVDVETISMRLDCVQELLQDEELFFGL-QSVISRFLDTEQLLSVLVQIPKQDTVNAAESKITNLIYLKHTLELVEPLKVTLKNCST--PLLRAYYGSLEDHRFGLILDKIKTVINDDARYMKGCLNMRT---------QKCYAVRSNISEFLDIARRTYTEIVDDIAGMIAQLAEKYSLP----LRTSFSSSRGFFIQMT-TDCAALSSDQLPSEFIKISKVKNSYSFTSADLIKMNERCQESLREIYHMTYMIVCKLLSEIYEHIHCLYKLSDTVSMLDMLLSFA-HACTL-SDYVRPEFTD-----TLAIKQGWHPILEKISAEKPVANNTYITEGSNVLIITGPNMSGKSTYLKQIALCQIMAQIGSYVPAEYASFRIAAQIFTRISTDDDIETNSSTFMKEMKEIAYILHNANDKSLILIDELGRGTNTEEGIGISYAVCEHLLS-IKAFTLFTTHFLELCHLDALYLNVENMHFEVQHVKNTSRNKDAILYTYKLSRGLTEEKNYGLKAAEASSLP 788          
BLAST of Msh2 vs. UniProt/SwissProt
Match: sp|Q5XXB5|MSH2_CHLAE (DNA mismatch repair protein Msh2 OS=Chlorocebus aethiops OX=9534 GN=MSH2 PE=2 SV=1)

HSP 1 Score: 627.476 bits (1617), Expect = 0.000e+0
Identity = 341/841 (40.55%), Postives = 527/841 (62.66%), Query Frame = 1
Query:   28 SFSLFWNSLGDKPNSTIRFFDRQDYYTVHFEDAEMLARSYYKSMEILKYFRRDSVSS-PYINISKSNSDGVFKYLLIANQYKVEVYSN---NKS--HDSWNLDFVATPGNLEKYQDILFKDVELVSSNSLLGLNIKRINDDYRIFLGFCDLDNGIFMIGGFEESFTGYEQLANLSSALFQLNCRECLIPN-DTRPELLAVKNAVQSAGLLVTEVKKSFFSSENVMNSILKLICKTKLNNENTVLKLVDTEGAETIGCLGSVITYLDLANDESFFNFFDVQTFKLDNYMRVGEQCSRALNILP-SPNDLRKHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLINDNKLRGCLYEENLRRIPDLQRITRRLQRNKGNLQDIYKLYVALRQASDMLNLLNEHNGPYKCIIQSELSSVIQEILKDTENFIQMFTSFFDFEAVKNHEFKVKCDVDESLKECENSMITLKSQMETESSRVSDKLGIESTKQLKFESSNSLGYYMRVSRKDENVLRNKSFISIIETLKDGVKFHSTQMTLMNESYLQHXXXXXXXXXXXXXXXMKITNKYVGSLHQLSSIIAKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVEMQNNMSYIANDISFDESRT-FQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIHCNVNNLHVTAQTIGNELIFMYKVEEGPAVRSYGIEVAKASGLPDESIKLAKLKLSEYE 2523
             F  F+ S+ +KP +T+R FDR D+YT H EDA + AR  +K+  ++KY       +   + +SK N +   K LL+  QY+VEVY N   NK+   + W L + A+PGNL +++DILF + ++ +S  ++G+ +  ++   ++ +G+ D       +  F ++    +Q +NL + L Q+  +EC++P  +T  ++  ++  +Q  G+L+TE KK+ FS++++   + +L+   K    N+ + L + E    +  L +VI +L+L +D+S F  F++ TF    YM++     RALN+   S  D     SL  LLN C+T  G+RL+ QWIKQPLMD N I  RL++VE+ + D +LR  L E+ LRR PDL R+ ++ QR   NLQD Y+LY  + Q  +++  L +H G ++ ++ +   + + ++  D   F +M  +  D + V+NHEF VK   D +L E    M  L+ +M++     +  LG++  KQ+K +SS   GYY RV+ K+E VLRN    S ++  K+GVKF ++++T +NE Y +++ +YEE + +I++EI+ I++ YV  +  L+ ++A+LD + S A +  GAP  Y RP +++  + R+  +K  RH  VE+Q+ +++I NDI F++ +  F IITGPNMGGKSTYIR  G+I +MAQIG FVPC+ AE+SI D I+ R+GAGD QL GVSTFMAEML+ + IL++AT  SLIIIDELGRGTST+DGFGLAW+ISE+IAT++ AF  FATHFHELT L+     VNNLHVTA T    L  +Y+V++G   +S+GI VA+ +  P   I+ AK K  E E
Sbjct:   18 GFVRFFQSMPEKPTTTVRLFDRGDFYTAHGEDALLAAREVFKTQGVIKYMGPAGAKNLQSVVLSKMNFESFVKDLLLVRQYRVEVYKNRAGNKASKENDWYLAYKASPGNLSQFEDILFGNNDMSASIGVVGVKMSTVDGQRQVGVGYVDSTQRKLGLCEFPDN----DQFSNLEALLIQIGPKECVLPGGETAGDMGKLRQIIQRGGILITERKKADFSTKDIYQDLNRLLKGKKGEQMNSAV-LPEMENQVAVSSLSAVIKFLELLSDDSNFGQFELTTFDFSQYMKLDIAAVRALNLFQGSVEDTTGSQSLAALLNKCKTPQGQRLVNQWIKQPLMDKNRIEERLNLVEAFVEDAELRQTLQEDLLRRFPDLNRLAKKFQRQAANLQDCYRLYQGINQLPNVIQALEKHEGKHQKLLLAVFVTPLTDLRSDFSKFQEMIETTLDMDQVENHEFLVKPSFDPNLSELREIMNDLEKKMQSTLISAARDLGLDPGKQIKLDSSTQFGYYFRVTCKEEKVLRNNKNFSTVDIQKNGVKFTNSKLTSLNEEYTKNKTEYEEAQDAIVKEIVNISSGYVEPMQTLNDVLAQLDAVVSFAHVSNGAPVPYVRPAILEKGQGRII-LKASRHACVEVQDEITFIPNDIYFEKDKQMFHIITGPNMGGKSTYIRQTGVIVLMAQIGCFVPCESAEVSIVDCILARVGAGDSQLKGVSTFMAEMLETASILRSATKDSLIIIDELGRGTSTYDGFGLAWAISEYIATKIGAFCMFATHFHELTALANQIPTVNNLHVTALTTEETLTMLYQVKKGVCDQSFGIHVAELANFPKHVIECAKQKALELE 852          
BLAST of Msh2 vs. UniProt/SwissProt
Match: sp|P43246|MSH2_HUMAN (DNA mismatch repair protein Msh2 OS=Homo sapiens OX=9606 GN=MSH2 PE=1 SV=1)

HSP 1 Score: 624.394 bits (1609), Expect = 0.000e+0
Identity = 342/841 (40.67%), Postives = 526/841 (62.54%), Query Frame = 1
Query:   28 SFSLFWNSLGDKPNSTIRFFDRQDYYTVHFEDAEMLARSYYKSMEILKYFRRDSVSS-PYINISKSNSDGVFKYLLIANQYKVEVYSN---NKS--HDSWNLDFVATPGNLEKYQDILFKDVELVSSNSLLGLNIKRINDDYRIFLGFCDLDNGIFMIGGFEESFTGYEQLANLSSALFQLNCRECLIPN-DTRPELLAVKNAVQSAGLLVTEVKKSFFSSENVMNSILKLICKTKLNNENTVLKLVDTEGAETIGCLGSVITYLDLANDESFFNFFDVQTFKLDNYMRVGEQCSRALNILP-SPNDLRKHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLINDNKLRGCLYEENLRRIPDLQRITRRLQRNKGNLQDIYKLYVALRQASDMLNLLNEHNGPYKCIIQSELSSVIQEILKDTENFIQMFTSFFDFEAVKNHEFKVKCDVDESLKECENSMITLKSQMETESSRVSDKLGIESTKQLKFESSNSLGYYMRVSRKDENVLRNKSFISIIETLKDGVKFHSTQMTLMNESYLQHXXXXXXXXXXXXXXXMKITNKYVGSLHQLSSIIAKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVEMQNNMSYIANDISFDESRT-FQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIHCNVNNLHVTAQTIGNELIFMYKVEEGPAVRSYGIEVAKASGLPDESIKLAKLKLSEYE 2523
             F  F+  + +KP +T+R FDR D+YT H EDA + AR  +K+  ++KY       +   + +SK N +   K LL+  QY+VEVY N   NK+   + W L + A+PGNL +++DILF + ++ +S  ++G+ +  ++   ++ +G+ D    I    G  E F   +Q +NL + L Q+  +EC++P  +T  ++  ++  +Q  G+L+TE KK+ FS++++   + +L+   K    N+ + L + E    +  L +VI +L+L +D+S F  F++ TF    YM++     RALN+   S  D     SL  LLN C+T  G+RL+ QWIKQPLMD N I  RL++VE+ + D +LR  L E+ LRR PDL R+ ++ QR   NLQD Y+LY  + Q  +++  L +H G ++ ++ +   + + ++  D   F +M  +  D + V+NHEF VK   D +L E    M  L+ +M++     +  LG++  KQ+K +SS   GYY RV+ K+E VLRN    S ++  K+GVKF ++++T +NE Y +++ +YEE + +I++EI+ I++ YV  +  L+ ++A+LD + S A +  GAP  Y RP +++  + R+  +K  RH  VE+Q+ +++I ND+ F++ +  F IITGPNMGGKSTYIR  G+I +MAQIG FVPC+ AE+SI D I+ R+GAGD QL GVSTFMAEML+ + IL++AT  SLIIIDELGRGTST+DGFGLAW+ISE+IAT++ AF  FATHFHELT L+     VNNLHVTA T    L  +Y+V++G   +S+GI VA+ +  P   I+ AK K  E E
Sbjct:   18 GFVRFFQGMPEKPTTTVRLFDRGDFYTAHGEDALLAAREVFKTQGVIKYMGPAGAKNLQSVVLSKMNFESFVKDLLLVRQYRVEVYKNRAGNKASKENDWYLAYKASPGNLSQFEDILFGNNDMSASIGVVGVKMSAVDGQRQVGVGYVD---SIQRKLGLCE-FPDNDQFSNLEALLIQIGPKECVLPGGETAGDMGKLRQIIQRGGILITERKKADFSTKDIYQDLNRLLKGKKGEQMNSAV-LPEMENQVAVSSLSAVIKFLELLSDDSNFGQFELTTFDFSQYMKLDIAAVRALNLFQGSVEDTTGSQSLAALLNKCKTPQGQRLVNQWIKQPLMDKNRIEERLNLVEAFVEDAELRQTLQEDLLRRFPDLNRLAKKFQRQAANLQDCYRLYQGINQLPNVIQALEKHEGKHQKLLLAVFVTPLTDLRSDFSKFQEMIETTLDMDQVENHEFLVKPSFDPNLSELREIMNDLEKKMQSTLISAARDLGLDPGKQIKLDSSAQFGYYFRVTCKEEKVLRNNKNFSTVDIQKNGVKFTNSKLTSLNEEYTKNKTEYEEAQDAIVKEIVNISSGYVEPMQTLNDVLAQLDAVVSFAHVSNGAPVPYVRPAILEKGQGRII-LKASRHACVEVQDEIAFIPNDVYFEKDKQMFHIITGPNMGGKSTYIRQTGVIVLMAQIGCFVPCESAEVSIVDCILARVGAGDSQLKGVSTFMAEMLETASILRSATKDSLIIIDELGRGTSTYDGFGLAWAISEYIATKIGAFCMFATHFHELTALANQIPTVNNLHVTALTTEETLTMLYQVKKGVCDQSFGIHVAELANFPKHVIECAKQKALELE 852          
BLAST of Msh2 vs. UniProt/SwissProt
Match: sp|P43247|MSH2_MOUSE (DNA mismatch repair protein Msh2 OS=Mus musculus OX=10090 GN=Msh2 PE=1 SV=1)

HSP 1 Score: 622.468 bits (1604), Expect = 0.000e+0
Identity = 340/846 (40.19%), Postives = 529/846 (62.53%), Query Frame = 1
Query:   28 SFSLFWNSLGDKPNSTIRFFDRQDYYTVHFEDAEMLARSYYKSMEILKYF-RRDSVSSPYINISKSNSDGVFKYLLIANQYKVEVYSN---NKS--HDSWNLDFVATPGNLEKYQDILFKDVELVSSNSLLGLNIKRINDDYRIFLGFCDLDNGIFMIGGFEESFTGYEQLANLSSALFQLNCRECLIPN-DTRPELLAVKNAVQSAGLLVTEVKKSFFSSENVMNSILKLICKTKLNNENTVLKLVDTEGAETIGCLGSVITYLDLANDESFFNFFDVQTFKLDNYMRVGEQCSRALNILP-SPNDLRKHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLINDNKLRGCLYEENLRRIPDLQRITRRLQRNKGNLQDIYKLYVALRQASDMLNLLNEHNGPYKCIIQSELSSVIQEILKDTENFIQMFTSFFDFEAVKNHEFKVKCDVDESLKECENSMITLKSQMETESSRVSDKLGIESTKQLKFESSNSLGYYMRVSRKDENVLRNKSFISIIETLKDGVKFHSTQMTLMNESYLQHXXXXXXXXXXXXXXXMKITNKYVGSLHQLSSIIAKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVEMQNNMSYIANDISFDESRT-FQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIHCNVNNLHVTAQTIGNELIFMYKVEEGPAVRSYGIEVAKASGLPDESIKLAK---LKLSEYENL 2529
             F  F+  + +KP++T+R FDR D+YT H EDA + AR  +K+  ++KY     S +   + +SK N +   K LL+  QY+VEVY N   NK+   + W L F A+PGNL +++DILF + ++ +S  ++G+ +  ++    + +G+ D       +  F E+    +Q +NL + L Q+  +EC++P  +T  ++  ++  +Q  G+L+TE K++ FS++++   + +L+ K K   +     L + E    +  L +VI +L+L +D+S F  F++ TF    YM++     RALN+   S  D     SL  LLN C+TA G+RL+ QWIKQPLMD N I  RL++VE+ + D++LR  L E+ LRR PDL R+ ++ QR   NLQD Y+LY  + Q   ++  L ++ G ++ ++ +   + + ++  D   F +M  +  D + V+NHEF VK   D +L E    M  L+ +M++     +  LG++  KQ+K +SS   GYY RV+ K+E VLRN    S ++  K+GVKF +++++ +NE Y +++ +YEE + +I++EI+ I++ YV  +  L+ ++A LD + S A +   AP  Y RP +++  K R+  +K  RH  VE+Q+ +++I ND+ F++ +  F IITGPNMGGKSTYIR  G+I +MAQIG FVPC+ AE+SI D I+ R+GAGD QL GVSTFMAEML+ + IL++AT  SLIIIDELGRGTST+DGFGLAW+IS++IAT++ AF  FATHFHELT L+     VNNLHVTA T    L  +Y+V++G   +S+GI VA+ +  P   I  AK   L+L E++N+
Sbjct:   18 GFVRFFEGMPEKPSTTVRLFDRGDFYTAHGEDALLAAREVFKTQGVIKYMGPAGSKTLQSVVLSKMNFESFVKDLLLVRQYRVEVYKNKAGNKASKENEWYLAFKASPGNLSQFEDILFGNNDMSASVGVMGIKMAVVDGQRHVGVGYVDSTQRKLGLCEFPEN----DQFSNLEALLIQIGPKECVLPGGETTGDMGKLRQVIQRGGILITERKRADFSTKDIYQDLNRLL-KGKKGEQINSAALPEMENQVAVSSLSAVIKFLELLSDDSNFGQFELATFDFSQYMKLDMAAVRALNLFQGSVEDTTGSQSLAALLNKCKTAQGQRLVNQWIKQPLMDRNRIEERLNLVEAFVEDSELRQSLQEDLLRRFPDLNRLAKKFQRQAANLQDCYRLYQGINQLPSVIQALEKYEGRHQALLLAVFVTPLIDLRSDFSKFQEMIETTLDMDQVENHEFLVKPSFDPNLSELREVMDGLEKKMQSTLINAARGLGLDPGKQIKLDSSAQFGYYFRVTCKEEKVLRNNKNFSTVDIQKNGVKFTNSELSSLNEEYTKNKGEYEEAQDAIVKEIVNISSGYVEPMQTLNDVLAHLDAIVSFAHVSNAAPVPYVRPVILEKGKGRII-LKASRHACVEVQDEVAFIPNDVHFEKDKQMFHIITGPNMGGKSTYIRQTGVIVLMAQIGCFVPCESAEVSIVDCILARVGAGDSQLKGVSTFMAEMLETASILRSATKDSLIIIDELGRGTSTYDGFGLAWAISDYIATKIGAFCMFATHFHELTALANQIPTVNNLHVTALTTEETLTMLYQVKKGVCDQSFGIHVAELANFPRHVIACAKQKALELEEFQNI 857          
BLAST of Msh2 vs. UniProt/SwissProt
Match: sp|Q3MHE4|MSH2_BOVIN (DNA mismatch repair protein Msh2 OS=Bos taurus OX=9913 GN=MSH2 PE=2 SV=1)

HSP 1 Score: 620.157 bits (1598), Expect = 0.000e+0
Identity = 340/861 (39.49%), Postives = 534/861 (62.02%), Query Frame = 1
Query:   28 SFSLFWNSLGDKPNSTIRFFDRQDYYTVHFEDAEMLARSYYKSMEILKYFRRDSVSS-PYINISKSNSDGVFKYLLIANQYKVEVYSN---NKS--HDSWNLDFVATPGNLEKYQDILFKDVELVSSNSLLGLNIKRINDDYRIFLGFCDLDNGIFMIGGFEESFTGYEQLANLSSALFQLNCRECLIPN-DTRPELLAVKNAVQSAGLLVTEVKKSFFSSENVMNSILKLICKTKLNNENTVLKLVDTEGAETIGCLGSVITYLDLANDESFFNFFDVQTFKLDNYMRVGEQCSRALNILP-SPNDLRKHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLINDNKLRGCLYEENLRRIPDLQRITRRLQRNKGNLQDIYKLYVALRQASDMLNLLNEHNGPYKCIIQSELSSVIQEILKDTENFIQMFTSFFDFEAVKNHEFKVKCDVDESLKECENSMITLKSQMETESSRVSDKLGIESTKQLKFESSNSLGYYMRVSRKDENVLRNKSFISIIETLKDGVKFHSTQMTLMNESYLQHXXXXXXXXXXXXXXXMKITNKYVGSLHQLSSIIAKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVEMQNNMSYIANDISFDESRT-FQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIHCNVNNLHVTAQTIGNELIFMYKVEEGPAVRSYGIEVAKASGLPDESIKLAK---LKLSEYENLMEWDSNHSEKLAATR 2574
             F  F+  + +KP +T+R FDR D+YT H EDA + AR  +K+  ++KY       +   + +SK N +   K LL+  QY+VEVY N   NK+   + W L F A+PGNL +++DILF + ++ +S  ++G+ +  ++   ++ +G+ D       +  F ++    +Q +NL + L Q+  +EC++P  +T  ++  ++  +Q  G+L+TE K++ FS++++   + +L+   K    N+ + L + E    +  L +VI +L+L +D+S F  F++ TF    YM++     RALN+   S  D     SL  LLN C+T  G+RL+ QWIKQPLMD N I  RL++VE+ + D +LR  L E+ LRR PDL R+ ++ QR   NLQD Y+LY  + Q  +++  L ++ G ++ +  +   + + ++  D   F +M  +  D + V+NHEF VK   D +L E    M  L+ +M++     +  LG++  KQ+K +SS   GYY RV+ K+E VLRN    S ++  K+GVKF ++++T +NE Y +++ +YEE + +I++EI+ I++ YV  +  L+ ++A+LD + S A +   AP  Y RP +++  + R+  +K  RH  VE+Q+ +++I ND+ F++ +  F IITGPNMGGKSTYIR  G++ +MAQIG FVPC+ AE+SI D I+ R+GAGD QL GVSTFMAEML+ + IL++AT  SLIIIDELGRGTST+DGFGLAW+ISE+IAT++ AF  FATHFHELT L+     VNNLHVTA T    L  +Y+V++G   +S+GI VA+ +  P   I+ AK   L+L E++N+ +       + AA R
Sbjct:   18 GFVRFFQGMPEKPTTTVRLFDRGDFYTAHREDALLAAREVFKTQGVVKYMGPAGAKTLESVVLSKMNFESFVKDLLLVRQYRVEVYKNRAGNKASKENDWYLAFKASPGNLSQFEDILFGNNDMSASIGVVGVKMSTVDGQRQVGVGYVDSTQRKLGLCEFPDN----DQFSNLEALLIQIGPKECVMPGGETAGDMGKLRQVIQRGGILITERKRADFSTKDIYQDLNRLLKGKKGEQVNSAV-LPEMENQVAVSSLSAVIKFLELLSDDSNFGQFELTTFDFSQYMKLDIAAVRALNLFQGSVEDTSGSQSLAALLNKCKTPQGQRLVNQWIKQPLMDKNRIEERLNLVEAFVEDAELRQNLQEDLLRRFPDLNRLAKKFQRQAANLQDCYRLYQGINQLPNVIQALEKYEGKHQALFLAVFVTPLIDLRSDFSKFQEMIETTLDMDQVENHEFLVKPSFDPNLSELREIMDDLEKKMQSTLVSAARDLGLDPGKQIKLDSSTQFGYYFRVTCKEEKVLRNNKNFSTVDIQKNGVKFTNSKLTSLNEEYTKNKTEYEEAQNAIVKEIVNISSGYVEPMQTLNDVLAQLDAVVSFAHVSDAAPVPYVRPVILEKGRGRI-TLKASRHACVEVQDEVAFIPNDVHFEKDKQMFHIITGPNMGGKSTYIRQTGVVVLMAQIGCFVPCEWAEVSIVDCILARVGAGDSQLKGVSTFMAEMLETASILRSATKDSLIIIDELGRGTSTYDGFGLAWAISEYIATKIGAFCMFATHFHELTALANQIPTVNNLHVTALTTEETLTMLYQVKKGVCDQSFGIHVAELANFPRHVIECAKQKALELEEFQNIGKPQECDEMEPAAKR 872          
BLAST of Msh2 vs. UniProt/SwissProt
Match: sp|P54275|MSH2_RAT (DNA mismatch repair protein Msh2 OS=Rattus norvegicus OX=10116 GN=Msh2 PE=2 SV=1)

HSP 1 Score: 618.616 bits (1594), Expect = 0.000e+0
Identity = 340/864 (39.35%), Postives = 535/864 (61.92%), Query Frame = 1
Query:   28 SFSLFWNSLGDKPNSTIRFFDRQDYYTVHFEDAEMLARSYYKSMEILKYFRRDSVSS-PYINISKSNSDGVFKYLLIANQYKVEVYSN---NKS--HDSWNLDFVATPGNLEKYQDILFKDVELVSSNSLLGLNIKRINDDYRIFLGFCDLDNGIFMIGGFEESFTGYEQLANLSSALFQLNCRECLIPN-DTRPELLAVKNAVQSAGLLVTEVKKSFFSSENVMNSILKLICKTKLNNENTVLKLVDTEGAETIGCLGSVITYLDLANDESFFNFFDVQTFKLDNYMRVGEQCSRALNILP-SPNDLRKHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLINDNKLRGCLYEENLRRIPDLQRITRRLQRNKGNLQDIYKLYVALRQASDMLNLLNEHNGPYKCIIQSELSSVIQEILKDTENFIQMFTSFFDFEAVKNHEFKVKCDVDESLKECENSMITLKSQMETESSRVSDKLGIESTKQLKFESSNSLGYYMRVSRKDENVLRNKSFISIIETLKDGVKFHSTQMTLMNESYLQHXXXXXXXXXXXXXXXMKITNKYVGSLHQLSSIIAKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVEMQNNMSYIANDISFDESRT-FQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIHCNVNNLHVTAQTIGNELIFMYKVEEGPAVRSYGIEVAKASGLPDESIKLAK---LKLSEYENLMEWDSNHSEKLAATRNAL 2583
             F  F+  + +KP++T+  FDR D+YT H EDA + AR  +K+  ++KY       +   + +SK N +   K LL+   Y+VEVY N   NK+   + W L + A+PGNL +++DILF + ++ +S  ++G+ +  ++   ++ +G  D+D+    +G  E  F   +Q +NL + L Q+  +EC++P  +T  ++  ++  +Q  G+L+TE K+  FS++++   + +L+   K    N+ + L + E    +  L +VI +L+L +D+S F  F++ TF    YM++     RALN+   S  D     SL   LN C+TA G+RL+ QWIKQPLMD N I  RL++VE+ + D++LR  L E+ LRR PDL R+ ++ QR   NLQD Y+LY  ++Q  +++  L ++ G ++ ++ +   + + ++  D   F +   +  D + V+NHEF VK   D +L E    M  L+ +M++     +  LG++  KQ+K +SS   GYY RV+ K+E VLRN    S ++  K+GVKF +++++ +NE Y +++ +YEE + +I++EI+ I++ YV  +  ++ ++A LD + S A +   AP  Y RP +++  K R+  VK  RH  VE+Q+++++I ND+ F++ +  F IITGPNMGGKSTYIR  G+I +MAQIG FVPC+ AE+SI D I+ R+GAGD QL GVSTFMAEML+ + IL++AT  SLIIIDELGRGTST+DGFGLAW+ISE+IAT + AF  FATHFHELT L+     VNNLHVTA T    L  +Y+V+ G   +S+GI VA+ +  P   I+ AK   L+L E++++     +   + AA R  L
Sbjct:   18 GFVRFFEGMPEKPSTTVGLFDRGDFYTAHGEDALLAAREVFKTQGVIKYMGPAGAKTLQTVVLSKMNFESFVKDLLLVRHYRVEVYKNKAGNKASKENDWYLAYKASPGNLSQFEDILFGNNDMATSIGIMGIKLSTVDGQRQVGVG--DVDSTQRKLGLCE--FPDNDQFSNLEALLIQIGPKECILPGGETAGDMGKLRQVIQRGGILITERKRIDFSTKDIYQDLNRLLKGRKGEQMNSAV-LPEMENQVAVSSLSAVIKFLELLSDDSNFGQFELATFDFSQYMKLDMAAVRALNLFQGSVEDTTGSQSLAAFLNKCKTAQGQRLVSQWIKQPLMDKNRIEERLNLVEAFVEDSELRRALQEDLLRRFPDLNRLAKKFQRQAANLQDCYRLYQGVKQLPNVIQALEKYQGRHQALLLAVFVTPLTDLRSDFSKFQEKIETTLDMDQVENHEFLVKPSFDPNLSELREVMDGLEKKMQSTLISAARGLGLDPGKQIKLDSSAQFGYYFRVTCKEEKVLRNNKNFSTVDIQKNGVKFTNSELSSLNEEYTKNKGEYEEAQDAIVKEIVNISSGYVEPMQTVNDVLAHLDAVVSFAHVSNAAPVPYVRPVILEKGKGRII-VKASRHACVEVQHDVAFIPNDVHFEKDKQMFHIITGPNMGGKSTYIRQTGVIVLMAQIGCFVPCESAEVSIVDCILARVGAGDSQLKGVSTFMAEMLETASILRSATKDSLIIIDELGRGTSTYDGFGLAWAISEYIATNIGAFCMFATHFHELTALASQIPTVNNLHVTALTTEETLTMLYQVKTGVCDQSFGIHVAELANFPRHVIECAKQKALELEEFQSIGTSQGHDETQPAAKRRCL 875          
BLAST of Msh2 vs. TrEMBL
Match: G1BGJ9 (Msh2 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=msh2 PE=2 SV=1)

HSP 1 Score: 1788.47 bits (4631), Expect = 0.000e+0
Identity = 883/884 (99.89%), Postives = 884/884 (100.00%), Query Frame = 1
Query:   10 MDELTNSFSLFWNSLGDKPNSTIRFFDRQDYYTVHFEDAEMLARSYYKSMEILKYFRRDSVSSPYINISKSNSDGVFKYLLIANQYKVEVYSNNKSHDSWNLDFVATPGNLEKYQDILFKDVELVSSNSLLGLNIKRINDDYRIFLGFCDLDNGIFMIGGFEESFTGYEQLANLSSALFQLNCRECLIPNDTRPELLAVKNAVQSAGLLVTEVKKSFFSSENVMNSILKLICKTKLNNENTVLKLVDTEGAETIGCLGSVITYLDLANDESFFNFFDVQTFKLDNYMRVGEQCSRALNILPSPNDLRKHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLINDNKLRGCLYEENLRRIPDLQRITRRLQRNKGNLQDIYKLYVALRQASDMLNLLNEHNGPYKCIIQSELSSVIQEILKDTENFIQMFTSFFDFEAVKNHEFKVKCDVDESLKECENSMITLKSQMETESSRVSDKLGIESTKQLKFESSNSLGYYMRVSRKDENVLRNKSFISIIETLKDGVKFHSTQMTLMNESYLQHXXXXXXXXXXXXXXXMKITNKYVGSLHQLSSIIAKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVEMQNNMSYIANDISFDESRTFQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIHCNVNNLHVTAQTIGNELIFMYKVEEGPAVRSYGIEVAKASGLPDESIKLAKLKLSEYENLMEWDSNHSEKLAATRNALMEFCLKDLVKDSIDFPVFVKMLRDKL 2661
            MDELTNSFSLFWNSLGDKPNSTIRFFDRQDYYTVHFEDAEMLARSYYKSMEILKYFRRDSVSSPYINISKSNSDGVFKYLLIANQYKVEVYSNNKSHDSW+LDFVATPGNLEKYQDILFKDVELVSSNSLLGLNIKRINDDYRIFLGFCDLDNGIFMIGGFEESFTGYEQLANLSSALFQLNCRECLIPNDTRPELLAVKNAVQSAGLLVTEVKKSFFSSENVMNSILKLICKTKLNNENTVLKLVDTEGAETIGCLGSVITYLDLANDESFFNFFDVQTFKLDNYMRVGEQCSRALNILPSPNDLRKHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLINDNKLRGCLYEENLRRIPDLQRITRRLQRNKGNLQDIYKLYVALRQASDMLNLLNEHNGPYKCIIQSELSSVIQEILKDTENFIQMFTSFFDFEAVKNHEFKVKCDVDESLKECENSMITLKSQMETESSRVSDKLGIESTKQLKFESSNSLGYYMRVSRKDENVLRNKSFISIIETLKDGVKFHSTQMTLMNESYLQHRRDYEEYERSIIEEIMKITNKYVGSLHQLSSIIAKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVEMQNNMSYIANDISFDESRTFQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIHCNVNNLHVTAQTIGNELIFMYKVEEGPAVRSYGIEVAKASGLPDESIKLAKLKLSEYENLMEWDSNHSEKLAATRNALMEFCLKDLVKDSIDFPVFVKMLRDKL
Sbjct:    1 MDELTNSFSLFWNSLGDKPNSTIRFFDRQDYYTVHFEDAEMLARSYYKSMEILKYFRRDSVSSPYINISKSNSDGVFKYLLIANQYKVEVYSNNKSHDSWDLDFVATPGNLEKYQDILFKDVELVSSNSLLGLNIKRINDDYRIFLGFCDLDNGIFMIGGFEESFTGYEQLANLSSALFQLNCRECLIPNDTRPELLAVKNAVQSAGLLVTEVKKSFFSSENVMNSILKLICKTKLNNENTVLKLVDTEGAETIGCLGSVITYLDLANDESFFNFFDVQTFKLDNYMRVGEQCSRALNILPSPNDLRKHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLINDNKLRGCLYEENLRRIPDLQRITRRLQRNKGNLQDIYKLYVALRQASDMLNLLNEHNGPYKCIIQSELSSVIQEILKDTENFIQMFTSFFDFEAVKNHEFKVKCDVDESLKECENSMITLKSQMETESSRVSDKLGIESTKQLKFESSNSLGYYMRVSRKDENVLRNKSFISIIETLKDGVKFHSTQMTLMNESYLQHRRDYEEYERSIIEEIMKITNKYVGSLHQLSSIIAKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVEMQNNMSYIANDISFDESRTFQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIHCNVNNLHVTAQTIGNELIFMYKVEEGPAVRSYGIEVAKASGLPDESIKLAKLKLSEYENLMEWDSNHSEKLAATRNALMEFCLKDLVKDSIDFPVFVKMLRDKL 884          
BLAST of Msh2 vs. TrEMBL
Match: A0A0L8HX88 (DNA_MISMATCH_REPAIR_2 domain-containing protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22003442mg PE=3 SV=1)

HSP 1 Score: 663.3 bits (1710), Expect = 0.000e+0
Identity = 346/839 (41.24%), Postives = 541/839 (64.48%), Query Frame = 1
Query:   31 FSLFWNSLGDKPNSTIRFFDRQDYYTVHFEDAEMLARSYYKSMEILKYFRRDSVSSPYINISKSNSDGVFKYLLIANQYKVEVYSNNKSHDSWNLDFVATPGNLEKYQDILFKDVELVSSNSLLGLNIKRINDDYRIFLGFCDLDNGIFMIGGFEESFTGYEQLANLSSALFQLNCRECLIPNDTRPELLAVKNAVQSAGLLVTEVKKSFFSSENVMNSILKLICKTKLNNENTVLKLVDTEGAETIGCLGSVITYLDLANDESFFNFFDVQTFKLDNYMRVGEQCSRALNILPSPNDL-RKHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLINDNKLRGCLYEENLRRIPDLQRITRRLQRNKGNLQDIYKLYVALRQASDMLNLLNEHNGPYKCIIQSELSSVIQEILKDTENFIQMFTSFFDFEAVKNHEFKVKCDVDESLKECENSMITLKSQMETESSRVSDKLGIESTKQLKFESSNSLGYYMRVSRKDENVLRNKSFISIIETLKDGVKFHSTQMTLMNESYLQHXXXXXXXXXXXXXXXMKITNKYVGSLHQLSSIIAKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVEMQNNMSYIANDISFDES-RTFQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIHCNVNNLHVTAQTIGNELIFMYKVEEGPAVRSYGIEVAKASGLPDESIKLAKLKLSEYENLMEWD 2541
            F  F+  L +K ++T+R FDR DYYTVH  DA  +A+  +K++ ++KY    S     + +SK N + + + LL+   Y+VE+Y  +KS + W+LDF A+PGNL +++DILF + E+  +  +L + I  ++    +     DL +    +      FT  +Q +NL + + QL  +EC++      +   +K  +  +GLL+TE KK  F S++++  + +L+   K + +N+   L + +    +  L S++ YL+L +DE +F  F + TF L  Y+++     +ALNI P+P +   K+ S++GLLN CRTA G+RLL QWIKQPL+D+N I  RLD+VE+ IN+ +LR  L+E+ L++IPD QR++++  R K NLQD Y++Y +L +   ++  L + +GP+K ++    S+ I+E+L D   F +M  S  D E V+NHEF +K + D+ L      +  +++ ++++ ++V+  LG+E  K LK ES++ LGY+ RV+RK+E ++RN      I+T K+GV+FH+T +  +NE +++ R+DY E +++++  I+ I   YV  + Q++ I+A+LDV+   A +   AP  Y RPK+++   + + ++K  RHP +EMQ+++S+I NDI F++  R F IITGPNMGGKSTYIRS+G I ++AQ+G FVPC+ AEISI D I+ R+GAGD QL GVSTFMAEML+ + IL++A+  SLIIIDELGRGTST+DGFGLAW+I+E+IAT++KAF  FATHFHELT L+     V N HVTA T  + L  +YKV+ G   +S+GI VA+ +  P   I+ AK K  E E+    D
Sbjct:   19 FISFFRKLPEKSSATLRIFDRTDYYTVHGSDALFVAKEVFKTLGVVKYLGSGSNKMESVVLSKLNFESLVRDLLLVKAYRVELY-RSKSKNEWSLDFKASPGNLVQFEDILFTNCEMSCATGVLAVKIGTVSGQQMVGTALVDLTSHKMEVC----EFTDNDQFSNLEALIVQLGPKECVVCTSEINDSAWLKQVITRSGLLITEKKKGDFQSKDIVQDLNRLLKFQKEDQQNSA-ALPELDNTLAMAALSSLVKYLELLSDEGYFGQFKLSTFDLKQYLKLDAAAVKALNIQPNPYEGGNKNQSIFGLLNKCRTAPGQRLLSQWIKQPLVDINKIEERLDMVEAFINNTELRQSLHEDQLKKIPDYQRLSKKFYRKKANLQDCYRVYHSLSKLPYLVETLEKDDGPHKNLVMQVFSNPIKELLMDFTKFEEMIESTLDMEQVENHEFLIKPEFDDVLTSLREKLDEVEADIKSQLNKVARDLGVEPQKTLKLESNSQLGYFFRVTRKEEKLIRNNKTYLTIDTNKNGVRFHNTGLRQLNEEFVKLRQDYAEQQKTVVAGIIDIAAGYVEPMIQMNDILAQLDVMVCFAHVSANAPIPYVRPKLLEKG-SGIIRLKEARHPCLEMQDDVSFIPNDIEFEKKKRMFHIITGPNMGGKSTYIRSVGCIVLLAQLGCFVPCNEAEISIVDSILARVGAGDSQLKGVSTFMAEMLETASILRSASENSLIIIDELGRGTSTYDGFGLAWAIAEYIATKIKAFCLFATHFHELTLLADEVSTVINSHVTALTCNDTLTLLYKVKHGVCDQSFGIHVAELAHFPKHVIEFAKNKAKELEDFQSVD 850          
BLAST of Msh2 vs. TrEMBL
Match: V3ZN41 (DNA_MISMATCH_REPAIR_2 domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_195636 PE=3 SV=1)

HSP 1 Score: 661.759 bits (1706), Expect = 0.000e+0
Identity = 354/838 (42.24%), Postives = 534/838 (63.72%), Query Frame = 1
Query:   31 FSLFWNSLGDKPNSTIRFFDRQDYYTVHFEDAEMLARSYYKSMEILKYFRRDSVSSPYINISKSNSDGVFKYLLIANQYKVEVYSNNKS--HDSWNLDFVATPGNLEKYQDILFKDVELVSSNSLLGLNIKRINDDYRIFLGFCDLDNGIFMIGGFEESFTGYEQLANLSSALFQLNCRECLI-PNDTRPELLAVKNAVQSAGLLVTEVKKSFFSSENVMNSILKLICKTKLNNENTVLKLVDTEGAETIGCLGSVITYLDLANDESFFNFFDVQTFKLDNYMRVGEQCSRALNILPSPNDL-RKHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLINDNKLRGCLYEENLRRIPDLQRITRRLQRNKGNLQDIYKLYVALRQASDMLNLLNEHNGPYKCIIQSELSSVIQEILKDTENFIQMFTSFFDFEAVKNHEFKVKCDVDESLKECENSMITLKSQMETESSRVSDKLGIESTKQLKFESSNSLGYYMRVSRKDENVLRNKSFISIIETLKDGVKFHSTQMTLMNESYLQHXXXXXXXXXXXXXXXMKITNKYVGSLHQLSSIIAKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVEMQNNMSYIANDISFDES-RTFQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIHCNVNNLHVTAQTIGNELIFMYKVEEGPAVRSYGIEVAKASGLPDESIKLAKLKLSEYENL 2529
            F  F   L +KP++T+R FDR DYYTVH +DA  +A+  +K+  ++KY    +     + +SK N + + + LL+  QY+VEVY N  S  ++ W L   A+PGNL +++DILF + E+  S  ++G+ +   N    + +G+ D     F +      FT  +Q +NL + L QL  +EC+I   +   E    K  +  + +L+TE KKS F+ ++V+  + +L+ K K    N+   L + +    +  L +VI YL+L +DES F  + + TF L  YMR+     RALNILP+PN+   K+ S+ GLLN CRTA G+RL+ QW+KQPLMD N I  RL++VE+++ + +LR  L EE LRRIPD Q++ ++ QR K  LQD Y++Y A+ +   +L +L +H+G ++ ++    S+ ++E+L D   F +M  +  D   V+NHE+ +K D DE+L      +  L+S ++++ ++V+  L +E+ K LK ES+N LGY+ RV+RKDE  LRN      I+T K+GV+F ++ ++  NE YL+++ +Y E ++S++ EI++I   YV  +  ++ ++A+LDVL S + +   AP               + K+K  RHP +EMQ+++S+I ND  F+++ + F IITGPNMGGKSTYIRS+G++ +MAQ+G FVPC  A+I+I D I+ R+GAGD QL GVSTFMAEML+ + IL++AT KSLIIIDELGRGTST+DGFGLAW+ISEHIAT++K F  FATHFHELT LS +  +VNNLHVTA T  N L  +Y+V+ G   +S+GI VA+ +  P   I+ AK K  E E+ 
Sbjct:   19 FLAFHRDLPEKPSTTLRVFDRTDYYTVHGQDAIFVAKEVFKTTGVVKYLGGGTKKLESVVLSKMNFESLMRDLLLVQQYRVEVYRNKGSSKNNDWILALKASPGNLSQFEDILFTNNEMAGSIGVIGIKVSTDNGQKIVGIGYADATVRKFSVC----EFTDNDQFSNLEALLVQLGPKECVIGTGELNTESGKFKQVLDRSNILITERKKSEFNCKDVIQDMNRLLKKKKGEQSNSA-TLSEMDRVHAVSALSAVIKYLELLSDESNFGQYQLTTFDLKQYMRLDSAAVRALNILPNPNEGGNKNQSVLGLLNKCRTAQGQRLIAQWVKQPLMDKNKIEERLNVVEAMLENTELRQTLQEEQLRRIPDFQKLAKKFQRKKATLQDCYRVYQAIDKMPYLLEILEKHDGNHRTLLMELFSNPLKELLMDFAKFQEMVETTMDLNQVENHEYVIKSDFDENLAALREKIDALESDIKSQINKVARDLNLEANKTLKLESNNQLGYFFRVTRKDEKALRNNKNYRTIDTNKNGVRFRNSAVSKYNEDYLKYKEEYNEQQKSVVSEIIEIAAGYVEPMLIINDVVAQLDVLASFSHVSSSAP------------IHGILKLKEARHPCLEMQDDVSFIPNDAMFEKAEKMFHIITGPNMGGKSTYIRSVGVVVLMAQLGCFVPCSSADITIVDSILARVGAGDSQLKGVSTFMAEMLETASILRSATEKSLIIIDELGRGTSTYDGFGLAWAISEHIATKIKPFCLFATHFHELTALSDVVSSVNNLHVTALTTNNTLTLLYRVKPGVCDQSFGIHVAELAHFPKHVIEFAKEKARELEDF 839          
BLAST of Msh2 vs. TrEMBL
Match: T1IP55 (DNA_MISMATCH_REPAIR_2 domain-containing protein OS=Strigamia maritima OX=126957 PE=3 SV=1)

HSP 1 Score: 652.129 bits (1681), Expect = 0.000e+0
Identity = 345/851 (40.54%), Postives = 541/851 (63.57%), Query Frame = 1
Query:   25 NSFSLFWNSLGDKPNSTIRFFDRQDYYTVHFEDAEMLARSYYKSMEILKYFRRDSVSSPYINISKSNSDGVFKYLLIANQYKVEVYSN---NKSHDSWNLDFVATPGNLEKYQDILFKDVELVSSNSLLGLNIKRINDDYRIFLGFCDLDNGIFMIGGFEESFTGYEQLANLSSALFQLNCRECLIPNDTRPELLAVKNAVQSAGLLVTEVKKSFFSSENVMNSILKLICKTKLNNENTVLKLVDTEGAETIGCLGSVITYLDLANDESFFNFFDVQTFKLDNYMRVGEQCSRALNILPSPNDLRKHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLINDNKLRGCLYEENLRRIPDLQRITRRLQRNKGNLQDIYKLYVALRQASDMLNLLNEHNGPYKCIIQSELSSVIQEILKDTENFIQMFTSFFDFEAVKNHEFKVKCDVDESLKECENSMITLKSQMETESSRVSDKLGIESTKQLKFESSNSLGYYMRVSRKDENVLRNKSFISIIETLKDGVKFHSTQMTLMNESYLQHXXXXXXXXXXXXXXXMKITNKYVGSLHQLSSIIAKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVEMQNNMSYIANDISFDESRT-FQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIHCNVNNLHVTAQTIGNELIFMYKVEEGPAVRSYGIEVAKASGLPDESIKLAKLKLSEYENLMEWDSNHSEKLA 2565
            ++F  F+ SL DKP STIR FDR D+YTVH  DA   ++ ++K+  ++KY  ++      + +SK N + + + LL+   Y+VEVY N   NKS+D W L+F A+PGNL +++DILF + ++ +   ++  +IK IND+    +G   LDN +  I   E  FT  ++ +NL + + QL  +ECL+P++   +   VK      G+LVTE KKS F+ ++++  + +L+   K + EN+   L   +    I  L ++I YL+L  ++  FN + +  F L  ++R+     +ALN+LP P +  K  S++GLLN CRTA G+RLL +W+ QPL D+NLI  RLD+VE  I+D+ +   +  ++L+R PD QRI ++ ++ K NLQD++++Y A+ + ++++++L +++G  + ++       + E+ K    F ++  S  D E   N E+ V  + DE L E    +  L+ ++E    + +  L ++  K +K E++N +G++ R+++K+E VLRN     +I+T K GV+F+++ +  +NE +L    +Y+E ++S+++ IM++   Y   +H+L+ II++LDVL S A +   AP +Y RPK+     + + K+   RHP +E+Q+++ +I ND+ F++ +T F IITGPNMGGKSTYIRSIG+  V+AQIGSF+PC+ AEISI D I+ R+GAGD Q+ GVSTFM EML+ + IL+ ATS SLIIIDELGRGTSTFDGFGLAW+ISE+I+T++KAFS FATHFHELT LS     VNNLHVTA    ++L  +YKV  G   +S+GI VA+ +  P   I+ AK K  E E   +  + + EK A
Sbjct:   17 HAFLSFFRSLPDKPASTIRVFDRNDFYTVHESDAVFASKEFFKTSGVIKYLGKEPNKIESVVLSKMNFESIIRDLLLVRHYRVEVYQNKGSNKSND-WKLEFKASPGNLVQFEDILFGNNDMSTCGGVI--SIKVINDNGNKVVGVAYLDNTLHEISVSE--FTDNDKFSNLEALIVQLGPKECLLPSEKNADYTYVKQLTSRNGVLVTERKKSDFTGKSIVQDMNRLLNFKKGDLENSA-ALPGMDKHHAISSLAAIIKYLELLGNDDNFNQYKLSVFDLTRFVRLDGCAVKALNLLPVPGESAKTQSIFGLLNECRTAQGQRLLSRWVNQPLTDLNLIEERLDVVEIFISDHNMTSEIQSDHLKRFPDFQRIAKKFEKKKANLQDMFRIYQAISRLTNLISMLEQYSGEKEHVLNEMFCKPLNELGKQFNKFQKLAESTIDIEKANNGEYVVNPEFDEKLMELRTKLDNLEEKIENVFKKAARDLQLDPQKTIKLENNNQIGFHFRITKKEEKVLRNNKNYRMIQTNKGGVQFNNSALRDLNEEHLSVYGEYQEQQKSVVDAIMQVAMGYAEPMHELNDIISRLDVLLSFAFVAEKAPTSYVRPKLFSKG-SGILKLTQARHPCLEVQDDVKFIPNDVYFEKDKTTFHIITGPNMGGKSTYIRSIGVNVVLAQIGSFIPCESAEISIVDSILARVGAGDSQMKGVSTFMVEMLETAAILRAATSDSLIIIDELGRGTSTFDGFGLAWAISEYISTKIKAFSLFATHFHELTALSDQVSTVNNLHVTALAANDKLTLLYKVNPGVCDQSFGIHVAELAQFPKHVIEFAKRKAKELEGYHDDYTQYDEKSA 860          
BLAST of Msh2 vs. TrEMBL
Match: A0A1S3HMF8 (DNA mismatch repair protein Msh2 OS=Lingula unguis OX=7574 GN=LOC106156484 PE=3 SV=1)

HSP 1 Score: 650.973 bits (1678), Expect = 0.000e+0
Identity = 342/844 (40.52%), Postives = 534/844 (63.27%), Query Frame = 1
Query:   25 NSFSLFWNSLGDKPNSTIRFFDRQDYYTVHFEDAEMLARSYYKSMEILKYFRRDSVSSPYINISKSNSDGVFKYLLIANQYKVEVYSNNKS--HDSWNLDFVATPGNLEKYQDILFKDVELVSSNSLLGLNIKRINDDYRIFLGFCDLDNGIFMIGGFEESFTGYEQLANLSSALFQLNCRECLIPN-DTRPELLAVKNAVQSAGLLVTEVKKSFFSSENVMNSILKLICKTKLNNENTVLKLVDTEGAETIGCLGSVITYLDLANDESFFNFFDVQTFKLDNYMRVGEQCSRALNILPSPND-LRKHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLINDNKLRGCLYEENLRRIPDLQRITRRLQRNKGNLQDIYKLYVALRQASDMLNLLNEHNGPYKCIIQSELSSVIQEILKDTENFIQMFTSFFDFEAVKNHEFKVKCDVDESLKECENSMITLKSQMETESSRVSDKLGIESTKQLKFESSNSLGYYMRVSRKDENVLRNKSFISIIETLKDGVKFHSTQMTLMNESYLQHXXXXXXXXXXXXXXXMKITNKYVGSLHQLSSIIAKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVEMQNNMSYIANDISFD-ESRTFQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIHCNVNNLHVTAQTIGNELIFMYKVEEGPAVRSYGIEVAKASGLPDESIKLAKLKLSEYENLMEWD 2541
            + F  +  SL +KPN+TIRFFDR DYYTVH  DA   A+  +K+  ++K+    +     + +SK N +   + LL+  QY+VEVY N  +  ++ W+L + A+PGNL +++D+LF   ++  S  ++ + +   N    + +G+ D     F +  F E+    +Q +NL + + QL  +EC++ + +  PE+  +K  ++ +G+L+TE KK+ FS+++ +  + +L+ K K   +     L + +    +  + ++I YL+L  DE+ F+ F +Q+F L  YM++      ALN++PSPN+   K+ S+ GLLN CRT  G+RLL QW+KQPL+D N I  RL++VES + D +LR  L E+ LR++PD QR+ ++ Q+ + NLQD Y++Y AL +   +L  L +H G +  ++    ++ ++E+L D   F +M  +  D + V+NHEF +K D DE L E    +  ++ Q++ + ++ +  L +E  K LK ES++ LGY+ R++RK+E VLRN      I+T K GV+FH+T +  +NE ++  + DY E ++S++ E++ I   YV  +  L+ +IA LD L S A +   AP  Y RP+++D     + ++   RHP +EMQ+++++I ND  F+ + + F IITGPNMGGKSTYIRS+G+I +MAQIG FVPC  AEIS+ D I+ R+GAGD QL GVSTFMAEML+ + IL+TAT  SL+IIDELGRGTST+DGFGLAW+ISE+IAT++ A+  FATHFHELT LS +   VNNLHVTA T  + L  +Y+V+ G   +S+GI VA+ +  P   ++ A+ K  E E+    D
Sbjct:   18 HGFLSYLRSLPEKPNTTIRFFDRNDYYTVHGPDAVFAAKEVFKTTGVIKHLGSGANKVESVVLSKLNFESTVRDLLLVRQYRVEVYRNRAAGKNNDWSLAYKASPGNLTQFEDVLFGSNDMSVSVGVIAVKLGTENGQRVVGVGYGDATLRKFGVCQFPEN----DQFSNLEALIVQLGPKECVLASGEGSPEVSRLKQVIERSGVLITERKKADFSTKDNVQDLNRLL-KFKKGEQANSAALAEMDKTHAMAAVSALIKYLELLGDETNFHQFSLQSFDLSQYMKLDAAAVNALNLMPSPNEGSNKNQSVLGLLNRCRTPQGQRLLAQWVKQPLIDKNRIEERLNVVESFVEDTELRQTLQEDQLRKVPDFQRLAKKFQKKRANLQDCYRVYQALEKMPYLLEALEKHQGKHTPLLMELFTNPMKELLMDFSKFQEMVETTIDLDQVENHEFLIKPDFDEGLAELREKLDNVEKQIKAQLNKAAKDLNLEPNKVLKLESNSQLGYFFRLTRKEEKVLRNNKNYRTIDTNKSGVRFHNTPLRQLNEEFIALKDDYNEQQKSVVAEVIAIAAGYVEPMILLNDVIAHLDALVSFAHVSANAPIPYIRPRLLDKG-AGILRLTEARHPCLEMQDDVAFIPNDAIFEKDKKMFHIITGPNMGGKSTYIRSVGVIVLMAQIGCFVPCTEAEISLMDCILARVGAGDSQLKGVSTFMAEMLETASILRTATDTSLVIIDELGRGTSTYDGFGLAWAISEYIATKIGAYCLFATHFHELTALSDVVPTVNNLHVTALTTNDTLTLLYRVKPGVCDQSFGIHVAELAHFPKHVLEFARQKAQELEDYQSID 855          
BLAST of Msh2 vs. Ensembl Cavefish
Match: msh2 (mutS homolog 2 [Source:NCBI gene;Acc:103047089])

HSP 1 Score: 634.41 bits (1635), Expect = 0.000e+0
Identity = 346/869 (39.82%), Postives = 536/869 (61.68%), Query Frame = 1
Query:   10 MDELTNS-FSLFWNSLGDKPNSTIRFFDRQDYYTVHFEDAEMLARSYYKSMEILKYFRRDSVSSPYINISKSNSDGVFKYLLIANQYKVEVYSN------NKSHDSWNLDFVATPGNLEKYQDILFKDVELVSSNS-LLGLNIKRINDDYRIFLGFCDLDNGIFMIGGFEESFTGYEQLANLSSALFQLNCRECLIPN-DTRPELLAVKNAVQSAGLLVTEVKKSFFSSENVMNSILKLICKTKLNNENTVLKLVDTEGAETIGCLGSVITYLDLANDESFFNFFDVQTFKLDNYMRVGEQCSRALNIL--PSPNDLRKHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLINDNKLRGCLYEENLRRIPDLQRITRRLQRNKGNLQDIYKLYVALRQASDMLNLLNEHNGPYKCIIQSELSSVIQEILKDTENFIQMFTSFFDFEAVKNHEFKVKCDVDESLKECENSMITLKSQMETESSRVSDKLGIESTKQLKFESSNSLGYYMRVSRKDENVLRNKSFISIIETLKDGVKFHSTQMTLMNESYLQHXXXXXXXXXXXXXXXMKITNKYVGSLHQLSSIIAKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVEMQNNMSYIANDISFDES-RTFQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIHCNVNNLHVTAQTIGNELIFMYKVEEGPAVRSYGIEVAKASGLPDESIKLAKLKLSEYENLMEWDSNHSEKLAATRNA 2580
            MD  + S F  F++S+ +KP++T+R FDR DYYTVH +DA   AR  +K+  ++KY    S     + +SK N +   + LL+  QY+VEVY N      +K HD W + + A+PGNL ++++ILF    L    + ++G+ +    D  R+ +G   +D+ +  +G  E  F   +Q +NL + L Q+  +EC++P  DT  +L  ++  +Q  G+L+++ KK  F++++++  + +L+ K +     +   L + E    + CL +VI YL+L +DE+ F  F + TF L+ YMR+     +ALN+    S +D     SL GLLN CRT  G+RL+ QW+KQPL+D N I  RLD+VES + D++LR    E+ LRR PDL R+ ++LQR   NLQD Y++Y A+ Q   ++  L  H G ++ ++ +   S   ++  D   F +M  +  D   + +HEF VK   D +L E   SM  L+  M++  +  + +LG+++ K +K ES+  +GY+ RV+ K+E  LRN    + ++  K+GV+F +++++ +NE Y++ R +YEE + +I++EI+ I   YV  L  L+ +IA+LD + S A +   AP  + RP++++    R+  +K  RHP VE Q+++++I ND++F    + F IITGPNMGGKSTYIR +G+I +MAQIG FVPCD AE+S+ D ++ R+GAGD Q+ GVSTFMAEML+ + IL++AT  SLIIIDELGRGTST+DGFGLAW+ISE+IAT LK+F  FATHFHELT L++    V NLHVTA T  + L  +Y+V++G   +S+GI VA+ +  P   I  A+ K  E E   +      E + A   A
Sbjct:   11 MDSASESGFISFFSSMPEKPDTTLRIFDRTDYYTVHGKDALFTAREVFKTQGVIKYLGSGSRRLEGVVLSKMNFESFVRDLLLVRQYRVEVYRNKAGGKSSKDHD-WQIAYKASPGNLTQFEEILFGGGGLGEGAAGVVGIRLGTGGDGQRV-VGVGYVDSTLRKMGVCE--FPDNDQFSNLEALLVQIGPKECVLPGGDTAGDLGKLRQVIQRGGILLSDRKKMEFTAKDIVQDLNRLL-KARKGETVSSAALPEMEKQIAVSCLAAVIKYLELLSDEANFGSFKLTTFDLNQYMRLDNAAVQALNLFQGSSSDDPTGTHSLAGLLNKCRTPQGQRLVNQWLKQPLIDKNKIEERLDLVESFVEDSELRQSCQEDLLRRFPDLNRLAKKLQRQSANLQDCYRVYQAVGQLPGLVQALERHTGKHQVLLNAAFISPFSDLTSDFSKFQEMIETTLDMNQIDHHEFLVKPSFDPTLSELRESMDQLEKSMQSALNSAARELGLDAGKTIKLESNAQMGYFFRVTCKEEKSLRNNKKFTTLDVQKNGVRFTNSKLSSLNEEYVKSREEYEEAQNAIVKEIIGIAGGYVEPLQTLNEVIAQLDAVVSFAVVSHAAPVPFVRPRILEKGSGRLI-LKGSRHPCVEAQDDVAFIPNDVTFTRGEQMFHIITGPNMGGKSTYIRQVGVIVLMAQIGCFVPCDEAELSVVDCVLARVGAGDSQIKGVSTFMAEMLETAAILRSATEDSLIIIDELGRGTSTYDGFGLAWAISEYIATRLKSFCLFATHFHELTALAQQEPTVCNLHVTALTTDSTLTMLYRVKKGVCDQSFGIHVAELANFPKHVIANAREKALELEEFQDISRAEEEGVDAGPEA 873          
BLAST of Msh2 vs. Ensembl Cavefish
Match: msh3 (mutS homolog 3 [Source:NCBI gene;Acc:103037699])

HSP 1 Score: 207.223 bits (526), Expect = 9.774e-55
Identity = 211/817 (25.83%), Postives = 363/817 (44.43%), Query Frame = 1
Query:  334 GNLEKYQDILFKDVELVSSNSLLGL--NIKRINDDYRIFLGFCDLDNGIFMIGGFEESFTGYEQLANLSSALFQLNCRECLIPND-TRPELLAVK----NAVQSAGLLVTEVKKSF-FSSENVMNSILKLIC----KTKLNNENTVLKLVDTEGAETIGCLGSVITYLD-------LANDESFFNFFDVQTFKLDNYMRVGEQCSRALNILPSPNDLRKHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLINDNKLRGCLYEENLRRIPDLQRITRRLQRNKGNLQDIYKLYVALR---------------QASDMLNLLNEHNGPYKCIIQSELSSVIQEILKDTENFIQMFTSFFDFEAVKNHEFKVKCDVDESLKECENSMITLKSQMETESSRVSDKLGIESTKQLKFESSNSLGYYMRVSRKDENVLRNKSFISIIETLKDGVKFHSTQMT------LMNESY---LQHXXXXXXXXXXXXXXXMKITNKYVGSLHQLSSIIAKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVEM--QNNMSYIANDISFD-ESRTFQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIH-CNVNNLHVT-----AQTIGNE-------LIFMYKVEEGPAVRSYGIEVAKASGLPDESIKLAKLKLSEYENLMEWDSNHSEKLA-----ATRNALMEF 2592
            G+LE+ +D+    V+   ++ L+ +  N  +++ +  + L       G  M+  F+++ +  E    L + + ++   E L+P+D + P    ++    ++VQ+   +  E ++S  F     M ++ +       +T  N E        +  +  I CLG VI YL        L    SF            ++M +     + L I  +        SL  +L+   T  G+RLL +W+ QPL   + I +R + V  +++         +  L R+PDL+R    +   K + Q+ Y L   L                Q S  L      + P           V+ E    T N  ++F    DF  ++                        K Q++   S +     +E  ++L+    N    Y  VS ++  +    S  S++    D VK +ST++        + E Y   LQ R              +++  ++   L +    +A +D   SLA +       Y RP+V++  + R   +++ RHP+++M       Y+ ND     + +   I+TGPNMGGKS+YIR + L+++MAQ+GSFVP   A I + D I TR+GA D    G STFM E+L+ S IL  ATS+SL+I+DELGRGTST DG  +A++  E    ++K  + F TH+  L +L K++  +V N H+       + +G+E       + F+Y++ EG A RSYG+ VA+ + +P+  ++ A LK  E E ++       + L+       R AL+E+
Sbjct:  335 GDLEQAEDV----VQDPPTSYLMCVSENWDKLSKELTVGLVVVQPSTGDVMLDCFKDNTSRSE----LEARVLKIQPVEILVPSDLSEPTERLLRTIALSSVQADDRIRIEKRESTQFEYPTAMMTVREFYTSRSTRTVKNCEKGSASFYLSLESPVICCLGPVIQYLTEFKLERVLLCPSSFRRLLSD-----SDHMVLSATTMKNLEIFCNQTTGSVKGSLLWVLDHTHTPFGKRLLKKWVSQPLKSASEILSRQEAVAEILSSESSVLPSIQALLNRLPDLERGLCSIYHKKCSTQEFYLLSSTLSRLGIEFQALIPAVQSQISSALLKSLLLDTPQLLSPAHNFLKVLNENAAKTGNKTELFADLTDFPVIEQR----------------------KDQIQNILSDI-----MEHRRELRLILRNPSLNYATVSGQEFLIEVKNSMSSVVPP--DWVKINSTKVVGRYHSPFIVEKYRCLLQLREQLVIDSGQEWINFLQLFGEHYYILKKAVGHLATMDCFFSLAQV--AKENNYCRPEVLE--QERHIVIRDGRHPVIDMLMGEQDQYVPNDTELQGDGKRAMIVTGPNMGGKSSYIRQVALVTIMAQLGSFVPAREASIGMVDGIFTRMGASDNISRGRSTFMEELLEASEILSHATSRSLVILDELGRGTSTHDGIAIAYATLEFFIRDVKCLTLFVTHYPPLCELEKLYPLHVGNYHMAFLLNEPEIVGDEEEVQPEFITFLYQLTEGAAGRSYGLNVARLANIPESILRTAALKSKELEAIINSRRRAVKGLSEAWKITNREALLEW 1105          
BLAST of Msh2 vs. Ensembl Cavefish
Match: msh3 (mutS homolog 3 [Source:NCBI gene;Acc:103037699])

HSP 1 Score: 207.223 bits (526), Expect = 9.774e-55
Identity = 211/817 (25.83%), Postives = 363/817 (44.43%), Query Frame = 1
Query:  334 GNLEKYQDILFKDVELVSSNSLLGL--NIKRINDDYRIFLGFCDLDNGIFMIGGFEESFTGYEQLANLSSALFQLNCRECLIPND-TRPELLAVK----NAVQSAGLLVTEVKKSF-FSSENVMNSILKLIC----KTKLNNENTVLKLVDTEGAETIGCLGSVITYLD-------LANDESFFNFFDVQTFKLDNYMRVGEQCSRALNILPSPNDLRKHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLINDNKLRGCLYEENLRRIPDLQRITRRLQRNKGNLQDIYKLYVALR---------------QASDMLNLLNEHNGPYKCIIQSELSSVIQEILKDTENFIQMFTSFFDFEAVKNHEFKVKCDVDESLKECENSMITLKSQMETESSRVSDKLGIESTKQLKFESSNSLGYYMRVSRKDENVLRNKSFISIIETLKDGVKFHSTQMT------LMNESY---LQHXXXXXXXXXXXXXXXMKITNKYVGSLHQLSSIIAKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVEM--QNNMSYIANDISFD-ESRTFQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIH-CNVNNLHVT-----AQTIGNE-------LIFMYKVEEGPAVRSYGIEVAKASGLPDESIKLAKLKLSEYENLMEWDSNHSEKLA-----ATRNALMEF 2592
            G+LE+ +D+    V+   ++ L+ +  N  +++ +  + L       G  M+  F+++ +  E    L + + ++   E L+P+D + P    ++    ++VQ+   +  E ++S  F     M ++ +       +T  N E        +  +  I CLG VI YL        L    SF            ++M +     + L I  +        SL  +L+   T  G+RLL +W+ QPL   + I +R + V  +++         +  L R+PDL+R    +   K + Q+ Y L   L                Q S  L      + P           V+ E    T N  ++F    DF  ++                        K Q++   S +     +E  ++L+    N    Y  VS ++  +    S  S++    D VK +ST++        + E Y   LQ R              +++  ++   L +    +A +D   SLA +       Y RP+V++  + R   +++ RHP+++M       Y+ ND     + +   I+TGPNMGGKS+YIR + L+++MAQ+GSFVP   A I + D I TR+GA D    G STFM E+L+ S IL  ATS+SL+I+DELGRGTST DG  +A++  E    ++K  + F TH+  L +L K++  +V N H+       + +G+E       + F+Y++ EG A RSYG+ VA+ + +P+  ++ A LK  E E ++       + L+       R AL+E+
Sbjct:  335 GDLEQAEDV----VQDPPTSYLMCVSENWDKLSKELTVGLVVVQPSTGDVMLDCFKDNTSRSE----LEARVLKIQPVEILVPSDLSEPTERLLRTIALSSVQADDRIRIEKRESTQFEYPTAMMTVREFYTSRSTRTVKNCEKGSASFYLSLESPVICCLGPVIQYLTEFKLERVLLCPSSFRRLLSD-----SDHMVLSATTMKNLEIFCNQTTGSVKGSLLWVLDHTHTPFGKRLLKKWVSQPLKSASEILSRQEAVAEILSSESSVLPSIQALLNRLPDLERGLCSIYHKKCSTQEFYLLSSTLSRLGIEFQALIPAVQSQISSALLKSLLLDTPQLLSPAHNFLKVLNENAAKTGNKTELFADLTDFPVIEQR----------------------KDQIQNILSDI-----MEHRRELRLILRNPSLNYATVSGQEFLIEVKNSMSSVVPP--DWVKINSTKVVGRYHSPFIVEKYRCLLQLREQLVIDSGQEWINFLQLFGEHYYILKKAVGHLATMDCFFSLAQV--AKENNYCRPEVLE--QERHIVIRDGRHPVIDMLMGEQDQYVPNDTELQGDGKRAMIVTGPNMGGKSSYIRQVALVTIMAQLGSFVPAREASIGMVDGIFTRMGASDNISRGRSTFMEELLEASEILSHATSRSLVILDELGRGTSTHDGIAIAYATLEFFIRDVKCLTLFVTHYPPLCELEKLYPLHVGNYHMAFLLNEPEIVGDEEEVQPEFITFLYQLTEGAAGRSYGLNVARLANIPESILRTAALKSKELEAIINSRRRAVKGLSEAWKITNREALLEW 1105          
BLAST of Msh2 vs. Ensembl Cavefish
Match: msh4 (mutS homolog 4 [Source:ZFIN;Acc:ZDB-GENE-131121-643])

HSP 1 Score: 188.734 bits (478), Expect = 1.906e-49
Identity = 109/261 (41.76%), Postives = 150/261 (57.47%), Query Frame = 1
Query: 1741 LHQLSSIIAKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVEMQNNMSYIANDISFDESRTFQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIHCNVNNLHVTAQTIGNE------LIFMYKVEEG-PAVRSYGIEVAKASGLPDESIKLAK 2502
            L++LS  ++ LD+L SLA   C     Y RP+  D        +K  RHP +E       I+N+    E   F I+TGPNM GKSTY+R + L  +MAQIGSFVP + A   + D+I TRIG  D   T  STFM EM ++S+I  TA+ +SLIIIDELGRGTS  +G G+  ++ E +   LKAF+ FATH+ EL  L  ++ NV N H+  Q I  E      +++ Y +  G    R+YGI  A+ + +P   I+ AK
Sbjct:  457 LYKLSDAVSMLDMLLSLAN-ACTL-SDYVRPEFTD-----TLAIKQGRHPTLERITGKQPISNNSYISEGSNFVIVTGPNMSGKSTYLRQVALCQIMAQIGSFVPAEYASFRVADQIFTRIGVDDDFETNSSTFMVEMKEVSYITHTASERSLIIIDELGRGTSAEEGIGICHAVCEFL-INLKAFTLFATHYLELCQLETLYPNVENQHMQVQHIRREDNSTESVVYTYLLTRGFSEERNYGIRAAEMTSMPPSIIQEAK 709          
BLAST of Msh2 vs. Ensembl Cavefish
Match: msh3 (mutS homolog 3 [Source:NCBI gene;Acc:103037699])

HSP 1 Score: 189.119 bits (479), Expect = 5.975e-49
Identity = 113/316 (35.76%), Postives = 177/316 (56.01%), Query Frame = 1
Query: 1720 TNKYVGSLHQLSSIIAKLDVLCSLATMVCGAPGT----YARPKVVDDCKTRVFKVKNCRHPLVEM--QNNMSYIANDISFD-ESRTFQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIH-CNVNNLHVT-----AQTIGNE-------LIFMYKVEEGPAVRSYGIEVAKASGLPDESIKLAKLKLSEYENLMEWDSNHSEKLA-----ATRNALMEF 2592
            + K VG  H    I+ K   L  L   +    G     + +P+V++  + R   +++ RHP+++M       Y+ ND     + +   I+TGPNMGGKS+YIR + L+++MAQ+GSFVP   A I + D I TR+GA D    G STFM E+L+ S IL  ATS+SL+I+DELGRGTST DG  +A++  E    ++K  + F TH+  L +L K++  +V N H+       + +G+E       + F+Y++ EG A RSYG+ VA+ + +P+  ++ A LK  E E ++       + L+       R AL+E+
Sbjct:  757 STKVVGRYHS-PFIVEKYRCLLQLREQLVIDSGQEWINFLQPEVLE--QERHIVIRDGRHPVIDMLMGEQDQYVPNDTELQGDGKRAMIVTGPNMGGKSSYIRQVALVTIMAQLGSFVPAREASIGMVDGIFTRMGASDNISRGRSTFMEELLEASEILSHATSRSLVILDELGRGTSTHDGIAIAYATLEFFIRDVKCLTLFVTHYPPLCELEKLYPLHVGNYHMAFLLNEPEIVGDEEEVQPEFITFLYQLTEGAAGRSYGLNVARLANIPESILRTAALKSKELEAIINSRRRAVKGLSEAWKITNREALLEW 1069          
BLAST of Msh2 vs. Ensembl Sea Lamprey
Match: msh2 (mutS homolog 2 (E. coli) [Source:ZFIN;Acc:ZDB-GENE-040426-2932])

HSP 1 Score: 216.083 bits (549), Expect = 3.627e-63
Identity = 121/347 (34.87%), Postives = 198/347 (57.06%), Query Frame = 1
Query:   25 NSFSLFWNSLGDKPNSTIRFFDRQDYYTVHFEDAEMLARSYYKSMEILKYF-RRDSVSSPYINISKSNSDGVFKYLLIANQYKVEVYSNNKSHDS----WNLDFVATPGNLEKYQDILFKDVELVSSNSLLGLNIKRINDDYRIFLGFCDLDNGIFMIGGFEESFTGYEQLANLSSALFQLNCRECLIP-NDTRPELLAVKNAVQSAGLLVTEVKKSFFSSENVMNSILKLICKTKLNNENTVLKLVDTEGAETIGCLGSVITYLDLANDESFFNFFDVQTFKLDNYMRVGEQCSRALNILPSPND-LRKHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNR 1044
            N F  F+ S+ +K  +T+R FDR D+YTVH  DA +++R  +K+  ++K      S     + +SK N + V + LL+  QY+VEVY N     S    W L + A+PGNL +++DILF +V++ +S  ++ +     +    + +GF D       +  F ++    +Q +NL + L QL  +EC++P  + + +   ++  VQ +GLL+T+ KK  FSS++++  + +L+ KT+   +     L + E    +  L +++ YL+L +DES F  F++ TF L  Y+R+     RALN+    +D   +  SL+GLLN CRTA G+RLL QWIKQPL+D N I  R
Sbjct:   18 NGFVSFFASMSEKAEATVRLFDRADFYTVHGRDALLVSRDVFKTTAVVKMLGTAGSRKLESVVLSKMNFESVVRDLLLVRQYRVEVYRNRAGKASRDNDWQLAYKASPGNLAQFEDILFGNVDMSASAGVVAIQGGGADAQRVVGVGFADTTLRRLCVCEFPDN----DQFSNLEALLVQLGPKECVLPAGEVQADAGKLRQVVQRSGLLITDRKKVEFSSKDIVQDLNRLL-KTRKGEQANSAALSEMEKQVAMSSLAALVKYLELTSDESGFGQFELSTFDLGQYVRLDSAAVRALNLFQGSSDEGGRTQSLFGLLNRCRTAQGQRLLAQWIKQPLLDQNRIEER 359          
BLAST of Msh2 vs. Ensembl Sea Lamprey
Match: msh3 (mutS homolog 3 (E. coli) [Source:ZFIN;Acc:ZDB-GENE-060526-307])

HSP 1 Score: 204.912 bits (520), Expect = 5.050e-55
Identity = 193/716 (26.96%), Postives = 324/716 (45.25%), Query Frame = 1
Query:  529 LSSALFQLNCRECLIP---NDTRPELLAVKNAVQSAG---LLVTEVKKSFFSSENVMNSILKLICKTKL----NNENTVLKLVDTEGAETIGCLGSVITYL-DLANDESFFNFFDVQTFKLDNY-MRVGEQCSRALNILPSPNDLRKHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLINDNKLRGCLYEENLRRIPDLQRITRRLQRNKGNLQDIYKLYVALRQ----ASDMLNLLNEHNGPYKCIIQSELSS-VIQEILKDTE---NFIQMFTSFFDFEAVKNHE----FKVKCDVDESLKECENSMITLKSQMETESSRVSDKLGIESTKQLKFESSNSLGYYMRVSRKDENV-LRNKSFISI------IETLKDGVKFHSTQMTLMNESYLQHXXXXXXXXXXXXXXXMKITNKYVGSLHQLSSIIAKL---DVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVE--MQNNMSYIANDISFD-ESRTFQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIHCN-VNNLHV---------TAQTIGNE----LIFMYKVEEGPAVRSYGIEVAKASGLPDESIKLAKLKLSEYE 2523
            L S +  L   E LIP   +D     L    A  S G   + V  V    F       ++ +      L    N++   L  V       I CL  +I YL +   +   +   + Q F +++  + +     + + +  +  + +   SL   ++   T  G R+   W+ +PL+ ++ IN RLD V  ++    +     +E L ++PDL+R           L  IY    + ++    AS +  L  E +       Q +LSS ++  IL D       +Q +T   D +A K  +    F         L+  E     L+   E  +         E  + L+  +++    Y  VS ++  + +RN    ++      I + K   +FH+     + + + Q  +  E+       E +    ++    H   + +A+L   D L SLA +         RP+ V++    +  ++N RHP+VE  M +   Y+ N    D + +   IITGPNMGGKS+YIR + LI+VMAQ+GSFVP   A++S    I TR+GA D    G STFM E+ + S I++ AT  SL+I+DELGRGTST DG  +A++  E+   E++  + F TH+  + ++ +++   V+N H+         TAQ    E    + F+Y++ EGPA RSYG+ VA+ + +P++ +  A  K  E E
Sbjct:  210 LESRVLSLQPVELLIPAALSDETERSLCSLTANSSQGDDRVRVERVDVDLFEHSRAFQAVSRFFGAESLQSNCNHDEQKLSHVLAMEKPIIACLAVLIHYLTEFGLERVLYLSSNFQKFSMESECLHINGITQKNMELFQNQTNGKVKGSLLWAMDRTCTPFGRRMFRNWLGRPLISISDINARLDCVSEILASEHMVLSRAKELLWKLPDLER----------GLTSIYHRKCSTKEFSLIASSLERLCTETHA-LAASAQDQLSSPLLLGILLDVPRRLQHVQHYTRVLDKQAAKEGDKTRLFTDLTGFPRMLRRSEEIRAVLEELREHRT---------EVRRTLRSPAAD----YTTVSGQEFLIEVRNSMLHTVPSNWVKIGSTKAVTRFHTP---FVVQKFKQLCQLREKLRIDSNAEWLGFLTQFGEHYHNFRAAVAQLATLDCLFSLAAIASRDGYCSIRPEFVEE--KSLIVIENGRHPVVELLMGDQNQYVPNSTHLDADGKRAMIITGPNMGGKSSYIRQVALIAVMAQMGSFVPASHAKLSSLHAIHTRMGASDNIYKGHSTFMEELSEASEIIRKATRHSLVILDELGRGTSTHDGIAIAYATLEYFVKEVQCLTLFVTHYPPVCEMERLNAEVVSNYHMSFLLSEPEETAQGEDGERLESVTFLYQLTEGPAARSYGLNVARLAAIPEQVLHTAAQKSRELE 896          
BLAST of Msh2 vs. Ensembl Sea Lamprey
Match: msh6 (mutS homolog 6 (E. coli) [Source:ZFIN;Acc:ZDB-GENE-020905-3])

HSP 1 Score: 143.28 bits (360), Expect = 5.259e-35
Identity = 86/253 (33.99%), Postives = 133/253 (52.57%), Query Frame = 1
Query: 1864 FKVKNCRHPLVEMQN-NMSYIANDISFDESRTFQ-------IITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGD-----CQLTGVSTFMAEMLDISWILKTATSKSLIIIDEL-------GRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTD---------LSKIHCNV---NNLHVTAQTIGNELIFMYKVEEGPAVRSYGIEVAKASGLPDESIKLAKLKLSEYEN 2526
             +++  RHP V       S+I ND+    S           ++TGPNMGGKST +R  GLI +MAQ+G +VP +   ++  DR+ TR+GA D      +  G STF  E+ + S IL+ AT  SL+++DEL       GRGT+T+DG  +A ++   +A  ++  + F+TH+H L +         L  + C V   N+   + +TI     F+YK   G   +SYG   A+ +GLPD  ++    K  E+E+
Sbjct: 1121 LELRGSRHPCVSTTFLGDSFIPNDVVVGLSDGDDDGGARCVLVTGPNMGGKSTLMRQAGLIVIMAQLGCYVPAEACRLTPVDRVFTRLGASDRIMSVLRRAGESTFFVELSETSSILQHATRHSLVLLDELGFLLRPRGRGTATYDGTAIASAVVHELAEGVRCRTLFSTHYHSLVEDFAASPHVRLGHMACMVEQENDDDPSQETI----TFLYKFVAGACPKSYGFNAARLAGLPDAVVRAGHRKAREFES 1369          
BLAST of Msh2 vs. Ensembl Yeast
Match: MSH2 (Protein that binds to DNA mismatches; forms heterodimers with Msh3p and Msh6p that bind to DNA mismatches to initiate the mismatch repair process; contains a Walker ATP-binding motif required for repair activity and involved in interstrand cross-link repair; Msh2p-Msh6p binds to and hydrolyzes ATP [Source:SGD;Acc:S000005450])

HSP 1 Score: 481.485 bits (1238), Expect = 4.165e-156
Identity = 304/878 (34.62%), Postives = 497/878 (56.61%), Query Frame = 1
Query:   43 WNSLGDKPNSTIRFFDRQDYYTVHFEDAEMLARSYYKSMEILKYFRRDSVSSP-------YINISKSNSDGVFKYLLIANQYKVEVYSNNKSHDSWNLDFVATPGNLEKYQDILFKDVELVSSNSLLGLNIKRINDDYRIFLGFCDLDNGIFMIGGFEESFTGYEQLANLSSALFQLNCRECLIPN-----DTRPELLAVKNAVQSAGLLVTEVKKSFFSSENVMNSILKLICKTKLNNENTVLKLVDTEGAETIGCLGSVITYLDLANDESFFNFFDVQTFKLDNYMRVGEQCSRALNILP------------------SPNDLRKHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLINDNKLRGCLYEENLRRIPDLQRITRRLQRNKGNLQDIYKLYVALRQASDMLNLLN---EHNGPYKCI---IQSELSSVIQEILKDTENFIQMFTSFFDFEAVK-NHEFKVKCDVDESLKECENSMITLKSQMETESSRVSDKLGIESTKQLKFESSNSLGYYMRVSRKDENVLR-NKSFISIIETLKDGVKFHSTQM-TLMNESYLQHXXXXXXXXXXXXXXXMKITNKYVGSLHQLSSIIAKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVEMQNNMSYIANDISFDESR-TFQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIHCNVNNLHVTAQTIGN---------ELIFMYKVEEGPAVRSYGIEVAKASGLPDESIKLAKLKLSEYENL 2529
            +  L  KP  TIR  D+ DYYTV   DA  +A S Y +  +LK  + D V++        Y+ +S      + K  L+   YKVE+Y        W L   A+PGN+E+  +++  +++  SS  +  L ++  + D    +G   +D   + +G  +      E  +NL S L QL  +ECL+ +     ++  E+  V N +   G +VT +K S FS ++V   +      TKL  ++  L L       ++G   ++I YL L +++     +++   KL  +M++     +ALN+ P                  S  +  K  SL+ LLN C+T +G RLL +W+KQPL +++ IN R D+V+ LI+  +LR  L  E L  IPD++R+T++L + +GNL+D+ K+Y   ++  +++ +     E + P + +   ++S   + +   ++    F +M  +  D +A + N+EF +K + +E L +  + + TL+ ++ +     ++ LG +  K+LK E+ +  G+ MR++R D   LR +K +I +  T+K G+ F + Q+ ++ NE+ +  +   ++    + E  + IT  Y     +LS ++A LDV+ S A     AP  Y RPK+      R   + + RHP++EMQ+++S+I+ND++ +  +  F IITGPNMGGKSTYIR +G+IS+MAQIG FVPC+ AEI+I D I+ R+GAGD QL GVSTFM E+L+ + ILK A+  SLII+DELGRGTST+DGFGLAW+I+EHIA+++  F+ FATHFHELT+LS+   NV N+HV A    N         ++  +YKVE G + +S+GI VA+    P++ +K+AK K +E ++L
Sbjct:   23 YTGLPKKPLKTIRLVDKGDYYTVIGSDAIFVADSVYHTQSVLKNCQLDPVTAKNFHEPTKYVTVSLQVLATLLKLCLLDLGYKVEIYDK-----GWKLIKSASPGNIEQVNELMNMNID--SSIIIASLKVQWNSQDGNCIIGVAFIDTTAYKVGMLD--IVDNEVYSNLESFLIQLGVKECLVQDLTSNSNSNAEMQKVINVIDRCGCVVTLLKNSEFSEKDVELDL------TKLLGDDLALSLPQKYSKLSMGACNALIGYLQLLSEQDQVGKYELVEHKLKEFMKLDASAIKALNLFPQGPQNPFGSNNLAVSGFTSAGNSGKVTSLFQLLNHCKTNAGVRLLNEWLKQPLTNIDEINKRHDLVDYLIDQIELRQMLTSEYLPMIPDIRRLTKKLNK-RGNLEDVLKIYQFSKRIPEIVQVFTSFLEDDSPTEPVNELVRSVWLAPLSHHVEPLSKFEEMVETTVDLDAYEENNEFMIKVEFNEELGKIRSKLDTLRDEIHSIHLDSAEDLGFDPDKKLKLENHHLHGWCMRLTRNDAKELRKHKKYIEL-STVKAGIFFSTKQLKSIANETNILQKEYDKQQSALVREI-INITLTYTPVFEKLSLVLAHLDVIASFAHTSSYAPIPYIRPKLHPMDSERRTHLISSRHPVLEMQDDISFISNDVTLESGKGDFLIITGPNMGGKSTYIRQVGVISLMAQIGCFVPCEEAEIAIVDAILCRVGAGDSQLKGVSTFMVEILETASILKNASKNSLIIVDELGRGTSTYDGFGLAWAIAEHIASKIGCFALFATHFHELTELSEKLPNVKNMHVVAHIEKNLKEQKHDDEDITLLYKVEPGISDQSFGIHVAEVVQFPEKIVKMAKRKANELDDL 882          
BLAST of Msh2 vs. Ensembl Yeast
Match: MSH3 (Mismatch repair protein; forms dimers with Msh2p that mediate repair of insertion or deletion mutations and removal of nonhomologous DNA ends, contains a PCNA (Pol30p) binding motif required for genome stability [Source:SGD;Acc:S000000688])

HSP 1 Score: 207.994 bits (528), Expect = 5.512e-56
Identity = 180/582 (30.93%), Postives = 295/582 (50.69%), Query Frame = 1
Query:  898 LNILPSPNDLRK-----HD----SLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLINDNKLRGCLYEENLRRI----PDLQRITRRLQRNKGNLQDIYKLYVALRQASDMLNLLNEHNGPYKCIIQS-------------ELSSVIQEILKDTENFIQMFTSFFDFEAV--KNHEFKVKCDVDESLKECENSMITLKSQMETESSRVSDKLGIESTKQLKFESSN---SLGYYMRVSR---KD-------ENVLRNKSFISIIETLKDGVKFHSTQMTLMNESYLQHXXXXXXXXXXXXXXXMKITNKYVGSLHQLSSIIAKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVEMQNNMSYIANDISFD-ESRTFQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELK--AFSAFATHFHELTDL-SKIHCNVNNLHVTAQTIGNE---LIFMYKVEEGPAVRSYGIEVAKASGLPDESIKLA 2499
            +++L  PN L+      HD    SL+ LL+  RT+ G R+L +WI +PL+DV+ I  RLD +E + ++  +   ++ E+L ++    PDL R   R+     + +++Y     L+Q +  ++    H        +S              L S + E+L  T+  +  F +  +  AV  KN + +V    + +  +C   +I ++ + E+  S++ ++L  E  K LK    N    + Y + V     KD        N  +  S  +   T K   K    +  L+ ES LQ++               KIT +Y   L +++  +A+ D + SLA   C     Y RP  V+  +  +   KN R+P++E  + + Y+ NDI    E+    IITGPNMGGKS+YIR + L+++MAQIGSFVP +   +SIF+ ++TRIGA D  + G STF  EMLDI  ILK    +SL+++DE+GRGT T DG  +++++ ++ + EL       F THF  L ++ S +  N +  +V  Q  G +   +IF+YK+++G    SYG+ VAK + L  + I  A
Sbjct:  416 IHMLLDPNSLQSLDIFTHDGGKGSLFWLLDHTRTSFGLRMLREWILKPLVDVHQIEERLDAIECITSE--INNSIFFESLNQMLNHTPDLLRTLNRIMYGTTSRKEVY---FYLKQITSFVDHFKMHQSYLSEHFKSSDGRIGKQSPLLFRLFSELNELLSTTQ--LPHFLTMINVSAVMEKNSDKQVMDFFNLNNYDCSEGIIKIQRESESVRSQLKEELA-EIRKYLKRPYLNFRDEVDYLIEVKNSQIKDLPDDWIKVNNTKMVSRFTTPRTQKLTQKLEYYKDLLIRESELQYKEFLN-----------KITAEYT-ELRKITLNLAQYDCILSLAATSCNV--NYVRPTFVNGQQAII--AKNARNPIIESLD-VHYVPNDIMMSPENGKINIITGPNMGGKSSYIRQVALLTIMAQIGSFVPAEEIRLSIFENVLTRIGAHDDIINGDSTFKVEMLDILHILKNCNKRSLLLLDEVGRGTGTHDGIAISYALIKYFS-ELSDCPLILFTTHFPMLGEIKSPLIRNYHMDYVEEQKTGEDWMSVIFLYKLKKGLTYNSYGMNVAKLARLDKDIINRA 971          
BLAST of Msh2 vs. Ensembl Yeast
Match: MSH6 (Protein required for mismatch repair in mitosis and meiosis; forms a complex with Msh2p to repair both single-base & insertion-deletion mispairs; also involved in interstrand cross-link repair; potentially phosphorylated by Cdc28p [Source:SGD;Acc:S000002504])

HSP 1 Score: 160.614 bits (405), Expect = 9.888e-41
Identity = 97/286 (33.92%), Postives = 151/286 (52.80%), Query Frame = 1
Query: 1762 IAKLDVLCSLA--TMVCGAPGTYARPKVVDDCKTRV-------FKVKNCRHPLVEMQNNMS--YIANDISF-DESRTFQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIHCNVNNLHVT--AQTIGNELIFMYKVEEGPAVRSYGIEVAKASGLPDESIKLAKLKLSEYENLMEWDSNHSEKLAATRN 2577
            I+ +D L ++   +   GAP    RP +VD+  ++         K K+ RHP   +    +  +I NDI    E     ++TG N  GKST +R   +  +MAQ+G +VPC+ A ++  DRIMTR+GA D  + G STF  E+ +   IL  AT++SL+++DELGRG S+ DGF +A S+  H+AT +++   FATH+  L    K H  V  L ++         + F+YK+ EG +  S+G+ VA   G+  E I  A++     E        H+ +L   R+
Sbjct:  902 ISNIDCLLAITRTSEYLGAPS--CRPTIVDEVDSKTNTQLNGFLKFKSLRHPCFNLGATTAKDFIPNDIELGKEQPRLGLLTGANAAGKSTILRMACIAVIMAQMGCYVPCESAVLTPIDRIMTRLGANDNIMQGKSTFFVELAETKKILDMATNRSLLVVDELGRGGSSSDGFAIAESVLHHVATHIQSLGFFATHYGTLASSFKHHPQVRPLKMSILVDEATRNVTFLYKMLEGQSEGSFGMHVASMCGISKEIIDNAQIAADNLE--------HTSRLVKERD 1177          

HSP 2 Score: 56.9954 bits (136), Expect = 1.414e-8
Identity = 39/144 (27.08%), Postives = 71/144 (49.31%), Query Frame = 1
Query:  898 LNILPSPNDLRKHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLINDNKLRGCLYEENLRRIPDLQRITRRLQRNKGNLQDIYKLYVALRQASDMLNLLNEHNGPYKCIIQSELSSVIQEILKDTENFIQMF 1329
            L I  +  D     +L+ L N   T  G+R++ +W+  PL+  N I +RLD V+SL+ D  LR  L E    ++PDL+R+  R+      ++D  K+  A     ++ + L   N   K  +   +SS  + +++  +++   F
Sbjct:  624 LEIFSNSFDGSDKGTLFKLFNRAITPMGKRMMKKWLMHPLLRKNDIESRLDSVDSLLQDITLREQL-EITFSKLPDLERMLARIHSRTIKVKDFEKVITAFETIIELQDSLK--NNDLKGDVSKYISSFPEGLVEAVKSWTNAF 764          
BLAST of Msh2 vs. Ensembl Yeast
Match: MSH1 (DNA-binding protein of the mitochondria; involved in repair of mitochondrial DNA; has ATPase activity and binds to DNA mismatches; has homology to E. coli MutS; transcription is induced during meiosis [Source:SGD;Acc:S000001162])

HSP 1 Score: 147.902 bits (372), Expect = 8.228e-37
Identity = 91/266 (34.21%), Postives = 149/266 (56.02%), Query Frame = 1
Query: 1741 LHQLSSIIAKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVE----MQNNMSYIANDISFDESRTFQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHF-HELTDLSKIHCNVN-----NLHVTAQTI--GNELIFMYKVEEGPAVRSYGIEVAKASGLPDESIKLAK 2502
            + Q+++ +  LD L S A  V         PKV +  K    +V N RH +VE     ++  ++ AN+    +   + +ITGPNMGGKST++R   +I ++AQIG FVPC  A + I D++ +R+G+ D     +STFM EM++ S+IL+ AT +SL I+DE+GRGTS  +G  +A++  +++    +  + FATHF  EL  +    C+         + +  T   GN   + +K++ G   +S  I VA+ +G P E++K A+
Sbjct:  696 VRQVATTLGYLDTLSSFA--VLANERNLVCPKVDESNK---LEVVNGRHLMVEEGLSARSLETFTANNCELAKDNLW-VITGPNMGGKSTFLRQNAIIVILAQIGCFVPCSKARVGIVDKLFSRVGSADDLYNEMSTFMVEMIETSFILQGATERSLAILDEIGRGTSGKEGISIAYATLKYLLENNQCRTLFATHFGQELKQIIDNKCSKGMSEKVKFYQSGITDLGGNNFCYNHKLKPGICTKSDAIRVAELAGFPMEALKEAR 955          

HSP 2 Score: 51.9878 bits (123), Expect = 4.252e-7
Identity = 45/179 (25.14%), Postives = 82/179 (45.81%), Query Frame = 1
Query:  868 MRVGEQCSRALNILPSPNDLRKHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLINDNKLRGCLYEENLRRIPDLQRITRRLQRNKGNLQDIYKLYVALRQASDMLNLLNEHNGPYKCIIQSELSSVIQEILKDTENFIQMFTSFFDFEAV-KNHEFKVKCDVDESL 1401
            M++  + S AL +  +  D  K  SL   +    T SG RLL QW+  P +D+  I  R  IV +   DN+         L+++ DL RI ++    +G   ++ ++  +L  + ++   L  +    K  ++S+++  + E L   +N I     F + E + K+ + K   DV   L
Sbjct:  363 MQIDSRTSTALELHSTVRDNNKKGSLLSSIRRTVTPSGTRLLSQWLSGPSLDLKEIKKRQKIV-AFFKDNRDITETLRTMLKKVNDLSRILQKFSFGRGEALELIQMARSLEVSREIRKYLLNNTSLMKATLKSQITQ-LTESLNFEKNLIDDILKFLNEEELAKSQDAKQNADVTRML 539          
BLAST of Msh2 vs. Ensembl Yeast
Match: MSH4 (Protein involved in meiotic recombination; required for normal levels of crossing over, colocalizes with Zip2p to discrete foci on meiotic chromosomes, has homology to bacterial MutS protein [Source:SGD;Acc:S000001891])

HSP 1 Score: 136.346 bits (342), Expect = 2.788e-33
Identity = 148/579 (25.56%), Postives = 270/579 (46.63%), Query Frame = 1
Query:  826 FNFFDVQTFKLDNYMRVGEQCSRALNILPSPNDLRKHD-SLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESL-INDNKLRGCLYEENLRRIPDLQRITRRLQ-------RNKGNLQDIYKLYVALRQASDMLNLLNEHNGPYKCIIQSELSSVIQEILKDTE--NFIQMFTSFFDFEAV-KNHEFKVKCDVDESLKECENSMITLKSQMETESS----RVSDKLGIESTKQLKFESSNSLGYYMRVSRK---DENVLRNKSFISIIETLKDGVKFHSTQMTLMNESYLQHXXXXXXXXXXXXXXXM--KITNKYVGSLHQLSSIIAKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVE--MQNNMSYIANDIS-FDESRTFQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEH-IATELKAFSAFATHFHELTDLSKIHCNVNNLHVTAQTIGNELIFM-YKV-EEGPAVRSYGIEVAKASGLPD 2481
            F    +Q    +N M +  +  R L ++   N L K+  SL+  L+   T  G+R L   I QPL D   I  RL+ +E L  ND+ L+    E  ++ +PDL ++  RL        +    +  +  L   L+    + + LN+       +IQS L S  ++I  +       ++  S  + + V  +   ++      ++K   N ++ +  Q+  E      R  + L  ++   L     ++ G+Y+R+ R+   D+       FIS   T+K      +T   +   + L+   +          + +  KI   ++  L  ++  +A LD++CS    +      Y  P   ++       +++ RHPL+E  ++N   ++ N IS    S + QIITG NM GKS Y++ + LI +MAQ+GS +P       +F R+  R+     +LT  S F  EM ++++ L    +++L+I+DELGRG+S  DGF ++ +++EH + TE   F   +THF ++  +      V++LH+ A  + +  + M Y++ ++  A+ + GI V K    PD
Sbjct:  251 FRKLRIQFEGTENTMLIDSKTVRGLELVE--NKLDKNGISLWKFLDTTSTKMGQRSLRNSILQPLTDRGSIEMRLEALEELKANDDLLQKLRLE--MKSLPDLDKLFSRLLCINHSAIKPDQRINYVLLLKETLQSVKSLKDALNDQ------LIQSRLISETKKIFNNDAIMEIEKLINSCINEDCVWASSAIQLLNQRSYAVKSDSNGLLDVSRQIYKEVKEEFFREVEDLTAKNKINLDHNYDSARGFYLRIKRQEFTDDVATLPDVFIS--RTIKKNYIECTTLNIIKKNARLKEVMEEILLLSEETVDELLDKIAT-HISELFMIAEAVAILDLVCSFTYNL--KENNYTIPIFTNN-----LLIRDSRHPLLEKVLKN---FVPNTISSTKHSSSLQIITGCNMSGKSVYLKQVALICIMAQMGSGIPALYGSFPVFKRLHARVCNDSMELTS-SNFGFEMKEMAYFLDDINTETLLILDELGRGSSIADGFCVSLAVTEHLLRTEATVF--LSTHFQDIPKIMSKKPAVSHLHMDAVLLNDNSVKMNYQLTQKSVAIENSGIRVVKKIFNPD 803          
BLAST of Msh2 vs. Ensembl Nematostella
Match: EDO38319 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SD83])

HSP 1 Score: 531.176 bits (1367), Expect = 7.317e-177
Identity = 282/679 (41.53%), Postives = 423/679 (62.30%), Query Frame = 1
Query:  502 FTGYEQLANLSSALFQLNCRECLIPN-DTRPELLAVKNAVQSAGLLVTEVKKSFFSSENVMNSILKLICKTKLNNENTVLKLVDTEGAETIGCLGSVITYLDLANDESFFNFFDVQTFKLDNYMRVGEQCSRALNILPSPNDL-RKHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLINDNKLRGCLYEENLRRIPDLQRITRRLQRNKGNLQDIYKLYVALRQASDMLNLLNEHNGPYKCIIQSELSSVIQEILKDTENFIQMFTSFFDFEAVKNHEFKVKCDVDESLKECENSMITLKSQMETESSRVSDKLGIESTKQLKFESSNSLGYYMRVSRKDENVLRNKSFISIIETLKDGVKFHSTQMTLMNESYLQHXXXXXXXXXXXXXXXMKITNKYVGSLHQLSSIIAKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVEMQNNMSYIANDISFD-ESRTFQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIHCNVNNLHVTAQTIGNELIFMYKVEEGPAVRSYGIEVAKASGLPDESIKLAKLKLSEYENL 2529
            F   +Q +NL + + QL  +ECL+ + D+  +       V+ + +LVTE KK  FS+++++  + +L+  T   N  T   L + +       L +VI YL+L +DES F+ F + +F L  YM++     RALN+LP+P D   K   L GLLN C+T  G+RL+ QWIKQPLMD N I  RL+IVE+ + D +LR  L +E +++ PD  R+ ++ QR K  LQD  ++Y ++++     ++L  ++G ++ ++       + E++ D   F  +  +  D E V+NHE+ +K   DE L+EC   M  +  +   E ++    L +E +K +K ES+N LGY+ R++RK+E VLRN    S IET KDGV+F ++ ++ +N+ +  ++  Y + +  +  E++KI   Y   +  LS +IA++D L S A +   AP  Y RP +          +   RHP +E+Q+N+++IAND++   + + F IITGPNMGGKSTYIR IG+I +MAQ+G FVPC  A+ISI D I+ R+G+GD QL GVSTFM+EML+ + IL+TAT  SLIIIDELGRGTST+DGFGLAW+ISE+IAT++K+F  FATHFHELT L+     V NLHVTA T G  L  +YKV+ G   +S+GI VA+ +  P + I+ AK K +E E+ 
Sbjct:   38 FADNDQFSNLEALIVQLGPKECLMASTDSSGDAAKTHEVVKRSNILVTERKKVEFSNKDIVQDLNRLLKLTAGGNSAT---LPEMDMIHATAALAAVIKYLELLSDESNFSQFKLSSFDLSQYMKLDAAAVRALNLLPNPMDGGNKSMCLTGLLNKCKTPQGQRLVAQWIKQPLMDKNKIEERLNIVEAFVEDTELRQTLQDE-MKKFPDFSRLAKKFQRQKATLQDCVRVYQSVQRLEPFADVLERYHGDHRKLLVECFRDPLMELVADFAKFCDLVETTIDLEQVENHEYLIKATFDEGLQECREHMDEILEKFPVELNKAGRDLSLEPSKTIKLESNNQLGYFFRITRKEEKVLRNNKRYSTIETRKDGVRFTNSALSQLNDEFRGYKDTYNDVQGKLAAEVLKIAGGYSEPMQGLSDVIAQIDALVSFAHVSANAPIPYVRPTITPKGSEGDIILTGSRHPCLEIQDNVAFIANDVTLSRDKQMFLIITGPNMGGKSTYIRQIGVIVLMAQLGCFVPCSTAQISITDCILARVGSGDSQLKGVSTFMSEMLETASILRTATKDSLIIIDELGRGTSTYDGFGLAWAISEYIATQIKSFCLFATHFHELTSLADEVSTVTNLHVTALTTGGTLTLLYKVKPGVCDQSFGIHVAELAHFPSDVIEFAKQKAAELEDF 712          
BLAST of Msh2 vs. Ensembl Nematostella
Match: EDO26509 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TBU4])

HSP 1 Score: 196.052 bits (497), Expect = 9.019e-57
Identity = 107/269 (39.78%), Postives = 164/269 (60.97%), Query Frame = 1
Query: 1729 YVGSLHQLSSIIAKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVEMQNNMS--YIANDISFDESRTFQI-ITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATEL-KAFSAFATHFHELTDLSKIHCNVNNLHVTAQTIGNELIFMYKVEEGPAVRSYGIEVAKASGLPDESIKLAKLKLSEYE 2523
            +V  + Q ++ IA+LD L S A         Y RP ++D+      ++KN RHP++E Q  +   YIAND+  + ++   I ITGPNM GKS  +R   LI ++AQ+GS+VP   A I I D+I TR+GA D    G STFM EM + + IL   + +SL+++DE+GRGTST+DG  +AW+I+E +     KA + FATH+HEL D+++    + N +V+ + + + +IF+ K+  G +  S+GI VAK +G+P+  I  A   L + E
Sbjct:    1 FVQPVQQNANSIAQLDCLLSFAKTAID--NNYVRP-ILDESTD--LEIKNGRHPVIEKQLPIGEEYIANDVVLNRNQQQIIMITGPNMSGKSAILRQTALIVLLAQMGSYVPAQNARIGIVDKIFTRVGASDNISMGESTFMVEMNETASILNNISERSLVLLDEIGRGTSTYDGISIAWAIAEFLHEHPSKAKTLFATHYHELNDMTETFERIKNYNVSVKELKDTIIFLRKLVAGGSNHSFGIHVAKLAGMPNRVIHRASKILEQLE 264          
BLAST of Msh2 vs. Ensembl Nematostella
Match: EDO38799 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBW8])

HSP 1 Score: 199.519 bits (506), Expect = 4.817e-53
Identity = 174/587 (29.64%), Postives = 277/587 (47.19%), Query Frame = 1
Query:  856 LDNYMRVGEQCSRALNILPSPNDLRKHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVE---SLINDNKLRGCLYEENLRRIPDLQRITRRLQRNKGNLQDIYKLYVALRQASDMLNLLNEHNGPYKCIIQSELSSVIQEILKDTENFIQMFTSFFDFEAVKNHEFKVKCDVDES----LKECENSMITLKSQMETESSRVSDKLGIESTKQLKFESSNSLGYYMRVSRKDENV-LRNKSFISI------IETLKDGVKFHSTQMTLMNESYLQHXXXXXXXXXXXXXXXMKITNKYVGSLHQLSSIIAKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVE--MQNNMSYIANDISFD-ESRTFQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIHC-NVNNLHVTAQTIGNE------------LIFMYKVEEGPAVRSYGIEVAKASGLPDESIKLAKLKLSEYEN 2526
            +  +M++     + L IL S    RK  SL G+L+   T  G+RLL +WI QPL++   I  RL  V    +L +D  L   ++   L  IPDL++    +   K +  +   +  AL +  D L    E N   +    S LS    E+  D  + ++ F +  D +A K  + K K   D S    +  C   +  L ++++   S +   +   S              Y  VS  +  + +RN    S+      I   K   +F +  +    +S  Q R    +  +    E + I +      H+   ++A LD + SLAT V   PG Y  P +  + +     +   RHP+++  +Q +  Y+ N+   + E     IITGPNMGGKS+YI+ + LI +MAQ+GSFVP    E++  D I TR+GA D    G STFM E+ + S IL  AT +SL+I+DELGRGTST DG  +A++   H   +  + + F TH+  L +L +I   +V N H+   T   +            + F+Y++  G A RSYG+ VA+ +G+P   + +A  K  + E+
Sbjct:  313 IAKFMKLNGCALQNLEILKSQCGSRK-GSLLGILDHTSTPFGKRLLKRWITQPLLEKREIEERLKAVSCLSALSSDQPLLKSIHR-LLSHIPDLEKGLCAIYYKKCSTVEFLSIAKALSKLHDELKS-TELNSAKELAGSSILSRTFTEV-PDLLSGVEDFLNQIDEKAAKCGD-KTKLFTDPSKFPPVLTCIQEIDGLTAELKEHRSEIRRTIQHPSVD------------YCTVSGNEFLIEVRNAKLPSVPADWIKISATKQICRFRTPFVEEKFKSICQWREKLAQACQEAWLEFLDIFSTSYTRFHRAVKLVANLDCIMSLAT-VARQPG-YVCPVIKKETEASSVLITQGRHPVIDVLLQEHAQYVPNNTELNTEGPRCMIITGPNMGGKSSYIKQVALIVLMAQMGSFVPAHSVELTPLDAIYTRMGASDNIYKGRSTFMVELQETSEILAQATRRSLVILDELGRGTSTHDGVAIAYATLRHFIDQTHSLTLFVTHYPSLAELERIFPGHVTNNHMAFMTSDGDTELASVAMDTPAVTFLYELVRGVAARSYGLNVARLAGIPINIVAMAAGKSHDLES 880          
BLAST of Msh2 vs. Ensembl Nematostella
Match: EDO35291 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM04])

HSP 1 Score: 183.726 bits (465), Expect = 6.790e-48
Identity = 146/518 (28.19%), Postives = 258/518 (49.81%), Query Frame = 1
Query:  889 SRALNILPSPNDLRKHDSLYGLLNCCRTASGER----LLLQWIKQPLMDVNLINNRLDIVESLINDNKLRG-CLYEENLRRIPDLQRITRRLQRNKGNLQDIYKLYVALRQASDML--NLLNEHNGPYKCIIQSELSSVIQEILKDTENFIQMFTSFFDFEAVKNHEF--KVKC---DVDESLKECENSMITLKSQMETES-SRVSD---KLGIESTKQLKFESSNSLGYYMRVSRKDENVLRNKSF---ISIIETLKDGVKFHSTQMTLMNESYLQHXXXXXXXXXXXXXXXMKITNKYVGSLHQLSSIIAKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVEMQNNMSYIANDISFDESRTFQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIHCNVNNLHVTAQT 2385
            ++ L ++ +  D +   SL+G+LN  RTA G +    + L  I +      L  N   ++   ++ + L   C+       +   +     +   K  L+ I  L  AL+     L          P    I  ++ SVI +  +  +  + M T      AVK  +   K +C   D   S+  C   ++ +  +  TE+   ++D   +L  +    LK   +N+ G+++++    E  +   S    +  +  +K+ + F +  +  +N+   +   +       ++ E++      +G L++L+ +++ LD+L S A  +C     Y RP+  D        +K  RHP+++   + + + N++   E   F IITGPNM GKSTY++ I L+ VMAQIG +VP + A   + D+I +RIG+ D   T  STFM EM +I++I++ A+ KSLII+DELGRGTS+ +G G+ +++ EH+   +KAF+ FATHF ELT + +++ NV NLH   Q+
Sbjct:  260 AKNLELIQNVRDAKSEHSLFGVLNYTRTAGGNKETINMRLDCIAELTEKEELFYNIQTVIGRFLDVDHLTSMCVQIPKHETVKTAESKINTVIYLKHTLELIEPLQSALKDTDTPLFKAYFESLKDPRFTAIMEKIQSVIHDDTRYQKGALNMRTQ--KCFAVKYEQTVEKYECMCLDFRPSVVRCPVGLLDVARRTYTETVDDITDLIKQLAEKYELPLKVGFNNTRGFFIQMQLSKEQDVDTSSLPGELIKVSKVKNNLTFSTGDLIKLNDRIRESLNEIYLMANVVVSELLSDIRDQIGCLYKLAELVSMLDMLVSFA-HICTL-SDYVRPEFTD-----TLAIKQGRHPILDKILHETPVPNNMYAAEGTNFLIITGPNMSGKSTYLKQIALLQVMAQIGCYVPAEYASFRLADQIFSRIGSDDDIETNSSTFMLEMKEINYIIQNASDKSLIIVDELGRGTSSEEGVGICYAVCEHLLG-IKAFTFFATHFLELTTMDELYPNVENLHFEIQS 767          
BLAST of Msh2 vs. Ensembl Nematostella
Match: EDO48759 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIQ7])

HSP 1 Score: 172.555 bits (436), Expect = 3.106e-44
Identity = 162/629 (25.76%), Postives = 285/629 (45.31%), Query Frame = 1
Query:  742 LVDTEGAETIGCLGSVITYLD-------LANDESFFNFFDVQTFKLDNYMRVGEQCSRALNIL---------PSPNDLRKHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNR------------LDIVESL------INDNKLRGCLYEENLRRIPDLQRITRRLQRNKGNLQDIYKLYVALRQASDMLNLLNEHNGPYKCIIQSELSSVIQEILKDTENFIQMFTSFFDFE-AVKNHEFKVKCDVDESLKECENSMITLKSQMETESSRVSDKLGIESTKQLKFESSNSLGYYMRVSR----KDENVLRNKSFISIIETLKDGVKFHSTQMTLMNESYLQHXXXXXXXXXXXXXXXMKITNKYVGSLHQLSSIIAKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVEMQNNMSYIANDISFDE-SRTFQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEH-IATELKAFSAF-ATHFHELTDLSKIHCNVNNLHV-TAQTI--GNELIFMYKVEEGPAVRSYGIEVAKASGLPDESIK 2493
            LV  +    +   G+++ YL+       L + +      D+  F +D+ + V +    AL I           S    ++  SL+G+LN  R+A G RLL  W  +P  D+ ++  R            +D++ SL      + +  +R  + +  L+ +  + RI  R++  + ++ D   LY  +  A  + +L      P +  I  +++ ++ +   D  N   +  +  DF+ + + + F VK  VD +L E + +   L   M   + +  +KL   S  +        LGY + V R    K+E          +   L + + ++ +  T  +E+ + HR                   +    L  +    A+LD L SLA  V      Y  P++       +  +    HPL E+  +  ++ ND + +E S    I+TGPN  GKS Y++ +GLI  +A IGSFVP + A I + DR+ TRI   +    G+STFM ++  ++  +++AT KSL++IDE G+GT+T DG  L  +   H +A+  K      +THFH L    K+  ++  L   T + I  G EL+F+Y + +G A  SY   +A  +G+P+  +K
Sbjct:  183 LVPFDNVNMVRAAGALLKYLEKKRFGQELEDPDVHVPILDLVVFSIDDMVIVDDNTYSALQIFQKESHPSVYKSGTSSKEGLSLFGVLNRTRSALGSRLLRMWFLRPTRDILVLTERQKAITFFTTPRNIDLIASLQDCLKNVKNVSVRLYITKRELK-VKSVPRILVRMKTAQASITDWQALYKTVYNAMYIADLCR--TIPSEIAIAKKITVLVTQ---DLHNIASLINTIIDFDDSTEQNRFVVKPGVDPALDERKRTYNGLPDFMTKVARKELNKLN-PSIVECNVIYLPQLGYLLAVPRTTKMKEEKDFEMDGLDFVF--LSNNMVYYKSASTRDHETAIMHRLQSTIL-------------ERTKVLLDVMECTAELDCLISLA--VSARENNYVCPEITSKS---ILHITGGMHPLQELCVS-QFVPNDTAINEDSGRVVILTGPNASGKSVYLKQVGLIVFLAHIGSFVPAESAIIGVTDRLFTRIHTRETVSVGLSTFMIDLNQVASAIQSATDKSLVLIDEFGKGTATVDGLSLLCATLRHWLASSSKCPKTLVSTHFHSLIR-QKLLPDIPILRFQTTEVIQDGKELVFLYHLVDGHAKTSYASHIAALAGMPEHLVK 782          
BLAST of Msh2 vs. Ensembl Medaka
Match: msh2 (mutS homolog 2 [Source:NCBI gene;Acc:101167993])

HSP 1 Score: 617.076 bits (1590), Expect = 0.000e+0
Identity = 340/862 (39.44%), Postives = 524/862 (60.79%), Query Frame = 1
Query:    1 N*NMDELT-NSFSLFWNSLGDKPNSTIRFFDRQDYYTVHFEDAEMLARSYYKSMEILKYFRRDSVSSPYINISKSNSDGVFKYLLIANQYKVEVYSNN----KSHDSWNLDFVATPGNLEKYQDILFKDVELVSS-NSLLGLNIKRINDDYRIFLGFCDLDNGIFMIGGFEESFTGYEQLANLSSALFQLNCRECLIPN-DTRPELLAVKNAVQSAGLLVTEVKKSFFSSENVMNSILKLICKTKLNNENTVLKLVDTEGAETIGCLGSVITYLDLANDESFFNFFDVQTFKLDNYMRVGEQCSRALNILP-SPNDLRKHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLINDNKLRGCLYEENLRRIPDLQRITRRLQRNKGNLQDIYKLYVALRQASDMLNLLNEHNGPYKCIIQSELSSVIQEILKDTENFIQMFTSFFDFEAVKNHEFKVKCDVDESLKECENSMITLKSQMETESSRVSDKLGIESTKQLKFESSNSLGYYMRVSRKDENVLRNKSFISIIETLKDGVKFHSTQMTLMNESYLQHXXXXXXXXXXXXXXXMKITNKYVGSLHQLSSIIAKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVEMQNNMSYIANDISFDES-RTFQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIHCNVNNLHVTAQTIGNELIFMYKVEEGPAVRSYGIEVAKASGLPDESIKLAKLKLSEYENLMEWDSNHSEK 2559
            N +MD +  + F  F  S+ +KP++T R FDR +YYTVH +DA   A+  +K+  ++KY    S     + +SK N +   K LL+  QY+VEVY N+    K HD W +++ A+PGNL +++DILF           ++ +      D  R+ +G   +D     +G  E  F   E  +NL S L Q++ +ECL+   D+  +   ++  VQ  G+LV++ K++ FSS+++   + +L+ + K         L + +    + CL +V+ +LDL +DES FN F + +  L  YMR+      ALN+   SP+D+    SL GLLN CRT  G+RL+ QWIKQPLMD   I  RLD+VES + D++LR     + L R PDL R+ ++  R+   LQD Y++Y A+ Q   ++    +++G Y+ ++Q+  +S + ++  D   + +M  +  D   + +HEF VK   D  L E    M  L+  M+   +  + +LG+E+ K +K ES+  LG+Y+RV+ K+E  LRN    + ++  K+GV+F +++++ +NE Y +++ +YEE + +I++EI+ I + YV  L  LS +IA+LD + SLA     AP  Y RP+++D+   R  ++   RHP +E   + ++I ND+SF +  R+F IITGPNMGGKSTYIR +G+I++MAQIG FVPC+ AE+S+ D I+ R+GAGD Q+ GVSTFM+EML+ + IL++AT  SLIIIDELGRGTST+DGFGLAW+ISEHIA+++  F  FATHFHELT L+    +V+NLHVTA T  N L  +Y+V+ G   +S+GI VA+ +  P   + +A+ K  E E   E   N  E+
Sbjct:    8 NFSMDSVAEHGFLSFIFSMPEKPDTTFRIFDRNEYYTVHGKDAIFAAKEVFKTNGVIKYLGAGSRKLESVILSKLNFEAFVKDLLLVRQYRVEVYRNHSKSSKEHD-WRIEYKASPGNLTQFEDILFGGATGAEGCAGVVAVRFATAADGQRV-VGVGYVDAAQRKMGVCE--FPDNEIFSNLESLLVQISPKECLLAQGDSSTDGNKLREVVQRGGMLVSDRKRADFSSKDITQDLNRLL-RVKKGEAMASSTLSELDKQVAMSCLAAVVRFLDLLSDESNFNSFSLASLDLGQYMRLDNAAVGALNLFQGSPDDISGAHSLAGLLNKCRTPQGQRLVNQWIKQPLMDKTKIEERLDLVESFVCDSELRQTCQGDLLHRFPDLHRLAKKFHRHSATLQDCYRVYQAVSQIPGLIAAFEKYSGSYQVLLQAVFTSPLTDLQTDFTKYQEMVETTLDMNQIDHHEFLVKASFDPVLTELREKMDDLEESMQAVLNSAARELGLEAGKTVKLESNAMLGFYLRVTCKEEKGLRNNKKFTTLDVQKNGVRFTNSKLSSLNEEYTRNKEEYEEAQNAIVKEIINIASGYVDPLQTLSDVIAQLDAVVSLALASVSAPVPYVRPRILDE-GCRRLELVQARHPCMETDADTAFIPNDVSFVQGERSFYIITGPNMGGKSTYIRQVGVIALMAQIGCFVPCEKAELSVTDSILARVGAGDSQVKGVSTFMSEMLETAAILRSATENSLIIIDELGRGTSTYDGFGLAWAISEHIASKISCFCLFATHFHELTALASQQPSVHNLHVTALTTHNTLTMLYRVKAGVCDQSFGIHVAELACFPPAVLAVAREKAEELEEFQEPMGNQQEE 863          
BLAST of Msh2 vs. Ensembl Medaka
Match: msh3 (mutS homolog 3 [Source:NCBI gene;Acc:101156254])

HSP 1 Score: 239.195 bits (609), Expect = 2.074e-65
Identity = 213/738 (28.86%), Postives = 349/738 (47.29%), Query Frame = 1
Query:  490 FEESFTGYEQLANLSSALFQLNCRECLIPNDTRPE----LLAVKN-AVQSAGLLVTEVKKSF-FSSENVMNSILKLICKTKLNNENTVLKLVDTEGAETIGCLGSVITYLDLAN------DESFFNFFDVQTFKLDNYMRVGEQCSRALNILPSPNDLRKHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLINDNKLRGCLYEENLRRIPDLQRITRRLQRNKGNLQDIYKLYVALRQASDMLNLLNEHNGPYKCIIQSELSSVI-QEILKDTENFIQMFTSFFDF--EAVKNHEFKVKCDVDES----LKECENSMITLKSQMETESSRVSDKLGIESTKQLKFESSNSLGYYMRVSRKDENVLRNKSFISIIETLKDGVKFHSTQM------TLMNESYLQHXXXXXXXXXXXXXXXMKITNKYVGSLHQLSSII---AKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVEM----QNNMSYIANDISFDESRTFQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIHCN----------VNNLHVTAQT----IGNELI-FMYKVEEGPAVRSYGIEVAKASGLPDESIKLAKLKLSEYENLMEWDSNHSEKL 2562
            F + F      + L S + ++N  E L+P+D   E    LL+V N + Q+      E + S  F   + +N++ +  C+++  +  ++ ++   E +  I CLG +I YL   N       ES F     ++      M +     R L IL +  D     SL+ +L+  RT  G RL+ +W+ QPL D+  I+ R D V+ ++  +       +  L R+PDL+R    +   K + Q+ Y +       S  L+ L      +   I+S+  SV+ + +L DT + +    +F +   E       K +   D S    L+E    +  + S+++            E  K ++         Y+ VS ++  +    S  S + +  D VK  ST+        L+ E Y + ++  E+       E     +++    H +   I   A +D L SLA +     G Y RPKV +D       +++ RHP +++    QN       D+  D  RT  IITGPNMGGKS+YIR + LI +MAQIGSFVP   A + + D I TR+GA D    G STFM E+ + S I+  AT +SL+I+DELGRGTST DG  +A++  E+    +K+F+ F TH+  L +L +++ +          +N  H+++ T    +  E I F+Y + EG A +SYG+ VAK + +PD  +  A  K  E E+ +E      ++L
Sbjct:  364 FLDCFPDGSSRSELESRILKINPVEILVPSDLSEETCRLLLSVTNGSFQADDRARVERRDSAQFEYTSAINTVTQFYCRSQQEDSRSLWRVASFE-SPVICCLGPLIQYLQEFNLERVLRSESSFQRLSCES----EAMILNAATLRNLEILNNQTDRGVRGSLFWVLDHSRTPFGRRLMRKWVSQPLTDLQRISERQDAVQEIMESDSPILDSVKSLLPRLPDLERGICSIYHKKSSTQEFYLI-------SSHLSRLGLQLQSWIPAIRSQTRSVLLRSVLLDTPDLLAPAHTFLNVLNEKAARSGNKTELFSDLSGFPVLQERTKQIHFVLSEIQ------------EHLKDIRMVLKAPTLNYITVSGQEFLIEVKNSLSSTVPS--DWVKISSTKAVGRYHSPLLVERYKKLQQLREQLLLDCQREWTDFLDQFGEHYHTMKRAISHLATIDCLFSLAEV--AQQGGYCRPKVCEDQPQ--IMIRDGRHPAIDLLMGEQNQFVPNHTDLQGDGKRTM-IITGPNMGGKSSYIRQVALICIMAQIGSFVPASEACLGLLDGIYTRMGASDNIYKGRSTFMEELTEASEIISRATERSLVILDELGRGTSTHDGIAIAYATLEYFIRHVKSFTLFVTHYPPLCELERMYPDHVSNFHMAFLLNETHISSDTKDGDVQPEFITFLYNLTEGAAGQSYGLNVAKLADVPDPILCTAARKAQELESAVEARRRSKKRL 1070          
BLAST of Msh2 vs. Ensembl Medaka
Match: msh4 (mutS homolog 4 [Source:NCBI gene;Acc:101160275])

HSP 1 Score: 206.453 bits (524), Expect = 4.308e-55
Identity = 171/584 (29.28%), Postives = 285/584 (48.80%), Query Frame = 1
Query:  922 DLRKHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLINDNKL------RGCLYEENLRRIPDLQRITRR--LQRNKGNLQDIYKLYVALRQASDMLNLLNEHNGPYKCIIQSELSSVIQEILKDTENFIQMFTSFFDFEAVKNHEFKVKCDVDESLKECENSMITLKSQMETESSRVSDKLGIESTKQLKFESSNSLGYYMRVSRKDENVLRNKSFIS---IIETLKDGVKFHSTQMTLMNESYLQHXXXXXXXXXXXXXXXMKITNKYVGSLHQLSSIIAKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVEMQNNMSYIANDISFDESRTFQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIHCNVNNLHVTAQ------TIGNELIFMYKVEEGPA-VRSYGIEVAKASGLPDESIKLAKLKLSEY-ENLMEWDSNHSEK---------LAATRNALME 2589
            D R   +L G+LN  +T  G R L   I +PL++V+ IN RLD V+ L+ D +L        C + +  R +  L +I ++  +Q  +  +  + +L   L     +  +    N P    +  +LSS+   I  DT           +    K   + V+ +++E L     +   +   +    +++ +K G+     ++   S S G+++++ + D +VL   S       +   K+   F +  +  MN    +  R+       +I +++   + ++  L++LS  ++ LD+L SLA   C     Y RP+  D        +K  RHP++E        +N+    E   F IITGPNM GKSTY++ + L  +MAQIGSFVP + A   +  +I TRIG  D   T  S+FM EM +IS+I+  A+ +SLIIIDELGRGTS  +G G+  S+ E +   LKAF+ FATHF EL  L  ++ NV N H+  Q      T    +++ Y ++ G +  R YG+  A+ + LP   I+ A+   S+  + LM +  +H ++         L A RN+ ++
Sbjct:  245 DHRSEHTLLGVLNHTKTPGGARRLRSNILEPLVNVDTINMRLDAVQELLQDEELFFGLKNAICHFLDVDRLLSVLVQIPKQETVQAAEAKITHVIQLKHTLDLVPQLRTVFKNCNTP----LLKQLSSIKTVINPDT----MYLKGSLNMRTQKC--YAVRPNINEFLDIARRAYTEIVDDIAVLVNQMGEKYGLP----MRTSFSTSRGFFIQL-KLDGSVLPRGSLPPECIKVTKHKNNYCFTTADLMKMNGRCDEALREIFHMSYVVICQLLSTIHGHIHCLYKLSDAVSMLDMLLSLAN-ACTI-SDYVRPEFTD-----TLAIKQGRHPILERMARQQPTSNNAYISEGSNFVIITGPNMSGKSTYLKQVALCQIMAQIGSFVPAEYASFRLAGQIFTRIGVDDDFETNSSSFMLEMKEISYIIHNASDRSLIIIDELGRGTSAEEGVGICHSVCEFLLG-LKAFTLFATHFLELCQLESLYPNVENQHMEVQHTRSGDTGVEHVVYTYLLKRGCSEERLYGLRAAEMTALPPNIIQEARTIASKVSQQLMVYPKSHRQRALYRLATRLLQAARNSRLD 805          
BLAST of Msh2 vs. Ensembl Medaka
Match: msh4 (mutS homolog 4 [Source:NCBI gene;Acc:101160275])

HSP 1 Score: 201.06 bits (510), Expect = 3.400e-53
Identity = 162/549 (29.51%), Postives = 268/549 (48.82%), Query Frame = 1
Query:  922 DLRKHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLINDNKL------RGCLYEENLRRIPDLQRITRR--LQRNKGNLQDIYKLYVALRQASDMLNLLNEHNGP----YKCIIQSELSSVIQEILKDTENFIQMFTSFFDFEAVKNHEFKVKCDVDESLKECENSMITLKSQMETESSRVSDKLGIESTKQLKFESSNSLGYYMRVSRKDENVLRNKSFIS---IIETLKDGVKFHSTQMTLMNESYLQHXXXXXXXXXXXXXXXMKITNKYVGSLHQLSSIIAKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVEMQNNMSYIANDISFDESRTFQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIHCNVNNLHVTAQ------TIGNELIFMYKVEEGPA-VRSYGIEVAKASGLPDESIKLAK 2502
            D R   +L G+LN  +T  G R L   I +PL++V+ IN RLD V+ L+ D +L        C + +  R +  L +I ++  +Q  +  +  + +L   L     +  +    N P    Y   ++     +I E +K   N   M+             + V+ +++E L     +   +   +    +++ +K G+     ++   S S G+++++ + D +VL   S       +   K+   F +  +  MN    +  R+       +I +++   + ++  L++LS  ++ LD+L SLA   C     Y RP+  D        +K  RHP++E        +N+    E   F IITGPNM GKSTY++ + L  +MAQIGSFVP + A   +  +I TRIG  D   T  S+FM EM +IS+I+  A+ +SLIIIDELGRGTS  +G G+  S+ E +   LKAF+ FATHF EL  L  ++ NV N H+  Q      T    +++ Y ++ G +  R YG+  A+ + LP   I+ A+
Sbjct:  291 DHRSEHTLLGVLNHTKTPGGARRLRSNILEPLVNVDTINMRLDAVQELLQDEELFFGLKNAICHFLDVDRLLSVLVQIPKQETVQAAEAKITHVIQLKHTLDLVPQLRTVFKNCNTPLLKAYSSTLEDNRFDMILEQIKTVINPDTMYLKG-SLNMRTQKCYAVRPNINEFLDIARRAYTEIVDDIAVLVNQMGEKYGLP----MRTSFSTSRGFFIQL-KLDGSVLPRGSLPPECIKVTKHKNNYCFTTADLMKMNGRCDEALREIFHMSYVVICQLLSTIHGHIHCLYKLSDAVSMLDMLLSLAN-ACTI-SDYVRPEFTD-----TLAIKQGRHPILERMARQQPTSNNAYISEGSNFVIITGPNMSGKSTYLKQVALCQIMAQIGSFVPAEYASFRLAGQIFTRIGVDDDFETNSSSFMLEMKEISYIIHNASDRSLIIIDELGRGTSAEEGVGICHSVCEFLLG-LKAFTLFATHFLELCQLESLYPNVENQHMEVQHTRSGDTGVEHVVYTYLLKRGCSEERLYGLRAAEMTALPPNIIQEAR 825          
BLAST of Msh2 vs. Ensembl Medaka
Match: msh3 (mutS homolog 3 [Source:NCBI gene;Acc:101156254])

HSP 1 Score: 180.259 bits (456), Expect = 4.425e-46
Identity = 102/257 (39.69%), Postives = 150/257 (58.37%), Query Frame = 1
Query: 1822 YARPKVVDDCKTRVFKVKNCRHPLVEM----QNNMSYIANDISFDESRTFQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIHCN----------VNNLHVTAQT----IGNELI-FMYKVEEGPAVRSYGIEVAKASGLPDESIKLAKLKLSEYENLME 2535
            +  PKV +D       +++ RHP +++    QN       D+  D  RT  IITGPNMGGKS+YIR + LI +MAQIGSFVP   A + + D I TR+GA D    G STFM E+ + S I+  AT +SL+I+DELGRGTST DG  +A++  E+    +K+F+ F TH+  L +L +++ +          +N  H+++ T    +  E I F+Y + EG A +SYG+ VAK + +PD  +  A  K  E E+ +E
Sbjct:  772 FLEPKVCEDQPQ--IMIRDGRHPAIDLLMGEQNQFVPNHTDLQGDGKRTM-IITGPNMGGKSSYIRQVALICIMAQIGSFVPASEACLGLLDGIYTRMGASDNIYKGRSTFMEELTEASEIISRATERSLVILDELGRGTSTHDGIAIAYATLEYFIRHVKSFTLFVTHYPPLCELERMYPDHVSNFHMAFLLNETHISSDTKDGDVQPEFITFLYNLTEGAAGQSYGLNVAKLADVPDPILCTAARKAQELESAVE 1025          

HSP 2 Score: 76.6406 bits (187), Expect = 8.965e-14
Identity = 75/298 (25.17%), Postives = 135/298 (45.30%), Query Frame = 1
Query:  490 FEESFTGYEQLANLSSALFQLNCRECLIPNDTRPE----LLAVKN-AVQSAGLLVTEVKKSF-FSSENVMNSILKLICKTKLNNENTVLKLVDTEGAETIGCLGSVITYLDLAN------DESFFNFFDVQTFKLDNYMRVGEQCSRALNILPSPNDLRKHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLINDNKLRGCLYEENLRRIPDLQRITRRLQRNKGNLQDIYKLYVALRQASDMLNLLNEHNGPYKCIIQSELSSV-IQEILKDTENFIQMFTSFFD 1344
            F + F      + L S + ++N  E L+P+D   E    LL+V N + Q+      E + S  F   + +N++ +  C+++  +  ++ ++   E +  I CLG +I YL   N       ES F     ++      M +     R L IL +  D     SL+ +L+  RT  G RL+ +W+ QPL D+  I+ R D V+ ++  +       +  L R+PDL+R    +   K + Q+ Y +       S  L+ L      +   I+S+  SV ++ +L DT + +    +F +
Sbjct:  364 FLDCFPDGSSRSELESRILKINPVEILVPSDLSEETCRLLLSVTNGSFQADDRARVERRDSAQFEYTSAINTVTQFYCRSQQEDSRSLWRVASFE-SPVICCLGPLIQYLQEFNLERVLRSESSFQRLSCES----EAMILNAATLRNLEILNNQTDRGVRGSLFWVLDHSRTPFGRRLMRKWVSQPLTDLQRISERQDAVQEIMESDSPILDSVKSLLPRLPDLERGICSIYHKKSSTQEFYLI-------SSHLSRLGLQLQSWIPAIRSQTRSVLLRSVLLDTPDLLAPAHTFLN 649          
BLAST of Msh2 vs. Planmine SMEST
Match: SMESG000016751.1 (SMESG000016751.1)

HSP 1 Score: 1790.01 bits (4635), Expect = 0.000e+0
Identity = 884/884 (100.00%), Postives = 884/884 (100.00%), Query Frame = 1
Query:   10 MDELTNSFSLFWNSLGDKPNSTIRFFDRQDYYTVHFEDAEMLARSYYKSMEILKYFRRDSVSSPYINISKSNSDGVFKYLLIANQYKVEVYSNNKSHDSWNLDFVATPGNLEKYQDILFKDVELVSSNSLLGLNIKRINDDYRIFLGFCDLDNGIFMIGGFEESFTGYEQLANLSSALFQLNCRECLIPNDTRPELLAVKNAVQSAGLLVTEVKKSFFSSENVMNSILKLICKTKLNNENTVLKLVDTEGAETIGCLGSVITYLDLANDESFFNFFDVQTFKLDNYMRVGEQCSRALNILPSPNDLRKHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLINDNKLRGCLYEENLRRIPDLQRITRRLQRNKGNLQDIYKLYVALRQASDMLNLLNEHNGPYKCIIQSELSSVIQEILKDTENFIQMFTSFFDFEAVKNHEFKVKCDVDESLKECENSMITLKSQMETESSRVSDKLGIESTKQLKFESSNSLGYYMRVSRKDENVLRNKSFISIIETLKDGVKFHSTQMTLMNESYLQHXXXXXXXXXXXXXXXMKITNKYVGSLHQLSSIIAKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVEMQNNMSYIANDISFDESRTFQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIHCNVNNLHVTAQTIGNELIFMYKVEEGPAVRSYGIEVAKASGLPDESIKLAKLKLSEYENLMEWDSNHSEKLAATRNALMEFCLKDLVKDSIDFPVFVKMLRDKL 2661
            MDELTNSFSLFWNSLGDKPNSTIRFFDRQDYYTVHFEDAEMLARSYYKSMEILKYFRRDSVSSPYINISKSNSDGVFKYLLIANQYKVEVYSNNKSHDSWNLDFVATPGNLEKYQDILFKDVELVSSNSLLGLNIKRINDDYRIFLGFCDLDNGIFMIGGFEESFTGYEQLANLSSALFQLNCRECLIPNDTRPELLAVKNAVQSAGLLVTEVKKSFFSSENVMNSILKLICKTKLNNENTVLKLVDTEGAETIGCLGSVITYLDLANDESFFNFFDVQTFKLDNYMRVGEQCSRALNILPSPNDLRKHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLINDNKLRGCLYEENLRRIPDLQRITRRLQRNKGNLQDIYKLYVALRQASDMLNLLNEHNGPYKCIIQSELSSVIQEILKDTENFIQMFTSFFDFEAVKNHEFKVKCDVDESLKECENSMITLKSQMETESSRVSDKLGIESTKQLKFESSNSLGYYMRVSRKDENVLRNKSFISIIETLKDGVKFHSTQMTLMNESYLQHRRDYEEYERSIIEEIMKITNKYVGSLHQLSSIIAKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVEMQNNMSYIANDISFDESRTFQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIHCNVNNLHVTAQTIGNELIFMYKVEEGPAVRSYGIEVAKASGLPDESIKLAKLKLSEYENLMEWDSNHSEKLAATRNALMEFCLKDLVKDSIDFPVFVKMLRDKL
Sbjct:    1 MDELTNSFSLFWNSLGDKPNSTIRFFDRQDYYTVHFEDAEMLARSYYKSMEILKYFRRDSVSSPYINISKSNSDGVFKYLLIANQYKVEVYSNNKSHDSWNLDFVATPGNLEKYQDILFKDVELVSSNSLLGLNIKRINDDYRIFLGFCDLDNGIFMIGGFEESFTGYEQLANLSSALFQLNCRECLIPNDTRPELLAVKNAVQSAGLLVTEVKKSFFSSENVMNSILKLICKTKLNNENTVLKLVDTEGAETIGCLGSVITYLDLANDESFFNFFDVQTFKLDNYMRVGEQCSRALNILPSPNDLRKHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLINDNKLRGCLYEENLRRIPDLQRITRRLQRNKGNLQDIYKLYVALRQASDMLNLLNEHNGPYKCIIQSELSSVIQEILKDTENFIQMFTSFFDFEAVKNHEFKVKCDVDESLKECENSMITLKSQMETESSRVSDKLGIESTKQLKFESSNSLGYYMRVSRKDENVLRNKSFISIIETLKDGVKFHSTQMTLMNESYLQHRRDYEEYERSIIEEIMKITNKYVGSLHQLSSIIAKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVEMQNNMSYIANDISFDESRTFQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIHCNVNNLHVTAQTIGNELIFMYKVEEGPAVRSYGIEVAKASGLPDESIKLAKLKLSEYENLMEWDSNHSEKLAATRNALMEFCLKDLVKDSIDFPVFVKMLRDKL 884          
BLAST of Msh2 vs. Planmine SMEST
Match: SMESG000019325.1 (SMESG000019325.1)

HSP 1 Score: 163.31 bits (412), Expect = 1.884e-44
Identity = 100/304 (32.89%), Postives = 165/304 (54.28%), Query Frame = 1
Query: 1822 YARPKVVDDCKTRVFKVKNCRHPLVEMQNNMSYIANDISFDESRTFQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIHCNVNNLHVTAQTIG------NELIFMYKVEEGPAVR-SYGIEVAKASGLPD----ESIKLAKLKLSEYENLMEWDSNHSEKLAATR-----NALMEFCLKDLVKDSIDFPVFVKMLRDKL*LSIDRAN 2685
            Y RP+  D        +KNCR+PL++  +N   I+N +       F I+TG NM GKS Y+R I L+ +M QIG F+P + A   + D + TRIG  D   +  STF  EM ++S+I+ T T  SL++IDELGRGTS  +G G+ ++I EH+  + KAF   ATHF EL+ L  ++ NV N++   + +       N L+F YK   G     +  +++AK S LP     E+ K+        E ++E +  ++  +A+       +A +E+  K++  D+ +    +K L+++  ++ ++ N
Sbjct:    4 YIRPEFTD-----TLAIKNCRNPLLDRLSNKETISNHVYAANLSNFTIVTGANMSGKSMYLRQIALVQIMGQIGCFIPAEYASFRLSDHLFTRIGVDDDIQSNSSTFTIEMREMSYIINTITDNSLVLIDELGRGTSFDEGLGICFAICEHLL-QTKAFIFIATHFRELSKLEILYPNVQNVNFEVKNLSESDGDENHLLFTYKCVRGVCPDFTNAMKLAKLSNLPKQLLFEAEKIYGRLGDSNELIIEENEKNTNSIASDYEICKLSAKIEYLAKNVTVDTPEVNFCLKSLQNQCRVTFEKLN 301          
BLAST of Msh2 vs. Planmine SMEST
Match: SMESG000073017.1 (SMESG000073017.1)

HSP 1 Score: 155.606 bits (392), Expect = 2.158e-38
Identity = 166/617 (26.90%), Postives = 275/617 (44.57%), Query Frame = 1
Query:  922 DLRKHDSLYGL-------LNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLIN-DNKLRGCLYEENLRRIPDLQRITRR-----LQRNKGNLQD----IYK-LYVALRQASDMLNLLNEHNGPYKC--------IIQSELSSVIQEIL-----------KDTENFIQMFTSFFDFEAVKNH-----EFKVKCDVDESLKECENSMITLKSQMETESSRVSDKLGIESTKQLKFESSNSLGYYMRVSRKDENVLRNKSFISIIETLKDGVKFHSTQMTLMNESYLQHXXXXXXXXXXXXXXXM-KITNKYVGSLHQLSSII---AKLDVLCSLATMVCGAPG-TYARPKV--VDDCKTRVFKVKNCRHPLVEMQNNMSYIANDISF-----DESRTFQ----IITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEI-SIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEHIATELKAFSAFATHFHELTDLSKIHCNVNNLHVTAQT--------------IGNEL-----IFMYKVEEGPAVRSYGIEVAKASGLPDESI--KLAKLKLSEYENLM 2532
            DL K+ SL G+       L+   TA G RLL+QWI  PL D + I  R   ++ LI  D  L     + NL+  PDL+++  +     L ++  +  D    +Y+ L  + R+ +D +N L   +   K         + Q+  S ++++I+            D    I  F + FD E  K +     E  +  D DES+   +     L   +E +   ++  +    T + +F+         +V               I  + + G K +   +T+  E  L+   + E+    +++ IM KI  K+     Q + +I   A+ D L SL +   G  G    RP++  ++        +   R P      +  +I+N I       + +R       ++TGPNMGGKST +R   LI +++Q+G +VP +G  I +  DR+ TR GA D   +G ST   EM + + IL   +  S ++IDELGRGT+T+DG  LA+SI + IA      + F+THFH+L +  +I  N+   H+                  + N L      F+YK+  G   +SYG   A+ + +P++ I   L K K+ E E L+
Sbjct:  575 DLLKNSSLGGIDGTLLERLDFSLTAFGRRLLIQWIATPLCDPDKIIERQKAIKELIELDANLSNI--KNNLKSCPDLEKLVAKIHVLGLSKSVSDHPDSRAVLYEGLLYSRRKITDFVNTLTAFDNIIKIQLEFTRMHVEQNIQSKLLRKIMLHSKDSKIGEFPDISEIISFFKTAFDQENAKKNGKIIPESGIDADYDESVALIKEIERDLAEYLEKQKKIINSNINFFGTGKNRFQLEIPESKCSKVPS-----------TYIASSQRKGFKRY---LTVEIEGLLKKLINAEDKRDLVLKNIMSKIFAKFDEHYFQWTQVINSIAQFDALLSLTSFSRGLDGGPMTRPEIRHINPGDKPFLIITEGRFPCKAKTQSGEFISNTIKLGSLLMNSNRNLDNPVMLLTGPNMGGKSTLMRQTALIIILSQLGCYVPAEGPVILTPVDRLFTRQGANDSIGSGQSTLQVEMNEAALILSYMSPHSFLLIDELGRGTATYDGCALAFSILKRIADSCSPRTIFSTHFHKLLEEKEIGDNLQISHMACMIEDDNDDDVGNNECHLDNNLKLQNITFLYKLTHGGCPKSYGFNAARLANIPEQIILNGLKKAKIFEEETLI 1175          
BLAST of Msh2 vs. Planmine SMEST
Match: SMESG000006277.1 (SMESG000006277.1)

HSP 1 Score: 121.324 bits (303), Expect = 4.398e-28
Identity = 155/620 (25.00%), Postives = 264/620 (42.58%), Query Frame = 1
Query:  799 LDLANDESFFNFFDVQTFKLDNYMRVGEQCSRALNIL-----PS------PNDLRKHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLIN-DNKLRGCLYEENLRRIPDLQRITRRLQRNKGNLQDIYKLYVALRQASDMLNLLNEHNGPYKCIIQSELSSVIQEILKDTENFIQMF-TSFFDFEAV-KNHEFKVKCDVDESLKECENSMITLKSQMET--------------------------------ESSRVSDKLGIESTKQLKFESSNSLGYYMRVSRKDENVLRNKSFISIIETLKDGVKFHSTQMTLMNESYLQHXXXXXXXXXXXXXXXMKITNKYVGSLHQLSSIIAKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVEMQNNMSYIANDI-SFDESRTFQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEH-IATELKAFSAF-ATHFHEL----TDLSKIHCNVNNLHVTAQTIGNELIFMYKVEEGPAVRSYGIEVAKASGLPDESIKLA 2499
            ++L ++ S     DVQ +     M + E   +AL+I      PS        D ++  S++ LLN C +     +L  W+++PL D+++I  RLD V+   N  N+    +    L+ + ++++I  R++ +   L D   L  ++     +  + +    P       E+   I+    D    I  + T   D E + K   F VK  VD  L E ++    L   +                                  E++    K+ I   + L F  +N++ Y    ++K      +K F  I+  +KD     ++ M  + ES L+                      Y   L     ++ +LD L SLA       GT  RP      +    K++N RHPL E+ +N  +I N   S D      II+G N  GKS Y++ IG++ V+AQIGSFVP     ++  + ++TR+ + +  L+G+STFM ++  IS   K A + S I+IDE G+G     G  L  +     +A + +    F  THFH L     DL K+     N +V      ++LI++Y++ +G    S+ I+ A+   + D  ++ A
Sbjct:   26 VELESEISKIPVLDVQIYTTAKTMFIDENSLKALDIFNKVSHPSGFKQGVKKDTKEGLSIFHLLNNCHSKMASDMLHSWLRRPLTDISMIQKRLDCVDFFQNSQNQDVLQILLRKLKGVGNIKQILLRMKNSTALLPDWNVLIQSIAGLISIFEIFSAIKEPL------EIKQKIEAKFTDKLYLIASWITKIIDTEGIEKQKRFVVKEGVDPYLDEKKSKYYHLPDLLSALAEEELKGFNNDIQICGIVYLPQVGYLLTIPIENNENEQKINIPGMEYL-FSMNNAVYYKNYTTKK-----LDKEFGDILYEIKD---LETSIMHCLQESILE----------------------YTHMLLNCLDLVLELDCLLSLAIAARQIGGT--RPLFETSGE---IKIENGRHPLQEVFSN-PFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRLKSLESSLSGLSTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHIFVVTHFHRLFSLIQDLPKVQ--FKNFNVIEDK-HSQLIYLYQLVDGHIECSHAIQAARLVNVSDNILQRA 599          
BLAST of Msh2 vs. Planmine SMEST
Match: SMESG000006277.1 (SMESG000006277.1)

HSP 1 Score: 119.398 bits (298), Expect = 1.614e-27
Identity = 151/592 (25.51%), Postives = 263/592 (44.43%), Query Frame = 1
Query:  799 LDLANDESFFNFFDVQTFKLDNYMRVGEQCSRALNIL-----PS------PNDLRKHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLIN-DNKLRGCLYEENLRRIPDLQRITRRLQRNKGNLQDIYKLYVALRQASDMLNLLNEHNGPYKCIIQSELSSVIQEILKDTENFIQMF-TSFFDFEAV-KNHEFKVKCDVDESLKECENSMITLKSQM----ETESSRVSDKLGIESTKQLKFESSNSLGYYMRVSRKDENVLRNKSFISIIETLKDGVKFHSTQMTLMNESYLQHXXXXXXXXXXXXXXXMKITNKYVGSLHQLSSIIAKLDVLCSLATMVCGAPGTYARPKVVDDCKTRVFKVKNCRHPLVEMQNNMSYIANDI-SFDESRTFQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWSISEH-IATELKAFSAF-ATHFHEL----TDLSKIHCNVNNLHVTAQTIGNELIFMYKVEEGPAVRSYGIEVAKASGLPDESIKLA 2499
            ++L ++ S     DVQ +     M + E   +AL+I      PS        D ++  S++ LLN C +     +L  W+++PL D+++I  RLD V+   N  N+    +    L+ + ++++I  R++ +   L D   L  ++     +  + +    P       E+   I+    D    I  + T   D E + K   F VK  VD  L E ++    L   +    E E    ++ + I     L       +GY + +  ++     N+  I+I      G+++     ++ N  Y ++          +      I  +Y   L     ++ +LD L SLA       GT  RP      +    K++N RHPL E+ +N  +I N   S D      II+G N  GKS Y++ IG++ V+AQIGSFVP     ++  + ++TR+ + +  L+G+STFM ++  IS   K A + S I+IDE G+G     G  L  +     +A + +    F  THFH L     DL K+     N +V      ++LI++Y++ +G    S+ I+ A+   + D  ++ A
Sbjct:   26 VELESEISKIPVLDVQIYTTAKTMFIDENSLKALDIFNKVSHPSGFKQGVKKDTKEGLSIFHLLNNCHSKMASDMLHSWLRRPLTDISMIQKRLDCVDFFQNSQNQDVLQILLRKLKGVGNIKQILLRMKNSTALLPDWNVLIQSIAGLISIFEIFSAIKEPL------EIKQKIEAKFTDKLYLIASWITKIIDTEGIEKQKRFVVKEGVDPYLDEKKSKYYHLPDLLSALAEEELKGFNNDIQICGIVYLP-----QVGYLLTIPIENN---ENEQKINI-----PGMEY---LFSMNNAVYYKNYTTKNLETSIMHCLQESIL-EYTHMLLNCLDLVLELDCLLSLAIAARQIGGT--RPLFETSGE---IKIENGRHPLQEVFSN-PFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRLKSLESSLSGLSTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHIFVVTHFHRLFSLIQDLPKVQ--FKNFNVIEDK-HSQLIYLYQLVDGHIECSHAIQAARLVNVSDNILQRA 585          
The following BLAST results are available for this feature:
BLAST of Msh2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MSH20.000e+040.67mutS homolog 2 [Source:HGNC Symbol;Acc:HGNC:7325][more]
MSH20.000e+040.67mutS homolog 2 [Source:HGNC Symbol;Acc:HGNC:7325][more]
MSH20.000e+040.67mutS homolog 2 [Source:HGNC Symbol;Acc:HGNC:7325][more]
MSH20.000e+040.67mutS homolog 2 [Source:HGNC Symbol;Acc:HGNC:7325][more]
MSH20.000e+040.67mutS homolog 2 [Source:HGNC Symbol;Acc:HGNC:7325][more]
back to top
BLAST of Msh2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
msh-22.601e-11632.76MSH (MutS Homolog) family [Source:UniProtKB/TrEMB... [more]
him-141.051e-4527.45MutS protein homolog him-14 [Source:UniProtKB/Swi... [more]
msh-61.018e-4427.41MSH (MutS Homolog) family [Source:UniProtKB/TrEMB... [more]
msh-54.123e-3524.18MutS protein homolog 5 [Source:UniProtKB/Swiss-Pr... [more]
msh-51.671e-2831.54MutS protein homolog 5 [Source:UniProtKB/Swiss-Pr... [more]
back to top
BLAST of Msh2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
spel11.125e-16735.88gene:FBgn0015546 transcript:FBtr0344018[more]
spel11.125e-16735.88gene:FBgn0015546 transcript:FBtr0344019[more]
spel11.125e-16735.88gene:FBgn0015546 transcript:FBtr0080630[more]
spel11.125e-16735.88gene:FBgn0015546 transcript:FBtr0309281[more]
Msh66.514e-4338.10gene:FBgn0036486 transcript:FBtr0075646[more]
back to top
BLAST of Msh2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
msh20.000e+039.63mutS homolog 2 (E. coli) [Source:ZFIN;Acc:ZDB-GENE... [more]
msh20.000e+039.63mutS homolog 2 (E. coli) [Source:ZFIN;Acc:ZDB-GENE... [more]
msh42.406e-5629.55mutS homolog 4 [Source:ZFIN;Acc:ZDB-GENE-131121-64... [more]
msh31.253e-5527.68mutS homolog 3 (E. coli) [Source:ZFIN;Acc:ZDB-GENE... [more]
msh35.688e-5427.64mutS homolog 3 (E. coli) [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Msh2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MSH20.000e+040.21mutS homolog 2 [Source:NCBI gene;Acc:100380043][more]
MSH20.000e+040.83mutS homolog 2 [Source:NCBI gene;Acc:100380043][more]
MSH20.000e+040.71mutS homolog 2 [Source:NCBI gene;Acc:100380043][more]
MSH20.000e+040.07mutS homolog 2 [Source:NCBI gene;Acc:100380043][more]
MSH20.000e+040.71mutS homolog 2 [Source:NCBI gene;Acc:100380043][more]
back to top
BLAST of Msh2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Msh20.000e+040.19mutS homolog 2 [Source:MGI Symbol;Acc:MGI:101816][more]
Msh34.343e-6227.45mutS homolog 3 [Source:MGI Symbol;Acc:MGI:109519][more]
Msh31.156e-6027.41mutS homolog 3 [Source:MGI Symbol;Acc:MGI:109519][more]
Msh42.480e-5629.23mutS homolog 4 [Source:MGI Symbol;Acc:MGI:1860077][more]
Msh42.007e-5530.18mutS homolog 4 [Source:MGI Symbol;Acc:MGI:1860077][more]
back to top
BLAST of Msh2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5XXB5|MSH2_CHLAE0.000e+040.55DNA mismatch repair protein Msh2 OS=Chlorocebus ae... [more]
sp|P43246|MSH2_HUMAN0.000e+040.67DNA mismatch repair protein Msh2 OS=Homo sapiens O... [more]
sp|P43247|MSH2_MOUSE0.000e+040.19DNA mismatch repair protein Msh2 OS=Mus musculus O... [more]
sp|Q3MHE4|MSH2_BOVIN0.000e+039.49DNA mismatch repair protein Msh2 OS=Bos taurus OX=... [more]
sp|P54275|MSH2_RAT0.000e+039.35DNA mismatch repair protein Msh2 OS=Rattus norvegi... [more]
back to top
BLAST of Msh2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G1BGJ90.000e+099.89Msh2 (Fragment) OS=Schmidtea mediterranea OX=79327... [more]
A0A0L8HX880.000e+041.24DNA_MISMATCH_REPAIR_2 domain-containing protein OS... [more]
V3ZN410.000e+042.24DNA_MISMATCH_REPAIR_2 domain-containing protein OS... [more]
T1IP550.000e+040.54DNA_MISMATCH_REPAIR_2 domain-containing protein OS... [more]
A0A1S3HMF80.000e+040.52DNA mismatch repair protein Msh2 OS=Lingula unguis... [more]
back to top
BLAST of Msh2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
msh20.000e+039.82mutS homolog 2 [Source:NCBI gene;Acc:103047089][more]
msh39.774e-5525.83mutS homolog 3 [Source:NCBI gene;Acc:103037699][more]
msh39.774e-5525.83mutS homolog 3 [Source:NCBI gene;Acc:103037699][more]
msh41.906e-4941.76mutS homolog 4 [Source:ZFIN;Acc:ZDB-GENE-131121-64... [more]
msh35.975e-4935.76mutS homolog 3 [Source:NCBI gene;Acc:103037699][more]
back to top
BLAST of Msh2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
msh23.627e-6334.87mutS homolog 2 (E. coli) [Source:ZFIN;Acc:ZDB-GENE... [more]
msh35.050e-5526.96mutS homolog 3 (E. coli) [Source:ZFIN;Acc:ZDB-GENE... [more]
msh65.259e-3533.99mutS homolog 6 (E. coli) [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Msh2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
MSH24.165e-15634.62Protein that binds to DNA mismatches; forms hetero... [more]
MSH35.512e-5630.93Mismatch repair protein; forms dimers with Msh2p t... [more]
MSH69.888e-4133.92Protein required for mismatch repair in mitosis an... [more]
MSH18.228e-3734.21DNA-binding protein of the mitochondria; involved ... [more]
MSH42.788e-3325.56Protein involved in meiotic recombination; require... [more]
back to top
BLAST of Msh2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO383197.317e-17741.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO265099.019e-5739.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387994.817e-5329.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352916.790e-4828.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487593.106e-4425.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Msh2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
msh20.000e+039.44mutS homolog 2 [Source:NCBI gene;Acc:101167993][more]
msh32.074e-6528.86mutS homolog 3 [Source:NCBI gene;Acc:101156254][more]
msh44.308e-5529.28mutS homolog 4 [Source:NCBI gene;Acc:101160275][more]
msh43.400e-5329.51mutS homolog 4 [Source:NCBI gene;Acc:101160275][more]
msh34.425e-4639.69mutS homolog 3 [Source:NCBI gene;Acc:101156254][more]
back to top
BLAST of Msh2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016751.10.000e+0100.00SMESG000016751.1[more]
SMESG000019325.11.884e-4432.89SMESG000019325.1[more]
SMESG000073017.12.158e-3826.90SMESG000073017.1[more]
SMESG000006277.14.398e-2825.00SMESG000006277.1[more]
SMESG000006277.11.614e-2725.51SMESG000006277.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30031773
GenBankAEK64794.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031773 ID=SMED30031773|Name=Msh2|organism=Schmidtea mediterranea sexual|type=transcript|length=2701bp
AATTAAAACATGGATGAATTAACAAATAGCTTTTCTTTGTTTTGGAATTC
TCTGGGTGACAAACCGAATTCAACAATTAGATTTTTTGATCGACAAGATT
ATTATACTGTTCACTTTGAAGATGCCGAAATGTTAGCCAGGAGTTATTAT
AAATCCATGGAAATTTTGAAATATTTTCGACGAGACTCTGTTTCTTCACC
TTATATTAATATAAGCAAAAGCAATTCAGACGGAGTGTTCAAATATCTGT
TGATTGCTAACCAATATAAGGTTGAGGTATATAGCAACAATAAATCTCAC
GACTCATGGAATTTGGATTTCGTCGCCACTCCAGGAAACCTCGAAAAATA
TCAAGATATATTATTTAAAGACGTTGAGCTGGTTTCATCCAATAGCCTAT
TAGGATTGAACATTAAGCGAATAAATGACGATTACAGAATATTTTTGGGA
TTTTGTGATTTGGATAATGGAATATTTATGATTGGTGGATTTGAGGAATC
ATTTACTGGCTATGAGCAGTTAGCCAATCTAAGTTCGGCACTGTTTCAAT
TGAATTGTCGTGAATGTCTCATTCCTAATGATACTCGACCCGAACTACTT
GCAGTGAAAAATGCGGTTCAAAGTGCTGGGCTGTTAGTAACGGAAGTGAA
AAAGTCATTTTTTTCATCGGAAAACGTTATGAATTCGATTTTAAAACTTA
TTTGTAAGACAAAATTAAACAATGAAAACACAGTTTTAAAACTCGTCGAT
ACTGAAGGAGCTGAAACTATTGGATGCTTAGGTTCTGTTATCACATATTT
GGATTTAGCCAATGATGAGAGTTTCTTTAACTTTTTCGATGTCCAAACAT
TCAAGTTGGACAATTACATGAGAGTAGGAGAACAATGCAGTAGAGCTTTG
AATATTTTGCCATCTCCAAATGATTTAAGAAAGCACGATAGTTTGTATGG
GCTATTGAATTGCTGCAGAACAGCCTCTGGAGAGAGGCTGTTATTACAAT
GGATTAAGCAGCCCTTGATGGATGTTAATTTGATAAATAACCGACTGGAT
ATTGTAGAAAGCCTTATTAATGATAATAAGTTAAGAGGTTGCCTTTATGA
GGAAAATTTAAGACGCATTCCCGATTTACAAAGAATTACTAGACGACTCC
AAAGAAACAAAGGGAACCTTCAAGATATATATAAACTGTATGTGGCATTA
AGACAAGCATCGGACATGCTAAATCTACTAAATGAACACAACGGTCCTTA
TAAATGCATCATTCAATCAGAATTAAGTTCTGTTATCCAGGAAATACTAA
AAGATACAGAGAATTTTATACAAATGTTCACATCATTTTTTGATTTTGAA
GCTGTAAAAAATCATGAATTTAAAGTGAAGTGTGATGTTGATGAAAGTTT
AAAAGAATGTGAAAATAGTATGATAACTTTAAAATCGCAAATGGAAACAG
AATCTTCAAGGGTTTCTGACAAACTTGGCATAGAGTCAACAAAGCAATTA
AAGTTTGAATCATCAAACAGTCTCGGCTATTATATGCGAGTTTCAAGAAA
GGATGAAAATGTCTTGCGAAACAAGAGTTTTATTTCTATTATAGAAACAC
TTAAAGATGGAGTAAAATTTCATTCTACTCAAATGACTCTAATGAATGAA
TCGTATTTACAACATCGCAGAGATTATGAAGAATATGAGAGAAGCATTAT
TGAAGAAATAATGAAAATAACTAATAAATATGTCGGTTCATTGCACCAGT
TAAGTTCAATTATTGCTAAGCTCGATGTACTGTGTAGTTTAGCTACAATG
GTTTGTGGAGCACCCGGTACATATGCTAGACCAAAAGTAGTTGATGATTG
CAAAACGAGAGTGTTTAAGGTGAAAAACTGCCGCCACCCTCTAGTAGAAA
TGCAAAACAACATGTCTTACATAGCAAACGATATTTCCTTTGACGAATCG
AGAACTTTCCAAATCATTACCGGTCCTAATATGGGTGGCAAATCAACATA
TATTCGATCAATAGGTTTGATCTCTGTGATGGCACAAATAGGCTCGTTTG
TTCCTTGTGATGGAGCAGAAATCAGCATTTTTGATAGAATCATGACGAGA
ATCGGAGCTGGGGATTGCCAATTGACGGGCGTATCGACATTTATGGCAGA
AATGCTGGATATATCCTGGATATTGAAGACTGCTACCTCTAAATCACTGA
TCATTATCGACGAATTGGGCAGAGGAACATCAACATTTGATGGTTTTGGA
CTGGCTTGGTCTATTTCAGAGCATATTGCAACAGAATTGAAAGCATTCAG
TGCCTTTGCGACTCATTTCCACGAGTTGACAGATCTGTCAAAGATTCATT
GCAATGTGAATAATTTACACGTGACTGCACAGACAATTGGAAATGAGTTG
ATTTTCATGTATAAAGTCGAGGAAGGGCCCGCAGTGAGGAGTTACGGTAT
CGAGGTAGCCAAGGCATCTGGACTGCCGGACGAATCTATTAAATTAGCTA
AGCTGAAATTATCTGAATATGAAAACCTGATGGAGTGGGATTCCAATCAT
TCTGAGAAATTGGCAGCAACTAGAAATGCTCTCATGGAATTTTGTCTTAA
AGATCTAGTCAAGGATTCAATCGATTTCCCAGTATTTGTGAAGATGCTTC
GTGATAAATTGTGATTATCGATTGATAGAGCAAATATATATTGATGTTTC
T
back to top

protein sequence of SMED30031773-orf-1

>SMED30031773-orf-1 ID=SMED30031773-orf-1|Name=SMED30031773-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=885bp
MDELTNSFSLFWNSLGDKPNSTIRFFDRQDYYTVHFEDAEMLARSYYKSM
EILKYFRRDSVSSPYINISKSNSDGVFKYLLIANQYKVEVYSNNKSHDSW
NLDFVATPGNLEKYQDILFKDVELVSSNSLLGLNIKRINDDYRIFLGFCD
LDNGIFMIGGFEESFTGYEQLANLSSALFQLNCRECLIPNDTRPELLAVK
NAVQSAGLLVTEVKKSFFSSENVMNSILKLICKTKLNNENTVLKLVDTEG
AETIGCLGSVITYLDLANDESFFNFFDVQTFKLDNYMRVGEQCSRALNIL
PSPNDLRKHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVE
SLINDNKLRGCLYEENLRRIPDLQRITRRLQRNKGNLQDIYKLYVALRQA
SDMLNLLNEHNGPYKCIIQSELSSVIQEILKDTENFIQMFTSFFDFEAVK
NHEFKVKCDVDESLKECENSMITLKSQMETESSRVSDKLGIESTKQLKFE
SSNSLGYYMRVSRKDENVLRNKSFISIIETLKDGVKFHSTQMTLMNESYL
QHRRDYEEYERSIIEEIMKITNKYVGSLHQLSSIIAKLDVLCSLATMVCG
APGTYARPKVVDDCKTRVFKVKNCRHPLVEMQNNMSYIANDISFDESRTF
QIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGA
GDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAW
SISEHIATELKAFSAFATHFHELTDLSKIHCNVNNLHVTAQTIGNELIFM
YKVEEGPAVRSYGIEVAKASGLPDESIKLAKLKLSEYENLMEWDSNHSEK
LAATRNALMEFCLKDLVKDSIDFPVFVKMLRDKL*
back to top
Aliases
The feature 'Msh2' has the following synonyms
Synonym
Msh2
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0006298mismatch repair
GO:0006281DNA repair
GO:0006974cellular response to DNA damage stimulus
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000020protonephridia
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0002089reproductive organ
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR016151DNA_mismatch_repair_MutS_N
IPR036678MutS_con_dom_sf
IPR032642Msh2
IPR036187DNA_mismatch_repair_MutS_sf
IPR007696DNA_mismatch_repair_MutS_core
IPR000432DNA_mismatch_repair_MutS_C
IPR007861DNA_mismatch_repair_MutS_clamp
IPR027417P-loop_NTPase
IPR007860DNA_mmatch_repair_MutS_con_dom
IPR007695DNA_mismatch_repair_MutS-lik_N
IPR011184DNA_mismatch_repair_Msh2
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0030983mismatched DNA binding
GO:0000166nucleotide binding
GO:0003677DNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0032300mismatch repair complex
GO:0032301MutSalpha complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR007696DNA mismatch repair protein MutS, coreSMARTSM00533DNAendcoord: 307..632
e-value: 4.6E-68
score: 242.1
IPR007696DNA mismatch repair protein MutS, corePFAMPF05192MutS_IIIcoord: 295..595
e-value: 6.3E-34
score: 120.3
IPR000432DNA mismatch repair protein MutS, C-terminalSMARTSM00534mutATP5coord: 648..835
e-value: 3.8E-102
score: 355.3
IPR000432DNA mismatch repair protein MutS, C-terminalPFAMPF00488MutS_Vcoord: 651..836
e-value: 1.6E-77
score: 259.8
IPR000432DNA mismatch repair protein MutS, C-terminalPROSITEPS00486DNA_MISMATCH_REPAIR_2coord: 729..745
IPR007861DNA mismatch repair protein MutS, clampPFAMPF05190MutS_IVcoord: 460..553
e-value: 5.1E-13
score: 49.2
IPR016151DNA mismatch repair protein MutS, N-terminalGENE3DG3DSA:3.40.1170.10coord: 2..107
e-value: 1.4E-28
score: 101.0
IPR036678MutS, connector domain superfamilyGENE3DG3DSA:3.30.420.110coord: 108..284
e-value: 5.2E-31
score: 109.8
IPR011184DNA mismatch repair Msh2-typePIRSFPIRSF005813MSH2coord: 2..871
e-value: 3.0E-269
score: 893.4
IPR007860DNA mismatch repair protein MutS, connector domainPFAMPF05188MutS_IIcoord: 143..270
e-value: 4.3E-5
score: 23.8
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 606..871
e-value: 1.1E-98
score: 332.1
NoneNo IPR availableGENE3DG3DSA:1.10.1420.10coord: 308..596
e-value: 9.6E-83
score: 280.3
NoneNo IPR availableGENE3DG3DSA:1.10.1420.10coord: 457..539
e-value: 9.6E-83
score: 280.3
NoneNo IPR availablePANTHERPTHR11361DNA MISMATCH REPAIR PROTEIN MUTS FAMILY MEMBERcoord: 11..848
IPR007695DNA mismatch repair protein MutS-like, N-terminalPFAMPF01624MutS_Icoord: 10..112
e-value: 9.3E-12
score: 45.2
IPR032642DNA mismatch repair protein Msh2PANTHERPTHR11361:SF35DNA MISMATCH REPAIR PROTEIN MSH2coord: 11..848
IPR036187DNA mismatch repair protein MutS, core domain superfamilySUPERFAMILYSSF48334DNA repair protein MutS, domain IIIcoord: 293..597
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 605..839